Symbol:
Zfyve1
Name:
zinc finger FYVE-type containing 1
RGD ID:
1307795
Description:
Predicted to enable phosphatidylinositol binding activity and phosphatidylinositol-3,4-bisphosphate binding activity. Predicted to be involved in several processes, including cellular response to starvation; lipid droplet formation; and positive regulation by host of viral genome replication. Predicted to be located in several cellular components, including autophagosome; mitochondria-associated endoplasmic reticulum membrane contact site; and omegasome. Predicted to be extrinsic component of omegasome membrane. Predicted to be active in lipid droplet. Orthologous to human ZFYVE1 (zinc finger FYVE-type containing 1); INTERACTS WITH 3-chloropropane-1,2-diol; all-trans-retinoic acid; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC299188; zinc finger FYVE domain-containing protein 1; zinc finger, FYVE domain containing 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ZFYVE1 (zinc finger FYVE-type containing 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Zfyve1 (zinc finger, FYVE domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Zfyve1 (zinc finger FYVE-type containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ZFYVE1 (zinc finger FYVE-type containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ZFYVE1 (zinc finger FYVE-type containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Zfyve1 (zinc finger FYVE-type containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ZFYVE1 (zinc finger FYVE-type containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ZFYVE1 (zinc finger FYVE-type containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Zfyve1 (zinc finger FYVE-type containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
ZFYVE1 (zinc finger FYVE-type containing 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Zfyve1 (zinc finger, FYVE domain containing 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
zfyve1 (zinc finger, FYVE domain containing 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
zfyve1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 108,916,062 - 108,965,231 (-) NCBI GRCr8 mRatBN7.2 6 103,184,938 - 103,234,111 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 103,184,938 - 103,234,039 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 103,346,651 - 103,395,756 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 103,645,865 - 103,694,962 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 103,015,337 - 103,064,435 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 107,031,411 - 107,080,590 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 107,031,412 - 107,080,524 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 118,460,937 - 118,509,830 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 107,498,866 - 107,548,204 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 107,503,540 - 107,551,702 (-) NCBI Celera 6 101,015,641 - 101,064,748 (-) NCBI Celera Cytogenetic Map 6 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Zfyve1 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1317195 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ZFYVE1 mRNA CTD PMID:36331819 Zfyve1 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1317195 6480464 1,2-Dimethylhydrazine results in decreased expression of ZFYVE1 mRNA CTD PMID:22206623 Zfyve1 Rat 17beta-estradiol decreases expression ISO RGD:1317195 6480464 Estradiol results in decreased expression of ZFYVE1 mRNA CTD PMID:39298647 Zfyve1 Rat 17beta-estradiol decreases expression ISO RGD:1317194 6480464 Estradiol results in decreased expression of ZFYVE1 mRNA CTD PMID:31614463 Zfyve1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1317195 6480464 Tetrachlorodibenzodioxin affects the expression of ZFYVE1 mRNA CTD PMID:21570461 Zfyve1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of ZFYVE1 protein CTD PMID:34915118 Zfyve1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1317194 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Zfyve1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1317194 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Zfyve1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO RGD:1317195 6480464 bisphenol S results in decreased methylation of ZFYVE1 exon CTD PMID:33297965 Zfyve1 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1317195 6480464 bisphenol S results in decreased expression of ZFYVE1 mRNA CTD PMID:39298647 Zfyve1 Rat actinomycin D multiple interactions ISO RGD:1317194 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of ZFYVE1 mRNA CTD PMID:38460933 Zfyve1 Rat aflatoxin B1 increases expression ISO RGD:1317195 6480464 Aflatoxin B1 results in increased expression of ZFYVE1 mRNA CTD PMID:19770486 Zfyve1 Rat aflatoxin B1 increases methylation ISO RGD:1317194 6480464 Aflatoxin B1 results in increased methylation of ZFYVE1 gene CTD PMID:27153756 Zfyve1 Rat aflatoxin B1 increases expression ISO RGD:1317194 6480464 Aflatoxin B1 results in increased expression of ZFYVE1 mRNA CTD PMID:21641981 Zfyve1 Rat all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of ZFYVE1 mRNA CTD PMID:20488242 Zfyve1 Rat all-trans-retinoic acid increases expression ISO RGD:1317194 6480464 Tretinoin results in increased expression of ZFYVE1 mRNA CTD PMID:23724009 Zfyve1 Rat antirheumatic drug increases expression ISO RGD:1317194 6480464 Antirheumatic Agents results in increased expression of ZFYVE1 mRNA CTD PMID:24449571 Zfyve1 Rat aristolochic acid A increases expression ISO RGD:1317194 6480464 aristolochic acid I results in increased expression of ZFYVE1 mRNA CTD PMID:33212167 Zfyve1 Rat arsane affects methylation ISO RGD:1317194 6480464 Arsenic affects the methylation of ZFYVE1 gene CTD PMID:25304211 Zfyve1 Rat arsenic atom affects methylation ISO RGD:1317194 6480464 Arsenic affects the methylation of ZFYVE1 gene CTD PMID:25304211 Zfyve1 Rat atrazine decreases expression ISO RGD:1317194 6480464 Atrazine results in decreased expression of ZFYVE1 mRNA CTD PMID:22378314 Zfyve1 Rat benzo[a]pyrene increases methylation ISO RGD:1317194 6480464 Benzo(a)pyrene results in increased methylation of ZFYVE1 promoter CTD PMID:27901495 Zfyve1 Rat benzo[e]pyrene decreases methylation ISO RGD:1317194 6480464 benzo(e)pyrene results in decreased methylation of ZFYVE1 intron CTD PMID:30157460 Zfyve1 Rat bisphenol A multiple interactions ISO RGD:1317194 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Zfyve1 Rat bisphenol A increases expression ISO RGD:1317195 6480464 bisphenol A results in increased expression of ZFYVE1 mRNA CTD PMID:33221593 Zfyve1 Rat bisphenol A increases expression ISO RGD:1317194 6480464 bisphenol A results in increased expression of ZFYVE1 mRNA CTD PMID:29275510|PMID:33670352 Zfyve1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ZFYVE1 mRNA CTD PMID:30816183 Zfyve1 Rat bisphenol F multiple interactions ISO RGD:1317194 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Zfyve1 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of ZFYVE1 protein CTD PMID:28903499 Zfyve1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of ZFYVE1 mRNA CTD PMID:33453195 Zfyve1 Rat camptothecin increases expression ISO RGD:1317194 6480464 Camptothecin results in increased expression of ZFYVE1 mRNA CTD PMID:38460933 Zfyve1 Rat cisplatin increases expression ISO RGD:1317194 6480464 Cisplatin results in increased expression of ZFYVE1 mRNA CTD PMID:27392435 Zfyve1 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of ZFYVE1 mRNA CTD PMID:24386269 Zfyve1 Rat cobalt dichloride increases expression ISO RGD:1317194 6480464 cobaltous chloride results in increased expression of ZFYVE1 mRNA CTD PMID:19320972 Zfyve1 Rat copper(II) sulfate decreases expression ISO RGD:1317194 6480464 Copper Sulfate results in decreased expression of ZFYVE1 mRNA CTD PMID:19549813 Zfyve1 Rat coumestrol decreases expression ISO RGD:1317194 6480464 Coumestrol results in decreased expression of ZFYVE1 mRNA CTD PMID:19167446 Zfyve1 Rat coumestrol multiple interactions ISO RGD:1317194 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of ZFYVE1 mRNA CTD PMID:19167446 Zfyve1 Rat DDE decreases expression ISO RGD:1317194 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of ZFYVE1 mRNA CTD PMID:38568856 Zfyve1 Rat dexamethasone multiple interactions ISO RGD:1317194 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Zfyve1 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of ZFYVE1 mRNA CTD PMID:25152437 Zfyve1 Rat doxorubicin decreases expression ISO RGD:1317194 6480464 Doxorubicin results in decreased expression of ZFYVE1 mRNA CTD PMID:29803840 Zfyve1 Rat Enterolactone multiple interactions ISO RGD:1317194 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of ZFYVE1 mRNA CTD PMID:19167446 Zfyve1 Rat ethanol affects splicing ISO RGD:1317195 6480464 Ethanol affects the splicing of ZFYVE1 mRNA CTD PMID:30319688 Zfyve1 Rat ethyl methanesulfonate increases expression ISO RGD:1317194 6480464 Ethyl Methanesulfonate results in increased expression of ZFYVE1 mRNA CTD PMID:23649840 Zfyve1 Rat folic acid decreases expression ISO RGD:1317195 6480464 Folic Acid results in decreased expression of ZFYVE1 mRNA CTD PMID:25629700 Zfyve1 Rat formaldehyde increases expression ISO RGD:1317194 6480464 Formaldehyde results in increased expression of ZFYVE1 mRNA CTD PMID:23649840 Zfyve1 Rat hydrogen peroxide affects expression ISO RGD:1317194 6480464 Hydrogen Peroxide affects the expression of ZFYVE1 mRNA CTD PMID:20044591 Zfyve1 Rat indometacin multiple interactions ISO RGD:1317194 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Zfyve1 Rat methapyrilene decreases methylation ISO RGD:1317194 6480464 Methapyrilene results in decreased methylation of ZFYVE1 intron CTD PMID:30157460 Zfyve1 Rat methyl methanesulfonate increases expression ISO RGD:1317194 6480464 Methyl Methanesulfonate results in increased expression of ZFYVE1 mRNA CTD PMID:23649840 Zfyve1 Rat Nutlin-3 multiple interactions ISO RGD:1317194 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of ZFYVE1 mRNA CTD PMID:38460933 Zfyve1 Rat paracetamol affects expression ISO RGD:1317195 6480464 Acetaminophen affects the expression of ZFYVE1 mRNA CTD PMID:17562736 Zfyve1 Rat paracetamol increases expression ISO RGD:1317194 6480464 Acetaminophen results in increased expression of ZFYVE1 mRNA CTD PMID:21420995|PMID:22230336|PMID:29067470 Zfyve1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1317195 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ZFYVE1 mRNA CTD PMID:36331819 Zfyve1 Rat pirinixic acid multiple interactions ISO RGD:1317194 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Zfyve1 Rat pregnenolone 16alpha-carbonitrile decreases expression ISO RGD:1317195 6480464 Pregnenolone Carbonitrile results in decreased expression of ZFYVE1 mRNA CTD PMID:28903501 Zfyve1 Rat quercetin increases expression ISO RGD:1317194 6480464 Quercetin results in increased expression of ZFYVE1 mRNA CTD PMID:21632981 Zfyve1 Rat resveratrol multiple interactions ISO RGD:1317194 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of ZFYVE1 mRNA CTD PMID:23557933 Zfyve1 Rat sodium arsenite increases expression ISO RGD:1317194 6480464 sodium arsenite results in increased expression of ZFYVE1 mRNA CTD PMID:38568856 Zfyve1 Rat thiram increases expression ISO RGD:1317194 6480464 Thiram results in increased expression of ZFYVE1 mRNA CTD PMID:38568856 Zfyve1 Rat titanium dioxide increases expression ISO RGD:1317195 6480464 titanium dioxide results in increased expression of ZFYVE1 mRNA CTD PMID:29264374 Zfyve1 Rat titanium dioxide decreases methylation ISO RGD:1317195 6480464 titanium dioxide results in decreased methylation of ZFYVE1 gene CTD PMID:35295148 Zfyve1 Rat toxaphene increases expression EXP 6480464 Toxaphene results in increased expression of ZFYVE1 mRNA CTD PMID:23153324 Zfyve1 Rat trichostatin A affects expression ISO RGD:1317194 6480464 trichostatin A affects the expression of ZFYVE1 mRNA CTD PMID:28542535 Zfyve1 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of ZFYVE1 mRNA CTD PMID:30589522 Zfyve1 Rat triphenyl phosphate affects expression ISO RGD:1317194 6480464 triphenyl phosphate affects the expression of ZFYVE1 mRNA CTD PMID:37042841 Zfyve1 Rat urethane increases expression ISO RGD:1317194 6480464 Urethane results in increased expression of ZFYVE1 mRNA CTD PMID:28818685 Zfyve1 Rat valproic acid decreases expression ISO RGD:1317194 6480464 Valproic Acid results in decreased expression of ZFYVE1 mRNA CTD PMID:37505509
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Zfyve1 Rat 1-phosphatidylinositol binding enables ISO RGD:1317194 1624291 PMID:11256955 RGD PMID:11256955 Zfyve1 Rat 1-phosphatidylinositol binding enables IEA UniProtKB:Q9HBF4|ensembl:ENSP00000450742 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Zfyve1 Rat 1-phosphatidylinositol binding enables IBA PANTHER:PTN002927553|UniProtKB:Q9HBF4 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Zfyve1 Rat metal ion binding enables IEA InterPro:IPR000306 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Zfyve1 Rat phosphatidylinositol-3,4,5-trisphosphate binding enables ISO RGD:1317194 1624291 PMID:11804589 RGD PMID:11804589 Zfyve1 Rat phosphatidylinositol-3,4,5-trisphosphate binding enables IEA UniProtKB:Q9HBF4|ensembl:ENSP00000450742 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Zfyve1 Rat phosphatidylinositol-3,4,5-trisphosphate binding enables IBA PANTHER:PTN002927553|UniProtKB:Q9HBF4 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Zfyve1 Rat phosphatidylinositol-3,4-bisphosphate binding enables ISO RGD:1317194 1624291 PMID:11804589 RGD PMID:11804589 Zfyve1 Rat phosphatidylinositol-3,4-bisphosphate binding enables IEA UniProtKB:Q9HBF4|ensembl:ENSP00000450742 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Zfyve1 Rat phosphatidylinositol-3,4-bisphosphate binding enables IBA PANTHER:PTN002927553|UniProtKB:Q9HBF4 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Zfyve1 Rat phosphatidylinositol-3-phosphate binding enables ISO RGD:1317194 1624291 PMID:31293035 RGD PMID:31293035 Zfyve1 Rat phosphatidylinositol-3-phosphate binding enables IBA PANTHER:PTN002927553|UniProtKB:Q9HBF4 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Zfyve1 Rat phosphatidylinositol-3-phosphate binding enables IEA UniProtKB:Q9HBF4|ensembl:ENSP00000450742 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Zfyve1 Rat protein binding enables ISO RGD:1317194 1624291 UniProtKB:O43264|UniProtKB:P0DTD1-PRO_0000449624|UniProtKB:P62136|UniProtKB:Q96A72|UniProtKB:Q96G97|UniProtKB:Q9NP72 PMID:19389623, PMID:30970241, PMID:31293035, PMID:32296183, PMID:35551511 RGD PMID:19389623|PMID:30970241|PMID:31293035|PMID:32296183|PMID:35551511
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) actinomycin D (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP,ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) Brodifacoum (EXP) cadmium dichloride (EXP) camptothecin (ISO) cisplatin (ISO) cobalt dichloride (EXP,ISO) copper(II) sulfate (ISO) coumestrol (ISO) DDE (ISO) dexamethasone (ISO) diuron (EXP) doxorubicin (ISO) Enterolactone (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) folic acid (ISO) formaldehyde (ISO) hydrogen peroxide (ISO) indometacin (ISO) methapyrilene (ISO) methyl methanesulfonate (ISO) Nutlin-3 (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (ISO) quercetin (ISO) resveratrol (ISO) sodium arsenite (ISO) thiram (ISO) titanium dioxide (ISO) toxaphene (EXP) trichostatin A (ISO) triphenyl phosphate (EXP,ISO) urethane (ISO) valproic acid (ISO)
Cellular Component
autophagosome (IEA,ISO) endoplasmic reticulum (IEA,ISO) endoplasmic reticulum membrane (IEA,ISO) extrinsic component of omegasome membrane (IEA,ISO) Golgi apparatus (IEA,ISO) Golgi stack (IEA,ISO) lipid droplet (IBA,IEA,ISO) membrane (IEA,ISO) mitochondria-associated endoplasmic reticulum membrane contact site (IEA,ISO) mitochondrion (IEA,ISO) omegasome (IEA,ISO) perinuclear region of cytoplasm (IEA,ISO) phagophore assembly site (IEA,ISO)
Molecular Function
1-phosphatidylinositol binding (IBA,IEA,ISO) metal ion binding (IEA) phosphatidylinositol-3,4,5-trisphosphate binding (IBA,IEA,ISO) phosphatidylinositol-3,4-bisphosphate binding (IBA,IEA,ISO) phosphatidylinositol-3-phosphate binding (IBA,IEA,ISO) protein binding (ISO)
Zfyve1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 108,916,062 - 108,965,231 (-) NCBI GRCr8 mRatBN7.2 6 103,184,938 - 103,234,111 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 103,184,938 - 103,234,039 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 103,346,651 - 103,395,756 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 103,645,865 - 103,694,962 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 103,015,337 - 103,064,435 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 107,031,411 - 107,080,590 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 107,031,412 - 107,080,524 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 118,460,937 - 118,509,830 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 107,498,866 - 107,548,204 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 107,503,540 - 107,551,702 (-) NCBI Celera 6 101,015,641 - 101,064,748 (-) NCBI Celera Cytogenetic Map 6 q31 NCBI
ZFYVE1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 72,969,445 - 73,027,106 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 72,969,451 - 73,027,131 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 73,436,153 - 73,493,814 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 72,505,912 - 72,563,592 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 72,505,911 - 72,523,417 NCBI Celera 14 53,499,299 - 53,557,223 (-) NCBI Celera Cytogenetic Map 14 q24.2 NCBI HuRef 14 53,602,230 - 53,659,971 (-) NCBI HuRef CHM1_1 14 73,374,318 - 73,431,997 (-) NCBI CHM1_1 T2T-CHM13v2.0 14 67,175,059 - 67,232,660 (-) NCBI T2T-CHM13v2.0
Zfyve1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 83,593,330 - 83,679,289 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 83,593,332 - 83,643,996 (-) Ensembl GRCm39 Ensembl GRCm38 12 83,546,556 - 83,597,245 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 83,546,558 - 83,597,222 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 84,887,891 - 84,938,097 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 84,436,673 - 84,484,642 (-) NCBI MGSCv36 mm8 Celera 12 84,993,303 - 85,043,636 (-) NCBI Celera Cytogenetic Map 12 D1 NCBI cM Map 12 38.76 NCBI
Zfyve1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955523 2,334,175 - 2,388,612 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955523 2,334,175 - 2,388,612 (+) NCBI ChiLan1.0 ChiLan1.0
ZFYVE1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 74,081,251 - 74,138,942 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 73,297,764 - 73,355,455 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 53,550,688 - 53,608,297 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 72,414,810 - 72,471,578 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 72,414,810 - 72,471,578 (-) Ensembl panpan1.1 panPan2
ZFYVE1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 46,353,489 - 46,407,912 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 46,353,761 - 46,406,038 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 46,033,682 - 46,088,098 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 46,575,384 - 46,629,813 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 46,575,394 - 46,629,785 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 46,243,456 - 46,297,884 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 46,259,416 - 46,313,970 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 46,650,744 - 46,705,414 (-) NCBI UU_Cfam_GSD_1.0
Zfyve1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 29,704,511 - 29,764,447 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936488 2,304,438 - 2,364,709 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936488 2,304,521 - 2,364,472 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ZFYVE1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 96,323,262 - 96,380,284 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 96,323,256 - 96,380,286 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 102,110,548 - 102,167,573 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ZFYVE1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 50,219,429 - 50,276,783 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 50,220,867 - 50,273,900 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 38,397,013 - 38,456,640 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Zfyve1
.
Predicted Target Of
Count of predictions: 191 Count of miRNA genes: 118 Interacting mature miRNAs: 142 Transcripts: ENSRNOT00000011662 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12801411 Schws8 Schwannoma susceptibility QTL 8 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 94968928 139968928 Rat 1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 1358355 Srcrt4 Stress Responsive Cort QTL 4 6.39 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 100364669 140994061 Rat 634330 Pia16 Pristane induced arthritis QTL 16 3.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 6 45790088 104200226 Rat 2313399 Anxrr28 Anxiety related response QTL 28 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 6 100671796 132340886 Rat 1331789 Rf37 Renal function QTL 37 3.224 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 6 72202632 115200186 Rat 1331725 Bp212 Blood pressure QTL 212 3.52475 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 93701310 128713626 Rat 1331722 Thshl1 Thyroid stimulating hormone level QTL 1 11.7 0.0001 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 6 89762877 106752806 Rat 8552796 Vie3 Viral induced encephalitis QTL 3 2.6 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 6 96833997 140994061 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 70176 Mcsm1 Mammary carcinoma susceptibility modifier QTL 1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 58632962 103632962 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 1558641 Cm47 Cardiac mass QTL 47 2.9 0.001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 6 57730540 104085867 Rat 61414 Pia3 Pristane induced arthritis QTL 3 4.5 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 6 94968928 137848904 Rat 724524 Uae2 Urinary albumin excretion QTL 2 2.7 0.0005 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 73463459 109394713 Rat 737827 Hcar11 Hepatocarcinoma resistance QTL 11 4.4 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 6 82523650 110548006 Rat 1641904 Alcrsp4 Alcohol response QTL 4 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 6 67262953 112262953 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 2293837 Kiddil1 Kidney dilation QTL 1 3.7 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 2293842 Kiddil3 Kidney dilation QTL 3 4.3 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 70196 BpQTLcluster7 Blood pressure QTL cluster 7 6.82 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 72202632 117202632 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 1576302 Schws4 Schwannoma susceptibility QTL 4 0.0078 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 83190345 106747639 Rat 1300075 Glom7 Glomerulus QTL 7 5.6 0.0000002 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 6 71201409 116201409 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 12801471 Schws9 Schwannoma susceptibility QTL 9 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 61747639 106747639 Rat 6893332 Cm74 Cardiac mass QTL 74 0.4 0.64 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 57730540 104085867 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat
D6Got139
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 103,210,322 - 103,210,596 (+) MAPPER mRatBN7.2 Rnor_6.0 6 107,056,796 - 107,057,069 NCBI Rnor6.0 Rnor_5.0 6 118,484,173 - 118,484,446 UniSTS Rnor5.0 RGSC_v3.4 6 107,524,113 - 107,524,387 RGD RGSC3.4 RGSC_v3.4 6 107,524,114 - 107,524,387 UniSTS RGSC3.4 RGSC_v3.1 6 107,527,569 - 107,527,843 RGD Celera 6 101,041,022 - 101,041,295 UniSTS RH 3.4 Map 6 735.8 UniSTS RH 3.4 Map 6 735.8 RGD RH 2.0 Map 6 985.0 RGD Cytogenetic Map 6 q24 UniSTS
RH143685
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 103,187,923 - 103,188,095 (+) MAPPER mRatBN7.2 Rnor_6.0 6 107,034,398 - 107,034,569 NCBI Rnor6.0 Rnor_5.0 6 118,506,673 - 118,506,844 UniSTS Rnor5.0 RGSC_v3.4 6 107,501,852 - 107,502,023 UniSTS RGSC3.4 Celera 6 101,018,627 - 101,018,798 UniSTS RH 3.4 Map 6 736.7 UniSTS Cytogenetic Map 6 q24 UniSTS
BF398857
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 103,185,352 - 103,185,561 (+) MAPPER mRatBN7.2 Rnor_6.0 6 107,031,827 - 107,032,035 NCBI Rnor6.0 Rnor_5.0 6 118,509,207 - 118,509,415 UniSTS Rnor5.0 RGSC_v3.4 6 107,499,281 - 107,499,489 UniSTS RGSC3.4 Celera 6 101,016,056 - 101,016,264 UniSTS RH 3.4 Map 6 738.2 UniSTS Cytogenetic Map 6 q24 UniSTS
AU049980
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 103,210,329 - 103,210,555 (+) MAPPER mRatBN7.2 Rnor_6.0 6 107,056,803 - 107,057,028 NCBI Rnor6.0 Rnor_5.0 6 118,484,214 - 118,484,439 UniSTS Rnor5.0 RGSC_v3.4 6 107,524,121 - 107,524,346 UniSTS RGSC3.4 Celera 6 101,041,029 - 101,041,254 UniSTS Cytogenetic Map 6 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011662 ⟹ ENSRNOP00000011662
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 103,184,938 - 103,234,039 (-) Ensembl Rnor_6.0 Ensembl 6 107,031,412 - 107,080,524 (-) Ensembl
RefSeq Acc Id:
NM_001106743 ⟹ NP_001100213
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 108,916,062 - 108,965,160 (-) NCBI mRatBN7.2 6 103,184,938 - 103,234,039 (-) NCBI Rnor_6.0 6 107,031,412 - 107,080,524 (-) NCBI Rnor_5.0 6 118,460,937 - 118,509,830 (+) NCBI RGSC_v3.4 6 107,498,866 - 107,548,204 (-) RGD Celera 6 101,015,641 - 101,064,748 (-) RGD
Sequence:
GCTGATTCCAACTGACAACAAGAGAGGAGGAAGCCTGGGAGGCAGCAGAGGAGGAGGGGGCGGAGATGGAACTGAGGATGGATCCACCGGGGCCCTAGAGCAGCCCAGGTCCCGTCGCCAATCCGCGT
hide sequence
RefSeq Acc Id:
XM_006240323 ⟹ XP_006240385
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 108,916,064 - 108,965,227 (-) NCBI mRatBN7.2 6 103,184,939 - 103,234,109 (-) NCBI Rnor_6.0 6 107,031,411 - 107,080,590 (-) NCBI Rnor_5.0 6 118,460,937 - 118,509,830 (+) NCBI
Sequence:
CCCTCTCTGGGTTGCGCTGTTCATGCCTTCCTGTTGGTCCGAGCTGGGAGAAGTTCACTCTGATCAGCTGATTCCAACTGACAACAAGAGAGGAGGAAGCCTGGGAGGCAGCAGAGGAGGAGGGGGCG
hide sequence
RefSeq Acc Id:
XM_039112023 ⟹ XP_038967951
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 108,916,064 - 108,965,223 (-) NCBI mRatBN7.2 6 103,184,939 - 103,234,111 (-) NCBI
RefSeq Acc Id:
XM_039112024 ⟹ XP_038967952
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 108,916,064 - 108,965,227 (-) NCBI mRatBN7.2 6 103,184,939 - 103,234,111 (-) NCBI
RefSeq Acc Id:
XM_039112025 ⟹ XP_038967953
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 108,916,064 - 108,965,218 (-) NCBI mRatBN7.2 6 103,184,939 - 103,234,111 (-) NCBI
RefSeq Acc Id:
XM_063261729 ⟹ XP_063117799
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 108,916,064 - 108,965,231 (-) NCBI
RefSeq Acc Id:
XM_063261730 ⟹ XP_063117800
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 108,916,064 - 108,965,223 (-) NCBI
RefSeq Acc Id:
XM_063261732 ⟹ XP_063117802
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 108,916,064 - 108,947,254 (-) NCBI
RefSeq Acc Id:
NP_001100213 ⟸ NM_001106743
- UniProtKB:
D4A3T4 (UniProtKB/TrEMBL), A6JDQ1 (UniProtKB/TrEMBL)
- Sequence:
MSAQTSLAEKGLNPGLMCQESYACSGTDEAVFECDECCSLQCLRCEEELHRQERLRNHERIRLKAGHVPYCDPCKGPNGHSPGVRQRAAVRCQTCKINLCLECQKRTHSGGNKRRHPVTVYHVSKVQE
hide sequence
RefSeq Acc Id:
XP_006240385 ⟸ XM_006240323
- Peptide Label:
isoform X2
- Sequence:
MSAQTSLAEKGLNPGLMCQESYACSGTDEAVFECDECCSLQCLRCEEELHRQERLRNHERIRLK
hide sequence
Ensembl Acc Id:
ENSRNOP00000011662 ⟸ ENSRNOT00000011662
RefSeq Acc Id:
XP_038967953 ⟸ XM_039112025
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038967952 ⟸ XM_039112024
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038967951 ⟸ XM_039112023
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063117799 ⟸ XM_063261729
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063117800 ⟸ XM_063261730
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063117802 ⟸ XM_063261732
- Peptide Label:
isoform X3
RGD ID: 13694714 Promoter ID: EPDNEW_R5237 Type: multiple initiation site Name: Zfyve1_1 Description: zinc finger FYVE-type containing 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 107,080,534 - 107,080,594 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-19
Zfyve1
zinc finger FYVE-type containing 1
Zfyve1
zinc finger, FYVE domain containing 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Zfyve1
zinc finger, FYVE domain containing 1
Zfyve1_predicted
zinc finger, FYVE domain containing 1 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Zfyve1_predicted
zinc finger, FYVE domain containing 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
