Advanced Search (OLGA)

Gene: Naa60 (N(alpha)-acetyltransferase 60, NatF catalytic subunit) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Naa60

Name:

N(alpha)-acetyltransferase 60, NatF catalytic subunit

RGD ID:

1308915

Description:

Predicted to enable histone H4 acetyltransferase activity; protein homodimerization activity; and protein-N-terminal amino-acid acetyltransferase activity. Predicted to be involved in several processes, including N-terminal peptidyl-methionine acetylation; chromosome segregation; and nucleosome assembly. Predicted to be active in Golgi membrane. Orthologous to human NAA60 (N-alpha-acetyltransferase 60, NatF catalytic subunit); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

GNAT acetyltransferase; GNAT acetytransferase; HAT4; histone acetyltransferase type B protein 4; LOC363545; MGC124897; N-acetyltransferase 15; N-acetyltransferase 15 (GCN5-related, putative); N-alpha-acetyltransferase 60; N-alpha-acetyltransferase F; Nat15; NatF; natF catalytic subunit; RGD1308915; similar to RIKEN cDNA 1200013P24

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	12,129,026 - 12,149,053 (-)	NCBI		GRCr8
mRatBN7.2	10	11,622,554 - 11,653,078 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	11,587,916 - 11,642,755 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	16,330,370 - 16,350,242 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	15,819,202 - 15,839,074 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	11,487,957 - 11,507,898 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	11,881,635 - 11,902,139 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	11,881,739 - 11,901,785 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	10,638,000 - 10,658,027 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	11,890,203 - 11,910,230 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	11,891,225 - 11,910,250 (-)	NCBI
Celera	10	10,579,271 - 10,599,160 (-)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Naa60	Rat	epilepsy		ISO	NAA60 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Epilepsy	ClinVar	PMID:28492532
Naa60	Rat	Idiopathic Basal Ganglia Calcification 9		ISO	NAA60 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Basal ganglia calcification more ...	ClinVar	PMID:38480682
Naa60	Rat	Idiopathic Generalized Epilepsy		ISO	NAA60 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Idiopathic generalized epilepsy	ClinVar	PMID:28492532
Naa60	Rat	Rubinstein-Taybi syndrome		ISO	NAA60 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Rubinstein-Taybi syndrome	ClinVar	PMID:12114483 more ...
Naa60	Rat	short-rib thoracic dysplasia 9 with or without polydactyly		ISO	NAA60 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Saldino-Mainzer syndrome	ClinVar	PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Naa60	Rat	Idiopathic Basal Ganglia Calcification 9		ISO	NAA60 (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Naa60	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of NAA60 mRNA]	CTD	PMID:31150632
Naa60	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	Naa60 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of NAA60 mRNA	CTD	PMID:36331819
Naa60	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Naa60 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of NAA60 mRNA	CTD	PMID:22206623
Naa60	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Naa60 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of NAA60 mRNA	CTD	PMID:22206623
Naa60	Rat	17beta-estradiol	decreases expression	ISO	Naa60 (Mus musculus)	6480464	Estradiol results in decreased expression of NAA60 mRNA	CTD	PMID:39298647
Naa60	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of NAA60 mRNA	CTD	PMID:21215274
Naa60	Rat	4,4'-sulfonyldiphenol	affects expression	ISO	Naa60 (Mus musculus)	6480464	bisphenol S affects the expression of NAA60 mRNA	CTD	PMID:39298647
Naa60	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of NAA60 mRNA	CTD	PMID:36041667
Naa60	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	NAA60 (Homo sapiens)	6480464	bisphenol S results in decreased methylation of NAA60 gene	CTD	PMID:31601247
Naa60	Rat	aristolochic acid A	increases expression	ISO	NAA60 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of NAA60 mRNA	CTD	PMID:33212167
Naa60	Rat	arsane	affects methylation	ISO	NAA60 (Homo sapiens)	6480464	Arsenic affects the methylation of NAA60 gene	CTD	PMID:25304211
Naa60	Rat	arsenic atom	affects methylation	ISO	NAA60 (Homo sapiens)	6480464	Arsenic affects the methylation of NAA60 gene	CTD	PMID:25304211
Naa60	Rat	benzo[a]pyrene	affects methylation	ISO	NAA60 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of NAA60 5' UTR	CTD	PMID:27901495
Naa60	Rat	benzo[a]pyrene	decreases methylation	ISO	NAA60 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of NAA60 promoter	CTD	PMID:27901495
Naa60	Rat	beta-lapachone	decreases expression	ISO	NAA60 (Homo sapiens)	6480464	beta-lapachone results in decreased expression of NAA60 mRNA	CTD	PMID:38218311
Naa60	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of NAA60 mRNA	CTD	PMID:25181051
Naa60	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of NAA60 mRNA	CTD	PMID:36041667
Naa60	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of NAA60 mRNA	CTD	PMID:34947998
Naa60	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of NAA60 mRNA	CTD	PMID:36041667
Naa60	Rat	cadmium atom	multiple interactions	ISO	NAA60 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of NAA60 mRNA	CTD	PMID:35301059
Naa60	Rat	cadmium dichloride	increases methylation	EXP		6480464	Cadmium Chloride results in increased methylation of NAA60 promoter	CTD	PMID:22457795
Naa60	Rat	cadmium dichloride	multiple interactions	ISO	NAA60 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of NAA60 mRNA	CTD	PMID:35301059
Naa60	Rat	clofibrate	multiple interactions	ISO	Naa60 (Mus musculus)	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of NAA60 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of NAA60 mRNA]	CTD	PMID:17585979
Naa60	Rat	cyclosporin A	decreases expression	ISO	NAA60 (Homo sapiens)	6480464	Cyclosporine results in decreased expression of NAA60 mRNA	CTD	PMID:20106945
Naa60	Rat	Dibutyl phosphate	affects expression	ISO	NAA60 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of NAA60 mRNA	CTD	PMID:37042841
Naa60	Rat	dicrotophos	increases expression	ISO	NAA60 (Homo sapiens)	6480464	dicrotophos results in increased expression of NAA60 mRNA	CTD	PMID:28302478
Naa60	Rat	doxorubicin	decreases expression	ISO	NAA60 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of NAA60 mRNA	CTD	PMID:29803840
Naa60	Rat	epoxiconazole	decreases expression	ISO	Naa60 (Mus musculus)	6480464	epoxiconazole results in decreased expression of NAA60 mRNA	CTD	PMID:35436446
Naa60	Rat	folic acid	multiple interactions	ISO	Naa60 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of NAA60 mRNA	CTD	PMID:22206623
Naa60	Rat	furan	increases methylation	EXP		6480464	furan results in increased methylation of NAA60 gene	CTD	PMID:22079235
Naa60	Rat	gallic acid	decreases expression	ISO	NAA60 (Homo sapiens)	6480464	Gallic Acid results in decreased expression of NAA60 mRNA	CTD	PMID:34408198
Naa60	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of NAA60 mRNA	CTD	PMID:33387578
Naa60	Rat	methidathion	increases expression	ISO	Naa60 (Mus musculus)	6480464	methidathion results in increased expression of NAA60 mRNA	CTD	PMID:34813904
Naa60	Rat	methyl methanesulfonate	increases expression	ISO	NAA60 (Homo sapiens)	6480464	Methyl Methanesulfonate results in increased expression of NAA60 mRNA	CTD	PMID:23649840
Naa60	Rat	ozone	multiple interactions	ISO	NAA60 (Homo sapiens)	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of NAA60 mRNA	CTD	PMID:35430440
Naa60	Rat	paracetamol	multiple interactions	ISO	Naa60 (Mus musculus)	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of NAA60 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of NAA60 mRNA]	CTD	PMID:17585979
Naa60	Rat	paracetamol	affects expression	ISO	Naa60 (Mus musculus)	6480464	Acetaminophen affects the expression of NAA60 mRNA	CTD	PMID:17562736
Naa60	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Naa60 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of NAA60 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of NAA60 mRNA	CTD	PMID:36331819
Naa60	Rat	poly(I:C)	multiple interactions	EXP		6480464	[Poly I-C co-treated with HU 211] results in decreased expression of NAA60 mRNA	CTD	PMID:26923065
Naa60	Rat	temozolomide	increases expression	ISO	NAA60 (Homo sapiens)	6480464	Temozolomide results in increased expression of NAA60 mRNA	CTD	PMID:31758290
Naa60	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of NAA60 mRNA]	CTD	PMID:31150632
Naa60	Rat	tetrachloromethane	decreases expression	ISO	Naa60 (Mus musculus)	6480464	Carbon Tetrachloride results in decreased expression of NAA60 mRNA	CTD	PMID:31919559
Naa60	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of NAA60 mRNA	CTD	PMID:31150632
Naa60	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of NAA60 mRNA	CTD	PMID:34492290
Naa60	Rat	titanium dioxide	decreases methylation	ISO	Naa60 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of NAT15 promoter	CTD	PMID:35295148
Naa60	Rat	triphenyl phosphate	affects expression	ISO	NAA60 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of NAA60 mRNA	CTD	PMID:37042841
Naa60	Rat	triptonide	decreases expression	ISO	Naa60 (Mus musculus)	6480464	triptonide results in decreased expression of NAA60 mRNA	CTD	PMID:33045310
Naa60	Rat	urethane	increases expression	ISO	NAA60 (Homo sapiens)	6480464	Urethane results in increased expression of NAA60 mRNA	CTD	PMID:28818685
Naa60	Rat	valproic acid	affects expression	ISO	NAA60 (Homo sapiens)	6480464	Valproic Acid affects the expression of NAA60 mRNA	CTD	PMID:25979313
Naa60	Rat	vitamin E	decreases expression	ISO	NAA60 (Homo sapiens)	6480464	Vitamin E results in decreased expression of NAA60 mRNA	CTD	PMID:19244175

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Naa60	Rat	cell population proliferation	involved_in	ISS	UniProtKB:Q9H7X0	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Naa60	Rat	cell population proliferation	involved_in	ISO	NAA60 (Homo sapiens)	1624291	PMID:21981917	RGD	PMID:21981917
Naa60	Rat	chromatin organization	involved_in	IEA	UniProtKB-KW:KW-0156	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Naa60	Rat	chromosome segregation	involved_in	ISS	UniProtKB:Q95SX8	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Naa60	Rat	chromosome segregation	involved_in	IBA	FB:FBgn0036039 and PANTHER:PTN000380943	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Naa60	Rat	chromosome segregation	involved_in	IEA	UniProtKB-KW:KW-0159	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Naa60	Rat	N-terminal peptidyl-methionine acetylation	involved_in	ISS	UniProtKB:Q9H7X0	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Naa60	Rat	N-terminal peptidyl-methionine acetylation	involved_in	ISO	NAA60 (Homo sapiens)	1624291	PMID:21750686	RGD	PMID:21750686
Naa60	Rat	N-terminal protein amino acid acetylation	involved_in	ISS	UniProtKB:Q9H7X0	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Naa60	Rat	N-terminal protein amino acid acetylation	involved_in	ISO	NAA60 (Homo sapiens)	1624291	PMID:25732826 more ...	RGD	PMID:25732826 more ...
Naa60	Rat	nucleosome assembly	involved_in	ISS	UniProtKB:Q9H7X0	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Naa60	Rat	nucleosome assembly	involved_in	ISO	NAA60 (Homo sapiens)	1624291	PMID:21981917	RGD	PMID:21981917

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Naa60	Rat	Golgi apparatus	located_in	IEA	UniProtKB-KW:KW-0333	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Naa60	Rat	Golgi membrane	located_in	ISS	UniProtKB:Q9H7X0	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Naa60	Rat	Golgi membrane	is_active_in	IBA	PANTHER:PTN000380943 and UniProtKB:Q9H7X0	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Naa60	Rat	Golgi membrane	located_in	IEA	UniProtKB-SubCell:SL-0134	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Naa60	Rat	Golgi membrane	located_in	ISO	NAA60 (Homo sapiens)	1624291	PMID:21981917 and PMID:25732826	RGD	PMID:21981917 and PMID:25732826
Naa60	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Naa60	Rat	acyltransferase activity	enables	IEA	UniProtKB-KW:KW-0012	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Naa60	Rat	acyltransferase activity, transferring groups other than amino-acyl groups	enables	IEA	InterPro:IPR000182	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Naa60	Rat	histone acetyltransferase activity	enables	IBA	FB:FBgn0036039 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Naa60	Rat	histone acetyltransferase activity	enables	IEA	EC:2.3.1.48	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Naa60	Rat	histone H4 acetyltransferase activity	enables	ISS	UniProtKB:Q9H7X0	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Naa60	Rat	histone H4 acetyltransferase activity	enables	ISO	NAA60 (Homo sapiens)	1624291	PMID:21981917	RGD	PMID:21981917
Naa60	Rat	protein binding	enables	ISO	NAA60 (Homo sapiens)	1624291	UniProtKB:O75400-2 more ...	RGD	PMID:32296183 and PMID:32814053
Naa60	Rat	protein homodimerization activity	enables	ISS	UniProtKB:Q9H7X0	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Naa60	Rat	protein homodimerization activity	enables	ISO	NAA60 (Homo sapiens)	1624291	PMID:27320834	RGD	PMID:27320834
Naa60	Rat	protein N-terminal-methionine acetyltransferase activity	enables	IEA	EC:2.3.1.259	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Naa60	Rat	protein-lysine-acetyltransferase activity	enables	IEA	RHEA:45948	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Naa60	Rat	protein-N-terminal amino-acid acetyltransferase activity	enables	ISS	UniProtKB:Q9H7X0	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Naa60	Rat	protein-N-terminal amino-acid acetyltransferase activity	enables	IBA	FB:FBgn0036039 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Naa60	Rat	protein-N-terminal amino-acid acetyltransferase activity	enables	ISO	NAA60 (Homo sapiens)	1624291	PMID:21750686 more ...	RGD	PMID:21750686 more ...
Naa60	Rat	protein-N-terminal amino-acid acetyltransferase activity	enables	IEA	InterPro:IPR045141	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Naa60	Rat	transferase activity	enables	IEA	UniProtKB-KW:KW-0808	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:21750686	PMID:21981917	PMID:25732826	PMID:27320834	PMID:27550639

Naa60
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	12,129,026 - 12,149,053 (-)	NCBI		GRCr8
mRatBN7.2	10	11,622,554 - 11,653,078 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	11,587,916 - 11,642,755 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	16,330,370 - 16,350,242 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	15,819,202 - 15,839,074 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	11,487,957 - 11,507,898 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	11,881,635 - 11,902,139 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	11,881,739 - 11,901,785 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	10,638,000 - 10,658,027 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	11,890,203 - 11,910,230 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	11,891,225 - 11,910,250 (-)	NCBI
Celera	10	10,579,271 - 10,599,160 (-)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

NAA60
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	3,443,611 - 3,486,963 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	3,443,649 - 3,486,953 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	3,493,611 - 3,536,963 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	3,433,669 - 3,476,964 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	16	3,700,439 - 3,743,751 (+)	NCBI		Celera
Cytogenetic Map	16	p13.3	NCBI
HuRef	16	3,463,338 - 3,506,627 (+)	NCBI		HuRef
CHM1_1	16	3,493,794 - 3,537,081 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	3,470,880 - 3,514,228 (+)	NCBI		T2T-CHM13v2.0

Naa60
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	3,690,365 - 3,722,645 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	3,690,239 - 3,722,634 (+)	Ensembl		GRCm39 Ensembl
GRCm38	16	3,872,496 - 3,904,781 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	3,872,375 - 3,904,770 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	3,884,619 - 3,904,781 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	16	3,799,911 - 3,819,994 (+)	NCBI		MGSCv36	mm8
Celera	16	4,515,115 - 4,535,272 (+)	NCBI		Celera
Cytogenetic Map	16	A1	NCBI
cM Map	16	2.28	NCBI

Naa60
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955442	13,895,248 - 13,918,723 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955442	13,895,248 - 13,926,152 (-)	NCBI	ChiLan1.0	ChiLan1.0

NAA60
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	3,970,123 - 4,013,964 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	7,754,950 - 7,795,486 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	2,366,988 - 2,409,598 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	3,543,418 - 3,586,299 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	3,543,418 - 3,586,299 (+)	Ensembl	panpan1.1		panPan2

NAA60
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	37,759,233 - 37,784,224 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	37,761,497 - 37,793,290 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	26,326,630 - 26,351,632 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	37,974,395 - 37,999,403 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	37,974,395 - 38,008,463 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	37,757,363 - 37,782,355 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	37,650,694 - 37,675,683 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	38,061,211 - 38,086,221 (-)	NCBI		UU_Cfam_GSD_1.0

Naa60
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	105,871,233 - 105,891,072 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936694	818,393 - 838,260 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936694	818,386 - 838,258 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NAA60
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	38,763,447 - 38,781,988 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	38,763,444 - 38,812,862 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	40,195,732 - 40,201,246 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NAA60
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	3,144,307 - 3,184,108 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	3,173,475 - 3,181,996 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666068	27,636,397 - 27,677,231 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Naa60
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624824	1,264,660 - 1,286,925 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624824	1,255,274 - 1,289,413 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Naa60
83 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	451
Count of miRNA genes:	220
Interacting mature miRNAs:	259
Transcripts:	ENSRNOT00000009936, ENSRNOT00000075238
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	1	24158324	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35225947	Rat
7387235	Uae41	Urinary albumin excretion QTL 41	5.26	0.1874	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	10	1	29497586	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
737820	Alc9	Alcohol consumption QTL 9	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	5144027	19233348	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
631828	Alc5	Alcohol consumption QTL 5	2.4		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	5144027	17245662	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38328221	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
631660	Hcar1	Hepatocarcinoma resistance QTL 1	3.4	0.0001	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	10	6154182	15990232	Rat
1576304	Schws7	Schwannoma susceptibility QTL 7		0.0115	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	4765527	19816042	Rat
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat

RH133439

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	11,622,680 - 11,622,880 (+)	MAPPER	mRatBN7.2
mRatBN7.2	X	26,944,300 - 26,944,505 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	28,403,980 - 28,404,184	NCBI	Rnor6.0
Rnor_6.0	10	11,881,762 - 11,881,961	NCBI	Rnor6.0
Rnor_5.0	10	10,638,024 - 10,638,223	UniSTS	Rnor5.0
Rnor_5.0	X	28,800,092 - 28,800,296	UniSTS	Rnor5.0
RGSC_v3.4	X	47,242,752 - 47,242,956	UniSTS	RGSC3.4
RGSC_v3.4	10	11,890,227 - 11,890,426	UniSTS	RGSC3.4
Celera	10	10,579,295 - 10,579,494	UniSTS
Celera	X	27,356,310 - 27,356,514	UniSTS
Cytogenetic Map	10	q12	UniSTS

BF405602

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	11,622,256 - 11,622,444 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	11,881,338 - 11,881,525	NCBI	Rnor6.0
Rnor_5.0	10	10,637,600 - 10,637,787	UniSTS	Rnor5.0
RGSC_v3.4	10	11,889,803 - 11,889,990	UniSTS	RGSC3.4
Celera	10	10,578,871 - 10,579,058	UniSTS
Cytogenetic Map	10	q12	UniSTS

RH139149

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	11,625,637 - 11,625,816 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	11,884,719 - 11,884,897	NCBI	Rnor6.0
Rnor_5.0	10	10,640,981 - 10,641,159	UniSTS	Rnor5.0
RGSC_v3.4	10	11,893,184 - 11,893,362	UniSTS	RGSC3.4
Celera	10	10,582,239 - 10,582,417	UniSTS
Cytogenetic Map	10	q12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001014226	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017597418	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC129669	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY316589	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC105304	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212054	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000009936 ⟹ ENSRNOP00000009936

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	11,622,658 - 11,642,685 (-)	Ensembl
Rnor_6.0 Ensembl	10	11,881,739 - 11,901,765 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000075238 ⟹ ENSRNOP00000064770

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	11,625,397 - 11,642,755 (-)	Ensembl
Rnor_6.0 Ensembl	10	11,882,760 - 11,901,785 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102976 ⟹ ENSRNOP00000089284

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	11,587,916 - 11,642,729 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106221 ⟹ ENSRNOP00000088883

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	11,628,357 - 11,642,755 (-)	Ensembl

RefSeq Acc Id:

NM_001014226 ⟹ NP_001014248

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	12,129,026 - 12,149,053 (-)	NCBI
mRatBN7.2	10	11,622,657 - 11,642,685 (-)	NCBI
Rnor_6.0	10	11,881,738 - 11,901,765 (-)	NCBI
Rnor_5.0	10	10,638,000 - 10,658,027 (-)	NCBI
RGSC_v3.4	10	11,890,203 - 11,910,230 (-)	RGD
Celera	10	10,579,271 - 10,599,160 (-)	RGD

Sequence:

show sequence

AATCTGTCGCGGGGGACCCCGCAGTCCCACGTACGGCTTCCCGGCTCCCCCAGGATGCGCTGAGCCTTGCGACACCGTCCGCTGCCGCCGGCTCCCGTCCGAGGTGTGAATGACAGAGGTGGTGCCTT
CCAGCGCCCTCAGCGAGGTCAGCCTGCGCCTCCTCTGCCACGATGACATAGACACTGTGAAGCACCTGTGTGGCGACTGGTTCCCCATTGAGTACCCAGACTCATGGTATCGTGATATCACATCCAAC
AAGAAGTTCTTCTCCCTTGCTGCAACCTACAGAGGTGCCATTGTGGGAATGATAGTAGCTGAAATAAAGAATAGGACCAAAATACATAAAGAGGATGGAGATATTCTAGCCTCCAGCTTCTCTGTGGA
TACACAAGTTGCATACATCCTCAGTCTGGGAGTGGTGAAAGAGTTCAGGAAACACGGCATAGGTTCCCTCTTATTAGAAAGTTTAAAGGATCATATTTCAACCACCGCCCAGGACCACTGCAAAGCCA
TCTACCTGCACGTTCTCACCACCAACAACACAGCAATAAACTTCTATGAAAACAGAGACTTTAGGCAGCATCACTATCTGCCCTATTACTACTCCATCCGAGGGGTCCTCAAAGATGGCTTCACCTAT
GTCCTCTACATCAATGGCGGCCACCCTCCCTGGACCATCTTAGACTACATCCAGCACCTGGGCTCAGCACTAGCCAACCTGAGCCCCTGCTCCATCCCACACAGGATCTACCGCCAGGCCCACAGCCT
GCTTTGCAGCTTTCTGCCGTGGTCCAGCATTTCCAGCAAAGGTGGCATTGAATACAGCCGTACCATGTAATGCCGTTGGGGCAGCCTCCACCAGGCCTCTGTCCTCAGCACTTTGTGGAGCCTATTTT
CCTGTCTGTCTGACTTCTGCTGTCCTTTTCGAGGAGCTGGTGGCCACCTGCCGGCCCATCAGCCTGCCTCAGCTGCAGGCCCGGTGCTATGCTGGCTGCCTCAGCTGCAGGCCCGGTGCTATGCTGGC
TCAGGAGCAGAATGTACACTGGTCGGGCTCTCCTTCCACCTGGAGTCCTTGTCCTGCCTCCATGCCCTGGCACCACCCAATGGCCTGGCAGGTGTGTCTACATTCACTGGGAAAGGGCTTGCCAGGCT
TCTCCTCTGTCTCCTGCTCCTTTAGCTCCTTCCTACAAGATGGACTGAACTTTGCTGAAAACGTGGACATTTCTGACCCTGAAGACACAGGAACCTTAGAATAAAGAGGCACAGCAAGGAGAATGTCA
GTTTTTGTTTAGGAATGCCCTAAAGAAGCTTAGATGATGGAAACGGTTCTTACTCCTCCATGAAAGGCTGGAAACTGGGGAAAGAGAAAGAGGGGCTGGCCCTTCACAAGAACTTAAAAACTTCAGGA
ATCAGTCCTCTCCATGGACAGATGGGACAGTCCCCTGTTCCCAGTGTTCTACTGTCCACTTCTTCCTGTCCAGAAGGATCATCCTGCTTGTTGAATCCTGGCATGTTCCACATAGCTGACCTACACTG
GGAGCTGGGCTAAGGACAGGTAGCTATTGGCTTCTGGGTTTCTTCCCTGCTTATCCTTATAGAAGCTGAAACTTCAAGGCCTGGGCCTATGCAGACAGGAGGAAGCTGAGCTTTGTATTGGCATCTCT
GCTACTGTGGACCCATGGCACCTGGCCTTGGGAGCAGAGGGCAGCTGCTGCCTTTGGGCCTTCAGCCTCTGAGGCAGAGACTTTGTCAGCACCACGAATTGTGCTTGCAGCAGACATCTCAAGTTTCC
AGCATCCCTTCCCTTGTGCCCCCATGTGTTTGCTGTCAGAGTCCTGCCCAGAATTGCTGCAGTGTTACAGGATCCCTTGCAGGGTCTCCTCACAGCCCCTCACTGTGCCAGACTGAGGAAGAACAGCT
TTATTGACAGGCCTCATTACTGAGCGCTTCCCTCCCTCAGCGTCTCCTGGCTCAGGGCTCTCAGGCTGTAGAGCCAGCCAAAGGCTGCCTGGCCTCAGAGAGGAAAGGGCCCCCACAAAGGAAGGCCA
AGGCAGTTAAGTATCCCCCTTCCTCAAGAGAACTAGCCAGCAGGTGGCCAGTCCTGACTGGTTTGGGTTGTGTGCTGAGGCCCCAGCCCCGCATCCTCTCCCTTTTCAGTCAATGGTGATCATGTGAT
TTTCATTTCTGCCCTGTGTAGTCAAGGAAGAGTCTTCCAGAAGGTTCTGACTTGGGCATTCATAAATCCAACTCAAAGACCTCTCGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001014248	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI05305	(Get FASTA)	NCBI Sequence Viewer
	AAP83441	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000009936
	ENSRNOP00000009936.3
GenBank Protein	Q3MHC1	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001014248 ⟸ NM_001014226

- UniProtKB:

Q7TMZ6 (UniProtKB/Swiss-Prot), Q3MHC1 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MTEVVPSSALSEVSLRLLCHDDIDTVKHLCGDWFPIEYPDSWYRDITSNKKFFSLAATYRGAIVGMIVAEIKNRTKIHKEDGDILASSFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTA
QDHCKAIYLHVLTTNNTAINFYENRDFRQHHYLPYYYSIRGVLKDGFTYVLYINGGHPPWTILDYIQHLGSALANLSPCSIPHRIYRQAHSLLCSFLPWSSISSKGGIEYSRTM

hide sequence

Ensembl Acc Id:

ENSRNOP00000064770 ⟸ ENSRNOT00000075238

Ensembl Acc Id:

ENSRNOP00000009936 ⟸ ENSRNOT00000009936

Ensembl Acc Id:

ENSRNOP00000089284 ⟸ ENSRNOT00000102976

Ensembl Acc Id:

ENSRNOP00000088883 ⟸ ENSRNOT00000106221

Protein Domains

N-acetyltransferase

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q3MHC1-F1-model_v2	AlphaFold	Q3MHC1	1-242	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13696988

Promoter ID:

EPDNEW_R7510

Type:

initiation region

Name:

Naa60_1

Description:

N-acetyltransferase 60, NatF catalytic subunit

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	11,901,801 - 11,901,861	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-25993	BioCyc
Ensembl Genes	ENSRNOG00000007280	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000009936	ENTREZGENE
	ENSRNOT00000009936.7	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.630.30	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7191187	IMAGE-MGC_LOAD
InterPro	Acyl_CoA_acyltransferase	UniProtKB/Swiss-Prot
	GNAT_dom	UniProtKB/Swiss-Prot
	NAA60-like	UniProtKB/Swiss-Prot
KEGG Report	rno:363545	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:124897	IMAGE-MGC_LOAD
NCBI Gene	363545	ENTREZGENE
PANTHER	N-ALPHA-ACETYLTRANSFERASE 60	UniProtKB/Swiss-Prot
	PTHR14744	UniProtKB/Swiss-Prot
Pfam	Acetyltransf_1	UniProtKB/Swiss-Prot
PhenoGen	Naa60	PhenoGen
PROSITE	GNAT	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000007280	RatGTEx
Superfamily-SCOP	SSF55729	UniProtKB/Swiss-Prot
UniProt	A0A8I6A718_RAT	UniProtKB/TrEMBL
	A0A8I6A7V0_RAT	UniProtKB/TrEMBL
	A0A8L2UNM0_RAT	UniProtKB/TrEMBL
	NAA60_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q7TMZ6	ENTREZGENE
UniProt Secondary	Q7TMZ6	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-09-02	Naa60	N(alpha)-acetyltransferase 60, NatF catalytic subunit	Nat15	N-acetyltransferase 15 (GCN5-related, putative)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-10-16	Nat15	N-acetyltransferase 15 (GCN5-related, putative)	RGD1308915	similar to RIKEN cDNA 1200013P24	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1308915	similar to RIKEN cDNA 1200013P24	RGD1308915_predicted	similar to RIKEN cDNA 1200013P24 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1308915_predicted	similar to RIKEN cDNA 1200013P24 (predicted)	LOC363545_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC363545_predicted	similar to RIKEN cDNA 1200013P24 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM