Advanced Search (OLGA)

Gene: Ptpdc1 (protein tyrosine phosphatase domain containing 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ptpdc1

Name:

protein tyrosine phosphatase domain containing 1

RGD ID:

1307698

Description:

Predicted to act upstream of or within cilium assembly and smoothened signaling pathway. Predicted to be located in cytosol and nucleoplasm. Orthologous to human PTPDC1 (protein tyrosine phosphatase domain containing 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amphetamine.

Type:

protein-coding (Ensembl: pseudogene)

RefSeq Status:

PROVISIONAL

Previously known as:

LOC291022; protein tyrosine phosphatase domain-containing protein 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	16,235,311 - 16,284,160 (+)	NCBI		GRCr8
mRatBN7.2	17	16,028,964 - 16,076,512 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	16,049,382 - 16,076,512 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	15,908,234 - 15,956,796 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	17,513,215 - 17,561,781 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	15,835,026 - 15,883,594 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	16,333,369 - 16,381,887 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	16,333,415 - 16,380,573 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	18,389,442 - 18,438,000 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	22,034,186 - 22,082,481 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	22,068,165 - 22,081,963 (+)	NCBI
Celera	17	15,755,398 - 15,802,644 (+)	NCBI		Celera
Cytogenetic Map	17	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ptpdc1	Rat	hiatus hernia		ISO	PTPDC1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hiatus hernia	ClinVar

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ptpdc1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Ptpdc1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of PTPDC1 mRNA	CTD	PMID:19465110
Ptpdc1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of PTPDC1 mRNA	CTD	PMID:33387578
Ptpdc1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	PTPDC1 (Homo sapiens)	6480464	Tetrachlorodibenzodioxin affects the expression of PTPDC1 mRNA	CTD	PMID:22574217
Ptpdc1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Ptpdc1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of PTPDC1 mRNA	CTD	PMID:21570461
Ptpdc1	Rat	5-aza-2'-deoxycytidine	affects expression	ISO	PTPDC1 (Homo sapiens)	6480464	Decitabine affects the expression of PTPDC1 mRNA	CTD	PMID:23300844
Ptpdc1	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of PTPDC1 mRNA	CTD	PMID:24780913
Ptpdc1	Rat	aflatoxin B1	increases expression	ISO	Ptpdc1 (Mus musculus)	6480464	Aflatoxin B1 results in increased expression of PTPDC1 mRNA	CTD	PMID:19770486
Ptpdc1	Rat	all-trans-retinoic acid	decreases expression	ISO	PTPDC1 (Homo sapiens)	6480464	Tretinoin results in decreased expression of PTPDC1 mRNA	CTD	PMID:33167477
Ptpdc1	Rat	amphetamine	decreases expression	EXP		6480464	Amphetamine results in decreased expression of PTPDC1 mRNA	CTD	PMID:30779732
Ptpdc1	Rat	antirheumatic drug	increases expression	ISO	PTPDC1 (Homo sapiens)	6480464	Antirheumatic Agents results in increased expression of PTPDC1 mRNA	CTD	PMID:24449571
Ptpdc1	Rat	arsane	multiple interactions	ISO	PTPDC1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PTPDC1 mRNA	CTD	PMID:39836092
Ptpdc1	Rat	arsenic atom	multiple interactions	ISO	PTPDC1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PTPDC1 mRNA	CTD	PMID:39836092
Ptpdc1	Rat	arsenous acid	decreases expression	ISO	PTPDC1 (Homo sapiens)	6480464	Arsenic Trioxide results in decreased expression of PTPDC1 mRNA	CTD	PMID:20458559
Ptpdc1	Rat	avobenzone	increases expression	ISO	PTPDC1 (Homo sapiens)	6480464	avobenzone results in increased expression of PTPDC1 mRNA	CTD	PMID:31016361
Ptpdc1	Rat	benzo[a]pyrene	increases mutagenesis	ISO	PTPDC1 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased mutagenesis of PTPDC1 gene	CTD	PMID:25435355
Ptpdc1	Rat	benzo[a]pyrene	increases methylation	ISO	PTPDC1 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of PTPDC1 promoter	CTD	PMID:27901495
Ptpdc1	Rat	benzo[a]pyrene	increases expression	ISO	PTPDC1 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of PTPDC1 mRNA	CTD	PMID:30453624
Ptpdc1	Rat	benzo[a]pyrene	increases expression	ISO	Ptpdc1 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of PTPDC1 mRNA	CTD	PMID:19770486 and PMID:22228805
Ptpdc1	Rat	benzo[a]pyrene	multiple interactions	ISO	Ptpdc1 (Mus musculus)	6480464	AHR protein affects the reaction [Benzo(a)pyrene affects the expression of PTPDC1 mRNA]	CTD	PMID:22228805
Ptpdc1	Rat	benzo[b]fluoranthene	increases expression	ISO	Ptpdc1 (Mus musculus)	6480464	benzo(b)fluoranthene results in increased expression of PTPDC1 mRNA	CTD	PMID:26377693
Ptpdc1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of PTPDC1 mRNA	CTD	PMID:25181051
Ptpdc1	Rat	bisphenol A	multiple interactions	ISO	PTPDC1 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of PTPDC1 gene	CTD	PMID:31601247
Ptpdc1	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of PTPDC1 gene	CTD	PMID:28505145
Ptpdc1	Rat	caffeine	decreases phosphorylation	ISO	PTPDC1 (Homo sapiens)	6480464	Caffeine results in decreased phosphorylation of PTPDC1 protein	CTD	PMID:35688186
Ptpdc1	Rat	carbon nanotube	decreases expression	ISO	Ptpdc1 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
Ptpdc1	Rat	CGP 52608	multiple interactions	ISO	PTPDC1 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to PTPDC1 gene]	CTD	PMID:28238834
Ptpdc1	Rat	cisplatin	affects expression	ISO	PTPDC1 (Homo sapiens)	6480464	Cisplatin affects the expression of PTPDC1 mRNA	CTD	PMID:23300844
Ptpdc1	Rat	cisplatin	decreases expression	EXP		6480464	Cisplatin results in decreased expression of PTPDC1 protein	CTD	PMID:17321087
Ptpdc1	Rat	copper atom	multiple interactions	ISO	PTPDC1 (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in increased expression of PTPDC1 mRNA	CTD	PMID:20971185
Ptpdc1	Rat	copper(0)	multiple interactions	ISO	PTPDC1 (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in increased expression of PTPDC1 mRNA	CTD	PMID:20971185
Ptpdc1	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of PTPDC1 mRNA	CTD	PMID:26577399
Ptpdc1	Rat	cyclosporin A	increases expression	ISO	PTPDC1 (Homo sapiens)	6480464	Cyclosporine results in increased expression of PTPDC1 mRNA	CTD	PMID:20106945 more ...
Ptpdc1	Rat	diarsenic trioxide	decreases expression	ISO	PTPDC1 (Homo sapiens)	6480464	Arsenic Trioxide results in decreased expression of PTPDC1 mRNA	CTD	PMID:20458559
Ptpdc1	Rat	dorsomorphin	multiple interactions	ISO	PTPDC1 (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PTPDC1 mRNA	CTD	PMID:27188386
Ptpdc1	Rat	doxorubicin	decreases expression	ISO	PTPDC1 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of PTPDC1 mRNA	CTD	PMID:29803840
Ptpdc1	Rat	ethanol	affects expression	ISO	Ptpdc1 (Mus musculus)	6480464	Ethanol affects the expression of PTPDC1 mRNA	CTD	PMID:30319688
Ptpdc1	Rat	folic acid	decreases expression	ISO	Ptpdc1 (Mus musculus)	6480464	Folic Acid results in decreased expression of PTPDC1 mRNA	CTD	PMID:25629700
Ptpdc1	Rat	FR900359	decreases phosphorylation	ISO	PTPDC1 (Homo sapiens)	6480464	FR900359 results in decreased phosphorylation of PTPDC1 protein	CTD	PMID:37730182
Ptpdc1	Rat	fulvestrant	multiple interactions	ISO	PTPDC1 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of PTPDC1 gene	CTD	PMID:31601247
Ptpdc1	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of PTPDC1 mRNA	CTD	PMID:33387578
Ptpdc1	Rat	glyphosate	increases expression	ISO	Ptpdc1 (Mus musculus)	6480464	Glyphosate results in increased expression of PTPDC1 mRNA	CTD	PMID:35897073
Ptpdc1	Rat	leflunomide	increases expression	ISO	PTPDC1 (Homo sapiens)	6480464	leflunomide results in increased expression of PTPDC1 mRNA	CTD	PMID:28988120
Ptpdc1	Rat	manganese atom	multiple interactions	ISO	PTPDC1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PTPDC1 mRNA	CTD	PMID:39836092
Ptpdc1	Rat	manganese(0)	multiple interactions	ISO	PTPDC1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PTPDC1 mRNA	CTD	PMID:39836092
Ptpdc1	Rat	manganese(II) chloride	multiple interactions	ISO	PTPDC1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PTPDC1 mRNA	CTD	PMID:39836092
Ptpdc1	Rat	Monobutylphthalate	decreases expression	EXP		6480464	monobutyl phthalate results in decreased expression of PTPDC1 mRNA	CTD	PMID:29162477
Ptpdc1	Rat	paracetamol	increases expression	ISO	PTPDC1 (Homo sapiens)	6480464	Acetaminophen results in increased expression of PTPDC1 mRNA	CTD	PMID:22230336
Ptpdc1	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of PTPDC1 mRNA	CTD	PMID:33387578
Ptpdc1	Rat	perfluorooctanoic acid	increases expression	ISO	PTPDC1 (Homo sapiens)	6480464	perfluorooctanoic acid results in increased expression of PTPDC1 mRNA	CTD	PMID:36326898
Ptpdc1	Rat	phenylmercury acetate	decreases expression	ISO	PTPDC1 (Homo sapiens)	6480464	Phenylmercuric Acetate results in decreased expression of PTPDC1 mRNA	CTD	PMID:26272509
Ptpdc1	Rat	phenylmercury acetate	multiple interactions	ISO	PTPDC1 (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PTPDC1 mRNA	CTD	PMID:27188386
Ptpdc1	Rat	pirinixic acid	increases expression	ISO	Ptpdc1 (Mus musculus)	6480464	pirinixic acid results in increased expression of PTPDC1 mRNA	CTD	PMID:20813756
Ptpdc1	Rat	SB 431542	multiple interactions	ISO	PTPDC1 (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PTPDC1 mRNA	CTD	PMID:27188386
Ptpdc1	Rat	sodium arsenite	increases expression	ISO	PTPDC1 (Homo sapiens)	6480464	sodium arsenite results in increased expression of PTPDC1 mRNA	CTD	PMID:38568856
Ptpdc1	Rat	sodium arsenite	multiple interactions	ISO	PTPDC1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PTPDC1 mRNA	CTD	PMID:39836092
Ptpdc1	Rat	sodium arsenite	decreases expression	ISO	PTPDC1 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of PTPDC1 mRNA	CTD	PMID:34032870
Ptpdc1	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of PTPDC1 mRNA	CTD	PMID:31150632
Ptpdc1	Rat	thapsigargin	increases expression	ISO	PTPDC1 (Homo sapiens)	6480464	Thapsigargin results in increased expression of PTPDC1 mRNA	CTD	PMID:22378314
Ptpdc1	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of PTPDC1 mRNA	CTD	PMID:33387578
Ptpdc1	Rat	trichostatin A	increases expression	ISO	PTPDC1 (Homo sapiens)	6480464	trichostatin A results in increased expression of PTPDC1 mRNA	CTD	PMID:24935251
Ptpdc1	Rat	triphenyl phosphate	affects expression	ISO	PTPDC1 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of PTPDC1 mRNA	CTD	PMID:37042841
Ptpdc1	Rat	Triptolide	increases expression	ISO	Ptpdc1 (Mus musculus)	6480464	triptolide results in increased expression of PTPDC1 mRNA	CTD	PMID:32835833
Ptpdc1	Rat	tunicamycin	increases expression	ISO	PTPDC1 (Homo sapiens)	6480464	Tunicamycin results in increased expression of PTPDC1 mRNA	CTD	PMID:22378314
Ptpdc1	Rat	valproic acid	decreases expression	ISO	PTPDC1 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of PTPDC1 mRNA	CTD	PMID:23179753
Ptpdc1	Rat	valproic acid	affects expression	ISO	PTPDC1 (Homo sapiens)	6480464	Valproic Acid affects the expression of PTPDC1 mRNA	CTD	PMID:25979313
Ptpdc1	Rat	valproic acid	increases expression	ISO	PTPDC1 (Homo sapiens)	6480464	Valproic Acid results in increased expression of PTPDC1 mRNA	CTD	PMID:24935251 and PMID:29154799
Ptpdc1	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of PTPDC1 mRNA	CTD	PMID:23869203

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ptpdc1	Rat	cilium assembly	acts_upstream_of_or_within	ISO	Ptpdc1 (Mus musculus)	1624291	PMID:21289087	RGD	PMID:21289087
Ptpdc1	Rat	smoothened signaling pathway	acts_upstream_of_or_within	ISO	Ptpdc1 (Mus musculus)	1624291	PMID:21289087	RGD	PMID:21289087

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ptpdc1	Rat	cytosol	located_in	ISO	PTPDC1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Ptpdc1	Rat	nucleoplasm	located_in	ISO	PTPDC1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ptpdc1	Rat	protein binding	enables	ISO	PTPDC1 (Homo sapiens)	1624291	UniProtKB:P28482 more ...	RGD	PMID:32296183 and PMID:33961781

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:21289087

Ptpdc1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	16,235,311 - 16,284,160 (+)	NCBI		GRCr8
mRatBN7.2	17	16,028,964 - 16,076,512 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	16,049,382 - 16,076,512 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	15,908,234 - 15,956,796 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	17,513,215 - 17,561,781 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	15,835,026 - 15,883,594 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	16,333,369 - 16,381,887 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	16,333,415 - 16,380,573 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	18,389,442 - 18,438,000 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	22,034,186 - 22,082,481 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	22,068,165 - 22,081,963 (+)	NCBI
Celera	17	15,755,398 - 15,802,644 (+)	NCBI		Celera
Cytogenetic Map	17	p14	NCBI

PTPDC1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	94,030,813 - 94,109,856 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	94,030,794 - 94,109,856 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	96,793,095 - 96,872,138 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	95,832,897 - 95,911,957 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	93,872,630 - 93,951,691	NCBI
Celera	9	67,234,631 - 67,313,691 (+)	NCBI		Celera
Cytogenetic Map	9	q22.32	NCBI
HuRef	9	66,469,862 - 66,548,925 (+)	NCBI		HuRef
CHM1_1	9	96,939,857 - 97,018,968 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	106,198,554 - 106,277,594 (+)	NCBI		T2T-CHM13v2.0

Ptpdc1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	48,731,345 - 48,779,148 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	48,731,348 - 48,779,140 (-)	Ensembl		GRCm39 Ensembl
GRCm38	13	48,577,869 - 48,625,672 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	48,577,872 - 48,625,664 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	48,673,241 - 48,720,942 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	48,589,809 - 48,637,510 (-)	NCBI		MGSCv36	mm8
Celera	13	49,668,289 - 49,715,985 (-)	NCBI		Celera
Cytogenetic Map	13	A5	NCBI
cM Map	13	24.86	NCBI

Ptpdc1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955515	3,912,117 - 4,044,999 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955515	3,912,495 - 4,044,999 (+)	NCBI	ChiLan1.0	ChiLan1.0

PTPDC1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	45,320,971 - 45,400,235 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	45,323,351 - 45,402,623 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	65,151,252 - 65,230,335 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	93,212,501 - 93,290,945 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	93,212,501 - 93,290,945 (+)	Ensembl	panpan1.1		panPan2

PTPDC1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	97,942,905 - 98,002,025 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	97,944,325 - 98,002,074 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	98,339,476 - 98,398,283 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	98,560,495 - 98,619,810 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	98,561,623 - 98,619,511 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	98,175,878 - 98,234,664 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	97,911,546 - 97,970,822 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	98,666,042 - 98,725,278 (-)	NCBI		UU_Cfam_GSD_1.0

Ptpdc1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	9,006,809 - 9,045,890 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004937000	156,596 - 195,717 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004937000	156,634 - 195,760 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PTPDC1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	43,321,476 - 43,418,784 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	43,321,391 - 43,418,788 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	44,640,924 - 44,736,247 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PTPDC1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	104,365,169 - 104,499,156 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	104,365,419 - 104,446,306 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	92,677,822 - 92,802,996 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ptpdc1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624868	2,414,265 - 2,487,620 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624868	2,414,320 - 2,517,703 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ptpdc1
509 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	195
Count of miRNA genes:	129
Interacting mature miRNAs:	146
Transcripts:	ENSRNOT00000060550
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
2300002	Iddm36	Insulin dependent diabetes mellitus QTL 36	1.98		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	9991286	40540197	Rat
631499	Stl1	Serum triglyceride level QTL 1	3.6		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	3271398	27389946	Rat
2293664	Bmd28	Bone mineral density QTL 28	5.1	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	17	4354487	27028127	Rat
1354640	Scl32	Serum cholesterol level QTL 32	5.4		blood HDL cholesterol amount (VT:0000184)	blood high density lipoprotein cholesterol level (CMO:0000052)	17	15781592	60781592	Rat
1300123	Bp194	Blood pressure QTL 194	2.82		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	2115149	34551001	Rat
1582224	Epfw4	Epididymal fat weight QTL 4	3.5	0.0058	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	17	9201365	23653323	Rat
1582225	Bw67	Body weight QTL 67	6.2	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582226	Bw64	Body weight QTL 64	4.2	0.0017	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
10401807	Kidm52	Kidney mass QTL 52			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	1	31701463	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4528038	49528038	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
1582208	Kidm32	Kidney mass QTL 32	3.9	0.0018	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	9201365	23653323	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
1549900	Iddm20	Insulin dependent diabetes mellitus QTL 20	3.7		pancreas integrity trait (VT:0010560)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	17	13986773	21975515	Rat
1331720	Rf43	Renal function QTL 43	2.881		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	17	15330613	23017269	Rat
1354613	Kidm14	Kidney mass QTL 14	6.2		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	17	4299130	35837242	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15330613	55836425	Rat
2324619	Coatc4	Coat color QTL 4		0.001	coat/hair pigmentation trait (VT:0010463)	pigmented dorsal coat/hair area to total dorsal coat/hair area ratio (CMO:0001811)	17	4299130	21293263	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4528038	49528038	Rat
70184	BpQTLcluster14	Blood pressure QTL cluster 14	3.38		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	1	31990913	Rat
1581553	Pur14	Proteinuria QTL 14	5.3	0.0001	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	17	7979968	16317111	Rat
2303561	Bw91	Body weight QTL 91	2		body mass (VT:0001259)	body weight (CMO:0000012)	17	8868462	53868462	Rat
1582258	Bw76	Body weight QTL 76	4.6	0.0005	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
631207	Niddm41	Non-insulin dependent diabetes mellitus QTL 41			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	1	37830672	Rat
1582199	Insul5	Insulin level QTL 5	3.4	0.0119	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	17	9201365	23653323	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
2293648	Bmd31	Bone mineral density QTL 31	4.5	0.0001	femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	17	4354487	27028127	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
1641902	Colcr7	Colorectal carcinoma resistance QTL 7	3.35	0.0044	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	17	2115149	21881669	Rat
1354659	Scl68	Serum cholesterol level QTL 68	3.9		blood VLDL cholesterol amount (VT:0005144)	blood very low density lipoprotein cholesterol level (CMO:0000648)	17	15781592	60781592	Rat
1582241	Bw70	Body weight QTL 70	4.6	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582245	Bw73	Body weight QTL 73	4.6	0.0004	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
9590316	Scort21	Serum corticosterone level QTL 21	4.75	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	1	22871563	Rat

D17Got20

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	17	16,277,847 - 16,278,102 (+)	Marker Load Pipeline
mRatBN7.2	17	16,071,491 - 16,071,747 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	16,375,568 - 16,375,822	NCBI	Rnor6.0
Rnor_5.0	17	18,431,681 - 18,431,935	UniSTS	Rnor5.0
RGSC_v3.4	17	22,077,475 - 22,077,730	RGD	RGSC3.4
RGSC_v3.4	17	22,077,476 - 22,077,730	UniSTS	RGSC3.4
RGSC_v3.1	17	22,077,476 - 22,077,730	RGD
Celera	17	15,797,639 - 15,797,893	UniSTS
RH 3.4 Map	17	192.0	RGD
RH 3.4 Map	17	192.0	UniSTS
RH 2.0 Map	17	147.6	RGD
Cytogenetic Map	17	p14	UniSTS

BE108539

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	16,030,364 - 16,030,538 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	16,334,816 - 16,334,989	NCBI	Rnor6.0
Rnor_5.0	17	18,390,854 - 18,391,027	UniSTS	Rnor5.0
RGSC_v3.4	17	22,035,587 - 22,035,760	UniSTS	RGSC3.4
Celera	17	15,756,799 - 15,756,972	UniSTS
RH 3.4 Map	17	187.4	UniSTS
Cytogenetic Map	17	p14	UniSTS

AU046352

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	16,071,522 - 16,071,758 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	16,375,601 - 16,375,832	NCBI	Rnor6.0
Rnor_5.0	17	18,431,714 - 18,431,945	UniSTS	Rnor5.0
RGSC_v3.4	17	22,077,509 - 22,077,740	UniSTS	RGSC3.4
Celera	17	15,797,672 - 15,797,903	UniSTS
Cytogenetic Map	17	p14	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001106104	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006253700	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006253701	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017600477	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017600478	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276152	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276153	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276154	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276155	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276156	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276157	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276158	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276159	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_001841733	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010058819	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010058821	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010058823	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473977	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000060550 ⟹ ENSRNOP00000057289

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	17	16,333,415 - 16,380,573 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000089140 ⟹ ENSRNOP00000075617

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	17	16,340,226 - 16,380,248 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118658

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	16,049,382 - 16,076,512 (+)	Ensembl

RefSeq Acc Id:

NM_001106104 ⟹ NP_001099574

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	16,235,311 - 16,282,853 (+)	NCBI
mRatBN7.2	17	16,028,964 - 16,076,512 (+)	NCBI
Rnor_6.0	17	16,333,415 - 16,380,573 (+)	NCBI
Rnor_5.0	17	18,389,442 - 18,438,000 (+)	NCBI
RGSC_v3.4	17	22,034,186 - 22,082,481 (+)	RGD
Celera	17	15,755,398 - 15,802,644 (+)	RGD

Sequence:

show sequence

AGTGGCCGGTGCGCGCGCCAGAGGGAGACGTTGTGTGGCGCGCCCGCCGGGGAGTCCCCCTGCTTAGAGGCGCGGCGGGGAGGCCGGGCCCCGTAGCCGGTGGGCAATAGCAGGCCTGCGGGCAGGCC
GGCGCCGAGGAATCCGAGCAGCGCCTTGGACTCGCCAGTCCTCTCCGCCCGCGCCTCCCGGCCCTAGAAGTCCCAAGACCGATCTGCGGGCTCCAGGGCTCACAAGCCGGAGAGCGAGGCGCGCCAAG
AGGTTCGGAGATGGCTGCAGGAGTCTTGCCGCAGAATGAAAATCCGTATTCCACGTTGGTGAATGACAGTGGGCATGCTGCATACATGGATGAAAATTCAGGCCGCCCAACACCTAAATACACAAAAG
TGGGAGAACGTTTGCGGCATGTCATCCCTGGACACATGGCGTGTTCCATGGCGTGTGGGGGGAGAGCGTGTAAGTACGAGAACCCAGCCCGCTGGAGTGAGCAGGAGCAGGCCATCAAAGGTGTTTAC
TCATCCTGGGTCACTGACAATATCCTGGCCATGGCTCGCCCATCCTCTGAGCTGCTGGAGAAGTATCACATCATTGAGCAGTTCCTCAGTCATGGCATAAAAACAATAATCAACCTGCAGCGTCCTGG
GGAGCATGCCAGCTGTGGGAACTCTCTGGAACAAGAAAGTGGTTTCACATACCTTCCAGAGGCATTTATGGAGGCGGGCATTTATTTCTACAACTTCGGGTGGAAGGATTATGGCGTGGCCTCCCTCA
CTGCCATCTTAGACATGGTAAAGGTGATGACATTTGCCTTACAGGAAGGAAAAGTAGCTGTGCACTGCCACGCAGGGCTCGGGCGCACAGGTGTGCTAATAGCATGTTACTTAGTTTTTGCAACAAGG
ATGACTGCTGACCAAGCAATTATATTCGTGCGGGCAAAACGCCCCAATTCCATTCAGACCAGAGGACAGTTGCTGTGTGTGCGGGAATTCACTCAGTTTCTGGCTCCACTCCGTAATATTTTCTCTTG
CTGCGACCCCAAAGCACACGCTGTTACCTTAGCACAGTACCTGATGCGCCAGCGTCATCTGCTTCATGGTTACGAGGCGCGCCTTCTGAAGTATGTGCCCAAGATCGTCCACCTAGTCTGCAAGCTGC
TGCTGGACGTGGCTGAGAACAGGCCAGTCGTGATGAAGAGCGTGTTAGAAGGACCCGAGCTCTCTGCCGAAATTGAAAAGACGGTGTCTGAAATGGTCACAATGCAGCTAGATCAAGAGTTACTGAGG
CAGAACAGCGATGTGCCTGACCCGTTTAACCCCACTGCAGAGGTGGCCGAGTTCGACAGTCAGGATGTGATCCTTTCTAATGAGCATGAGTTTGACCCCCTCTGGAAGAGGAGGAATATTGAGCGCCT
TCAGCCCCTGACACATCTGAAAAGACAGCTCAGCTACAGTGACTCAGACTTAAAGAGGGCCAAAGCCATCCTGGAGCAAGGGGAGACACCTTGGACAGTGCCTGCCCAGGAGCTGCTCGACCACAGTC
TCCAGCAGCAGACGCCCACAAGCCATTGCTTCCTGCCGCCGACTCCAGAGCTAGGTTTACATAAGGATACACTGGTGCGAAACACGTTTTCTTTCTGGACTGAGTCCAAGTGTGGAGGCTTAGAAGAA
CCCAAGGATGAGGGCTCACTGCTTTTGTGCAGGAAGGACTCTCCGAAGGAGGTACAGAGGAGCAGAACCTTCTCGGTGGGTGTCTCCTGTTCACACAACCCTGGAGAACCAGCGCCACCCAACTTCAC
AAGGACACACAAGGATTCAGAGCGAGGCGCCCACTGCCGGTGTGAGGCTCCTGAGGGTTGGGTGCCAGGCCCTGTTCCCAAGATGGGCCGGAGCCCCTGCAGCCCCCTGCACTGTGACACCAGCCCTA
AAGCGCAGTTCTCATGTGGACAGGAAACCCAGGACAGCACATACCTGCCGGAGGCAACGCCACACGCCGGCCTGCAGTCTGAACTGAACGCTGAAGCAAGGAGGATATTGGCAGCCAAAGCCCTGGCG
AACTTGACTGAGTTTGTTGAGGAGGAGGAGGTGAAAAGGAGAGTGGAAATGTGGCAGAAAGAACTAAATTCCCGAGAGGGAGCCTGGGAACGAATATGTGGTGAGAGAGACCCTTTCATCTTGTGCAG
TTTGATGTGGTCTTGGGTGGAGCAACTGAAAGAACCTGTAATCAGCAAAGAGGATGTGGACATGCTGGTCGACAGACACGCAGATGCTGCCGAAGCCCTGTTTTTACTAGAGAAGGGGCAGTACCAGA
CCATCCTCTGTGTGTTGCATTGCATTGTGAGCCTGCAGACGCTTCCGGTGGAGGTGGAGGAAGCTTGCCTTTCACATGCCATTAAAGCCTTCACCAAGGTTAATTTTGATTCTGAAAATGGACCAATA
GTTTACGACACCCTGAAAAAAATATTTAAGCACACGTTGGAAGAAAAGAGAAAAATGGCAAAAGACAGCCCGAGGCCTGGTCTCTCCTGAAGCTTTCTTCTCTGGACGAGCATCCGACCTAAGCATCC
ATCCATCCCAAGCGGGGAACAGTGCTGGCTGCGCTTCCCCCCCTCCGGCCATTGTCAGTGCTGTCTCCCTTTTTTAGTTATTTATTTTGAAATATCTTTGAGCTGTGTCTTAAAAAATTGCCATAAAG
TTGGTGCCACTTTATTTATTTACTGAATTGATAGTATTGTATTGACATTTTAATTATATTTGTGTCCTTACTCTTTTTGACATTTTGGAGGAAAAAAACAATCCTTTCAAAACAGTTATTCATTTTCT
CTTTCTTTTTCTTTTCTTTCTTTCTTTCTTTTTTTTTTTTTGACAAAACTCTTTGTGGAGTTTTTACCAAATAGATCATTTTAGTAGTAAAACCTCACTATGTATCCTTCCCAAGACATGTGTCCCTC
CCTCAGAGATATGACCTAAGATAGTCACCAAGTGTCTTAAACTGTTTTATATTCGTTACTAAGAAGGCTACTAATACATTTTAAAGGACCTTTAAA

hide sequence

RefSeq Acc Id:

XM_063276152 ⟹ XP_063132222

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	16,268,459 - 16,284,160 (+)	NCBI

RefSeq Acc Id:

XM_063276153 ⟹ XP_063132223

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	16,235,429 - 16,284,160 (+)	NCBI

RefSeq Acc Id:

XM_063276154 ⟹ XP_063132224

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	16,268,459 - 16,282,355 (+)	NCBI

RefSeq Acc Id:

XM_063276155 ⟹ XP_063132225

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	16,268,459 - 16,282,355 (+)	NCBI

RefSeq Acc Id:

XM_063276156 ⟹ XP_063132226

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	16,256,152 - 16,284,160 (+)	NCBI

RefSeq Acc Id:

XM_063276157 ⟹ XP_063132227

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	16,235,517 - 16,284,160 (+)	NCBI

RefSeq Acc Id:

XM_063276158 ⟹ XP_063132228

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	16,235,437 - 16,284,160 (+)	NCBI

RefSeq Acc Id:

XM_063276159 ⟹ XP_063132229

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	16,235,442 - 16,284,160 (+)	NCBI

RefSeq Acc Id:

XR_010058819

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	16,268,459 - 16,284,160 (+)	NCBI

RefSeq Acc Id:

XR_010058821

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	16,235,429 - 16,284,160 (+)	NCBI

RefSeq Acc Id:

XR_010058823

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	16,268,459 - 16,282,355 (+)	NCBI


Protein RefSeqs	NP_001099574	(Get FASTA)	NCBI Sequence Viewer
	XP_063132222	(Get FASTA)	NCBI Sequence Viewer
	XP_063132223	(Get FASTA)	NCBI Sequence Viewer
	XP_063132224	(Get FASTA)	NCBI Sequence Viewer
	XP_063132225	(Get FASTA)	NCBI Sequence Viewer
	XP_063132226	(Get FASTA)	NCBI Sequence Viewer
	XP_063132227	(Get FASTA)	NCBI Sequence Viewer
	XP_063132228	(Get FASTA)	NCBI Sequence Viewer
	XP_063132229	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL98137	(Get FASTA)	NCBI Sequence Viewer
	EDL98138	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000098824
	ENSRNOP00000103066

RefSeq Acc Id:

NP_001099574 ⟸ NM_001106104

- UniProtKB:

A6J6Y7 (UniProtKB/TrEMBL), A6J6Y8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAGVLPQNENPYSTLVNDSGHAAYMDENSGRPTPKYTKVGERLRHVIPGHMACSMACGGRACKYENPARWSEQEQAIKGVYSSWVTDNILAMARPSSELLEKYHIIEQFLSHGIKTIINLQRPGEHA
SCGNSLEQESGFTYLPEAFMEAGIYFYNFGWKDYGVASLTAILDMVKVMTFALQEGKVAVHCHAGLGRTGVLIACYLVFATRMTADQAIIFVRAKRPNSIQTRGQLLCVREFTQFLAPLRNIFSCCDP
KAHAVTLAQYLMRQRHLLHGYEARLLKYVPKIVHLVCKLLLDVAENRPVVMKSVLEGPELSAEIEKTVSEMVTMQLDQELLRQNSDVPDPFNPTAEVAEFDSQDVILSNEHEFDPLWKRRNIERLQPL
THLKRQLSYSDSDLKRAKAILEQGETPWTVPAQELLDHSLQQQTPTSHCFLPPTPELGLHKDTLVRNTFSFWTESKCGGLEEPKDEGSLLLCRKDSPKEVQRSRTFSVGVSCSHNPGEPAPPNFTRTH
KDSERGAHCRCEAPEGWVPGPVPKMGRSPCSPLHCDTSPKAQFSCGQETQDSTYLPEATPHAGLQSELNAEARRILAAKALANLTEFVEEEEVKRRVEMWQKELNSREGAWERICGERDPFILCSLMW
SWVEQLKEPVISKEDVDMLVDRHADAAEALFLLEKGQYQTILCVLHCIVSLQTLPVEVEEACLSHAIKAFTKVNFDSENGPIVYDTLKKIFKHTLEEKRKMAKDSPRPGLS

hide sequence

Ensembl Acc Id:

ENSRNOP00000075617 ⟸ ENSRNOT00000089140

Ensembl Acc Id:

ENSRNOP00000057289 ⟸ ENSRNOT00000060550

RefSeq Acc Id:	XP_063132223 ⟸ XM_063276153
- Peptide Label:	isoform X2
- UniProtKB:	A6J6Y8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063132228 ⟸ XM_063276158
- Peptide Label:	isoform X6
- UniProtKB:	A6J6Y7 (UniProtKB/TrEMBL), A6J6Y8 (UniProtKB/TrEMBL)

Protein Domains

Tyrosine specific protein phosphatases Tyrosine-protein phosphatase

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2KB18-F1-model_v2	AlphaFold	A0A0G2KB18	1-796	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13700360

Promoter ID:

EPDNEW_R10884

Type:

initiation region

Name:

Ptpdc1_1

Description:

protein tyrosine phosphatase domain containing 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	16,333,372 - 16,333,432	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-9976	BioCyc
Ensembl Genes	ENSRNOG00000026564	Ensembl
	ENSRNOG00000064794	Ensembl
	ENSRNOG00000086607	ENTREZGENE
Ensembl Transcript	ENSRNOT00000169259	ENTREZGENE
	ENSRNOT00000171451	ENTREZGENE
Gene3D-CATH	Protein tyrosine phosphatase superfamily	UniProtKB/TrEMBL
InterPro	Dual-sp_phosphatase_cat-dom	UniProtKB/TrEMBL
	Prot-tyrosine_phosphatase-like	UniProtKB/TrEMBL
	PTP	UniProtKB/TrEMBL
	PTPDC1_PTP	UniProtKB/TrEMBL
	Tyr_Pase_AS	UniProtKB/TrEMBL
	Tyr_Pase_cat	UniProtKB/TrEMBL
	Tyr_Pase_dom	UniProtKB/TrEMBL
	TYR_PHOSPHATASE_DUAL_dom	UniProtKB/TrEMBL
KEGG Report	rno:291022	UniProtKB/TrEMBL
NCBI Gene	291022	ENTREZGENE
PANTHER	TYROSINE SPECIFIC PROTEIN PHOSPHATASE AND DUAL SPECIFICITY PROTEIN PHOSPHATASE	UniProtKB/TrEMBL
Pfam	DSPc	UniProtKB/TrEMBL
PhenoGen	Ptpdc1	PhenoGen
PROSITE	TYR_PHOSPHATASE_1	UniProtKB/TrEMBL
	TYR_PHOSPHATASE_2	UniProtKB/TrEMBL
	TYR_PHOSPHATASE_DUAL	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000026564	RatGTEx
	ENSRNOG00000064794	RatGTEx
	ENSRNOG00000086607	RatGTEx
SMART	DSPc	UniProtKB/TrEMBL
	PTPc_motif	UniProtKB/TrEMBL
Superfamily-SCOP	(Phosphotyrosine protein) phosphatases II	UniProtKB/TrEMBL
UniProt	A6J6Y7	ENTREZGENE, UniProtKB/TrEMBL
	A6J6Y8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Ptpdc1	protein tyrosine phosphatase domain containing 1	Ptpdc1_predicted	protein tyrosine phosphatase domain containing 1 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Ptpdc1_predicted	protein tyrosine phosphatase domain containing 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar