Zw10 (zw10 kinetochore protein) - Rat Genome Database

Name: Zw10
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Zw10 (zw10 kinetochore protein) Rattus norvegicus

Analyze

Symbol:

Zw10

Name:

zw10 kinetochore protein

RGD ID:

1309197

Description:

Predicted to be involved in several processes, including establishment of mitotic spindle orientation; mitotic metaphase chromosome alignment; and regulation of mitotic cell cycle phase transition. Predicted to be located in several cellular components, including kinetochore; lipid droplet; and spindle. Predicted to be part of Dsl1/NZR complex and RZZ complex. Orthologous to human ZW10 (zw10 kinetochore protein); INTERACTS WITH (+)-schisandrin B; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

centromere/kinetochore protein zw10 homolog; LOC363059; ZW10 homolog (Drosophila), centromere/kinetochore protein; ZW10 homolog, centromere/kinetochore protein; ZW10 homolog, centromere/kinetochore protein (Drosophila); ZW10, kinetochore associated, homolog; ZW10, kinetochore associated, homolog (Drosophila)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ZW10 (zw10 kinetochore protein)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther, PhylomeDB
Mus musculus (house mouse):	Zw10 (zw10 kinetochore protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Zw10 (zw10 kinetochore protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ZW10 (zw10 kinetochore protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ZW10 (zw10 kinetochore protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Zw10 (zw10 kinetochore protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ZW10 (zw10 kinetochore protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ZW10 (zw10 kinetochore protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Zw10 (zw10 kinetochore protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	C11orf86 (chromosome 11 open reading frame 86)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	ZW10 (zw10 kinetochore protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Zw10 (zw10 kinetochore protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zw10 (zw10 kinetochore protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	czw-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Zw10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	zw10	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	58,292,959 - 58,317,881 (+)	NCBI		GRCr8
mRatBN7.2	8	49,396,541 - 49,424,743 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	49,396,545 - 49,421,805 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	54,902,405 - 54,927,272 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	53,181,278 - 53,206,138 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	51,045,529 - 51,070,395 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	53,365,881 - 53,390,742 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	53,365,857 - 53,390,930 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	51,980,064 - 52,005,883 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	52,316,233 - 52,341,095 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	52,335,286 - 52,360,149 (+)	NCBI
Celera	8	48,953,761 - 48,978,510 (+)	NCBI		Celera
Cytogenetic Map	8	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

chromosome 11 partial duplication syndrome (ISO)

intellectual disability (ISO)

osteosarcoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3-dimethoxynaphthalene-1,4-dione (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

2-palmitoylglycerol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

aristolochic acid A (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Bisphenol A diglycidyl ether (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

doxorubicin (ISO)

enzyme inhibitor (ISO)

folic acid (ISO)

inulin (ISO)

isoprenaline (ISO)

ivermectin (ISO)

methimazole (EXP)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

rotenone (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

temozolomide (ISO)

tetrachloromethane (EXP)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell division (IEA)

endoplasmic reticulum to Golgi vesicle-mediated transport (IBA,ISO,ISS)

establishment of mitotic spindle orientation (ISO)

Golgi organization (ISO)

mitotic metaphase chromosome alignment (ISO)

mitotic sister chromatid segregation (ISO,ISS)

mitotic spindle assembly checkpoint signaling (IBA,ISO,ISS)

protein localization to kinetochore (ISO)

protein transport (IEA)

protein-containing complex assembly (ISO,ISS)

regulation of exit from mitosis (ISO,ISS)

Cellular Component

cytosol (IEA,ISO)

Dsl1/NZR complex (ISO)

endoplasmic reticulum (ISO,ISS)

endoplasmic reticulum membrane (IEA)

kinetochore (ISO,ISS)

kinetochore microtubule (ISO,ISS)

lipid droplet (ISO,ISS)

nucleus (ISO,ISS)

RZZ complex (IBA,ISO)

spindle pole (ISO,ISS)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11146660	PMID:11682612	PMID:12477932	PMID:15029241	PMID:15485811	PMID:15489334	PMID:17560939	PMID:19229290	PMID:19468067	PMID:19946888	PMID:20163571	PMID:20462495
PMID:30970241

Genomics

Comparative Map Data

Zw10
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	58,292,959 - 58,317,881 (+)	NCBI		GRCr8
mRatBN7.2	8	49,396,541 - 49,424,743 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	49,396,545 - 49,421,805 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	54,902,405 - 54,927,272 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	53,181,278 - 53,206,138 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	51,045,529 - 51,070,395 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	53,365,881 - 53,390,742 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	53,365,857 - 53,390,930 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	51,980,064 - 52,005,883 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	52,316,233 - 52,341,095 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	52,335,286 - 52,360,149 (+)	NCBI
Celera	8	48,953,761 - 48,978,510 (+)	NCBI		Celera
Cytogenetic Map	8	q23	NCBI

ZW10
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	113,733,187 - 113,773,692 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	113,733,187 - 113,773,735 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	113,603,909 - 113,644,414 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	113,109,119 - 113,149,635 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	113,109,119 - 113,149,635	NCBI
Celera	11	110,756,828 - 110,797,319 (-)	NCBI		Celera
Cytogenetic Map	11	q23.2	NCBI
HuRef	11	109,532,443 - 109,573,027 (-)	NCBI		HuRef
CHM1_1	11	113,487,178 - 113,527,780 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	113,743,514 - 113,784,012 (-)	NCBI		T2T-CHM13v2.0

Zw10
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	48,966,880 - 48,990,075 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	48,966,913 - 48,990,075 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	49,055,576 - 49,078,775 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	49,055,613 - 49,078,775 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	48,863,737 - 48,886,878 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	48,807,564 - 48,830,705 (+)	NCBI		MGSCv36	mm8
Celera	9	46,352,736 - 46,375,856 (+)	NCBI		Celera
Cytogenetic Map	9	A5.3	NCBI
cM Map	9	26.58	NCBI

Zw10
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955412	15,350,285 - 15,391,996 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955412	15,354,918 - 15,391,233 (-)	NCBI	ChiLan1.0	ChiLan1.0

ZW10
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	114,476,266 - 114,517,225 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	115,570,599 - 115,611,545 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	108,611,818 - 108,652,444 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	112,454,637 - 112,494,959 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	112,454,637 - 112,495,316 (-)	Ensembl	panpan1.1		panPan2

ZW10
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	19,496,531 - 19,527,205 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	19,496,611 - 19,527,200 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	19,419,964 - 19,450,401 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	19,517,162 - 19,548,136 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	19,517,176 - 19,573,826 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	19,581,032 - 19,611,948 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	19,481,791 - 19,512,726 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	19,529,918 - 19,560,842 (+)	NCBI		UU_Cfam_GSD_1.0

Zw10
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	95,842,340 - 95,880,186 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936612	825,419 - 860,971 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936612	825,419 - 860,971 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ZW10
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	41,348,896 - 41,400,208 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	41,358,801 - 41,400,254 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

ZW10
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	105,108,531 - 105,152,921 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	105,109,040 - 105,152,862 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666043	20,866,303 - 20,906,831 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Zw10
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624784	9,221,128 - 9,255,284 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624784	9,221,123 - 9,255,294 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Zw10
106 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	118
Count of miRNA genes:	101
Interacting mature miRNAs:	110
Transcripts:	ENSRNOT00000010595
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30856404	75856404	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	41866876	86866876	Rat
11556286	Cm81	Cardiac mass QTL 81		0.01	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	30848154	61290444	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1582222	Epfw2	Epididymal fat weight QTL 2	3.2	0.0005	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	8	31737729	76737729	Rat
1354627	Despr14	Despair related QTL 14		0.0056	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	8	7688955	52688955	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	35582032	80582032	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1300146	Rf17	Renal function QTL 17	2.9		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	8	28242912	73242912	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	29502665	70386295	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	30848154	61290444	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	22662330	67662330	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	40713066	82925667	Rat
1359033	Bp273	Blood pressure QTL 273			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	61290444	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	41866876	75097878	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	35551938	80551938	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
1331744	Bp217	Blood pressure QTL 217	3.398		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	58482492	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
631216	Stl9	Serum triglyceride level QTL 9	4.71	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	8	41867010	70386132	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	16290444	61290444	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
2317030	Wbc5	White blood cell count QTL 5	3.21	0.005	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	8	8736635	53736635	Rat
1331804	Cm30	Cardiac mass QTL 30	3.77443		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	8	28242912	53961020	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
2317032	Ginf2	Gastrointestinal inflammation QTL 2	3.21	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	8	4705810	49705810	Rat
2301416	Bp315	Blood pressure QTL 315		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	7670578	52670578	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
2317036	Livw3	Liver weight QTL 3	2.43	0.01	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	8	4705810	49705810	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat
5684993	Bmd84	Bone mineral density QTL 84	4.1		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	8	42692684	50095447	Rat
2317051	Aia18	Adjuvant induced arthritis QTL 18	2.42		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	8	8736635	53736635	Rat
2317048	Ginf1	Gastrointestinal inflammation QTL 1	3.52	0.005	cecum mucosa thickness (VT:0010234)	enterocolitis severity score (CMO:0002138)	8	4705810	49705810	Rat
1558646	Swd5	Spike wave discharge measurement QTL 5	3.45	0.00036	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	8	14906751	59906751	Rat
2302278	Gluco36	Glucose level QTL 36	4.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	29502665	50095447	Rat
631648	Stl5	Serum triglyceride level QTL 5	4	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	27205715	54998217	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	46531722	99083736	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
2303564	Gluco43	Glucose level QTL 43	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	26130187	71130187	Rat
1598824	Memor4	Memory QTL 4	2.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	8	9712220	53356647	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
1354595	Despr4	Despair related QTL 4	2.16	0.0036	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	8	7688955	52688955	Rat
2303572	Insul13	Insulin level QTL 13	2		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	8	26130187	71130187	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001024801	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429477	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039081724	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063265741	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC097700	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC097452	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000080712 ⟹ ENSRNOP00000071533

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	49,396,545 - 49,421,805 (+)	Ensembl
Rnor_6.0 Ensembl	8	53,365,857 - 53,390,930 (+)	Ensembl

RefSeq Acc Id:

NM_001024801 ⟹ NP_001019972

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	58,293,020 - 58,317,881 (+)	NCBI
mRatBN7.2	8	49,396,541 - 49,421,406 (+)	NCBI
Rnor_6.0	8	53,365,881 - 53,390,742 (+)	NCBI
Rnor_5.0	8	51,980,064 - 52,005,883 (+)	NCBI
RGSC_v3.4	8	52,316,233 - 52,341,095 (+)	RGD
Celera	8	48,953,761 - 48,978,510 (+)	RGD

Sequence:

show sequence

CGGCGAGGCCGCTGGCGGGACCCGAGCTGCGGTGCTGGCTGCTGGAGTGACCTATCCTGTTGGT
GTGGGTACGCTTCGTGGCAATGGCTTCTTTCGTGACGGAAGTCTTGGCCCACTCGGGGAGCCTG
GAGAAGGAGGATCTGGGCACCAGGATCAGCCGTCTGACCCGGCGGGTGGAGGAGATCAAGGGCG
AGGTGTGCAATATGATCAGCAAGAAGTACAGTGAATTCCTGCCTACCATGCAGAGCGCACAGGC
CCTCGTCACCCAGGTGGACACTCTATCCAATGACATCGACCAGCTGAAATCCAGGATAGAGACT
GAGGTCTGTCGGGATCTTCACATATCAACTGTTGAGTTTACGAACTTGAAGCAGCGGCTGGAAA
GAGACTCTGTCGTCCTAAATTTGCTCAAACAGCTGCAAGAGTTTTCTTCTGCTATTGAAGAGTA
TAACAGTGCACTGGCAGAGAAGAAATACATCCCTGCTGCTCGGCTCCTGGAGGAGGCACAGGAA
TGCTTGAAGTTATTAAAATCAAAAAAATGCTTTGACTTAAAAATGTTGAAGTCTCTCAGCATGG
AGCTCACGGTACAGAAGCAGAACATCCTTTACCACCTGGGAGAAGACTGGCAGAAGCTGGTTGT
ATGGAAGTTCCCGCCATCAAAAGATACCAGCAGCTTAGAATCTTGTCTACAAACAGAACTTCAT
TTATGCACTGAGCAGCCCGAGAAGGAGATGACTCCTCTGCCATCCATCAGCTCTGTCCTCTTGG
CGTTTTCTATTCTTGGAGAATTACCCACCAAGCTGAAGTCATTTGGTCAGATGCTGCTGAAGTA
TATACTTAAGCCTCTGGTGACTTGCCCGTCGCTCCATGCTGTGATTGAAAGGCAGCCGAATTCA
GTTAGCATTTGTTTCCAGTCTCTGGCGACGGACTCAGAACATCCACCACCACCCGAAGCTTTTG
CAAAGATCCAGTTGGTATTGGAAGTGCTCCAGAAACAGCTTCTAGATTTGCCTCTTGATGCTGA
CCTAGAAATTGGAAAAGTCCCTGAGATCGTGTTGGCTGAGATGCTTGGTGAGGTGATCTGGGAG
GACCTGTCCGATTGCCTCATCAGAAACTGCTTGGTTTACTCTATTCCCACCAATAGCAGCAAGC
TACAGCAATATGAGGAGATCATACAGTCCACAGAGGAATTTGAAAAGTCCCTAAAAGAGATGAG
ATTTTTAAAAGGAGATACTACTGACTTGCTGAAATATGCTCGCAATATCAATTCTCATTTTGCT
AATAAGAAGTGCCAGGATGTGATTGTGGCGGCTAGACATCTAATGACCTCCGAAATTCACAACA
CCGTGAAGATTGGTCCTGATTGTGAGGAAACCCTACCAGACTTGCCCAGTCCTGATGCCGACCA
CAGGCTACAAGTGCAGGTGTGCAAAGTGCAGTTCACCGATGCCGGAAACTTAGAGCCCGAGACT
TCGCTGGACCCTCGGTCCTTCTCTTTACCCACGTGCCGCATCAGTGAGGCTGTGAAGAAGTTAA
TGGAGCTCGCTTATCAGACTTTACTTGAGGCAACAACAAGTAGCGACCAATGTGCTGTCCAGCT
TTTTTACTCAGTGAGAAATATCTTCCATTTGTTCCATGATGTGGTGCCCACATACCACAAGGAG
AACCTTCAGAAGCTTCCCCAGTTGGCTGCCATTCACCATAACAACTGCATGTATATTGCTCACC
ACTTGCTGACCCTCGGCCATCAGTTCAGATCGCGGCTCACCCCCATTCTTTGTGATGGCACGAC
CACTTTTGTGGACCTTGTACCTGGCTTCAGAAGACTTGGGACGGAGTGTTTTTTGGCCCAGATG
CGGACCCAGAAAGGAGAACTTCTGGAGAGATTATCAAGTGCTAGAAGCTTTGCAAACATGGATG
ATGAAGAGAATTATTCTGCAGCGAGCAAGGCAGTGAGGCAGGTGCTGCACCAGCTGAAGAGACT
TGGGATCGTGTGGCAGGATGTCCTGCCGGTGAACATATACTGCAAGGCTATGGGGACCTTGCTG
AACACCGTGATTGCTGAGATGATTGGCAGGATCACTGCTCTAGAGGACATCTCGACTGAAGATG
GCGATAGATTGTATTCCCTGTGCAAAACAGTGATGGATGAAGGGCCACAAGTATTTGCACCTCT
GTCTGATGAAAACAAAAACAAGAAATACCAAGAAGAGGTTCCGGTCTATGTGTCCAAGTGGATG
CCTTTCAAAGAACTCATGATAATGCTACAAGCTAGCTTGCAGGAAATCGGAGATCGGTGGGCAG
ATGGAAAAGGGCCCCTGGCAACTGCATTCCCTTCCAGCGAAGTAAAAGCTTTAATTCGTGCCTT
GTTCCAGAACACAGAAAGAAGAGCGGCTGCCCTTGCTAAGATTAAATAGCTCCCCCTTCAAAAA
AAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039081724 ⟹ XP_038937652

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	58,298,186 - 58,316,502 (+)	NCBI
mRatBN7.2	8	49,401,707 - 49,424,743 (+)	NCBI

RefSeq Acc Id:

XM_063265741 ⟹ XP_063121811

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	58,292,959 - 58,316,502 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001019972	(Get FASTA)	NCBI Sequence Viewer
	NP_001416406	(Get FASTA)	NCBI Sequence Viewer
	XP_038937652	(Get FASTA)	NCBI Sequence Viewer
	XP_063121811	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH97452	(Get FASTA)	NCBI Sequence Viewer
	EDL95434	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000071533.1
	ENSRNOP00055044785
	ENSRNOP00060019269
	ENSRNOP00065024778
GenBank Protein	Q4V8C2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001019972 ⟸ NM_001024801

- UniProtKB:

Q4V8C2 (UniProtKB/Swiss-Prot), A6J4B1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASFVTEVLAHSGSLEKEDLGTRISRLTRRVEEIKGEVCNMISKKYSEFLPTMQSAQALVTQVD
TLSNDIDQLKSRIETEVCRDLHISTVEFTNLKQRLERDSVVLNLLKQLQEFSSAIEEYNSALAE
KKYIPAARLLEEAQECLKLLKSKKCFDLKMLKSLSMELTVQKQNILYHLGEDWQKLVVWKFPPS
KDTSSLESCLQTELHLCTEQPEKEMTPLPSISSVLLAFSILGELPTKLKSFGQMLLKYILKPLV
TCPSLHAVIERQPNSVSICFQSLATDSEHPPPPEAFAKIQLVLEVLQKQLLDLPLDADLEIGKV
PEIVLAEMLGEVIWEDLSDCLIRNCLVYSIPTNSSKLQQYEEIIQSTEEFEKSLKEMRFLKGDT
TDLLKYARNINSHFANKKCQDVIVAARHLMTSEIHNTVKIGPDCEETLPDLPSPDADHRLQVQV
CKVQFTDAGNLEPETSLDPRSFSLPTCRISEAVKKLMELAYQTLLEATTSSDQCAVQLFYSVRN
IFHLFHDVVPTYHKENLQKLPQLAAIHHNNCMYIAHHLLTLGHQFRSRLTPILCDGTTTFVDLV
PGFRRLGTECFLAQMRTQKGELLERLSSARSFANMDDEENYSAASKAVRQVLHQLKRLGIVWQD
VLPVNIYCKAMGTLLNTVIAEMIGRITALEDISTEDGDRLYSLCKTVMDEGPQVFAPLSDENKN
KKYQEEVPVYVSKWMPFKELMIMLQASLQEIGDRWADGKGPLATAFPSSEVKALIRALFQNTER
RAAALAKIK

hide sequence

Ensembl Acc Id:

ENSRNOP00000071533 ⟸ ENSRNOT00000080712

RefSeq Acc Id:	XP_038937652 ⟸ XM_039081724
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063121811 ⟸ XM_063265741
- Peptide Label:	isoform X1

Protein Domains

Centromere/kinetochore protein zw10 C-terminal Centromere/kinetochore protein zw10 middle Centromere/kinetochore protein zw10 N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4V8C2-F1-model_v2	AlphaFold	Q4V8C2	1-777	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695940

Promoter ID:

EPDNEW_R6465

Type:

initiation region

Name:

Zw10_1

Description:

zw10 kinetochore protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	53,365,862 - 53,365,922	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309197	AgrOrtholog
BioCyc Gene	G2FUF-30587	BioCyc
Ensembl Genes	ENSRNOG00000054479	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055031256	UniProtKB/Swiss-Prot
	ENSRNOG00060014122	UniProtKB/Swiss-Prot
	ENSRNOG00065018529	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000080712.2	UniProtKB/Swiss-Prot
	ENSRNOT00055054151	UniProtKB/Swiss-Prot
	ENSRNOT00060024154	UniProtKB/Swiss-Prot
	ENSRNOT00065031119	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.357.150	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7456845	IMAGE-MGC_LOAD
InterPro	RZZ-complex_Zw10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Zw10/DSL1_C_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZW10_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Zw10_middle	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:363059	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:114513	IMAGE-MGC_LOAD
NCBI Gene	363059	ENTREZGENE
PANTHER	CENTROMERE/KINETOCHORE PROTEIN ZW10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CENTROMERE/KINETOCHORE PROTEIN ZW10 HOMOLOG	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Zw10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZW10_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZW10_C2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Zw10_middle	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Zw10	PhenoGen
RatGTEx	ENSRNOG00000054479	RatGTEx
	ENSRNOG00055031256	RatGTEx
	ENSRNOG00060014122	RatGTEx
	ENSRNOG00065018529	RatGTEx
UniProt	A6J4B1	ENTREZGENE, UniProtKB/TrEMBL
	Q4V8C2	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-01-02	Zw10	zw10 kinetochore protein	Zw10	ZW10, kinetochore associated, homolog (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Zw10	ZW10, kinetochore associated, homolog (Drosophila)	Zw10	ZW10 homolog (Drosophila), centromere/kinetochore protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-03	Zw10	ZW10 homolog (Drosophila), centromere/kinetochore protein	Zw10	ZW10 homolog, centromere/kinetochore protein (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Zw10	ZW10 homolog, centromere/kinetochore protein (Drosophila)	Zw10_predicted	ZW10 homolog, centromere/kinetochore protein (Drosophila) (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Zw10_predicted	ZW10 homolog, centromere/kinetochore protein (Drosophila) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD