Symbol:
Atp8b3
Name:
ATPase phospholipid transporting 8B3
RGD ID:
1307622
Description:
Predicted to enable ATPase-coupled intramembrane lipid transporter activity. Predicted to be involved in Golgi organization and phospholipid translocation. Predicted to act upstream of or within binding activity of sperm to zona pellucida and establishment of localization in cell. Predicted to be located in acrosomal vesicle and membrane. Predicted to be active in plasma membrane and trans-Golgi network. Orthologous to human ATP8B3 (ATPase phospholipid transporting 8B3); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
ATPase, aminophospholipid transporter, class I, type 8B, member 3; ATPase, Class I, type 8B, member 3; LOC299616; MGC188630; phospholipid-transporting ATPase IK; probable phospholipid-transporting ATPase IK
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ATP8B3 (ATPase phospholipid transporting 8B3) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Atp8b3 (ATPase, class I, type 8B, member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Atp8b3 (ATPase phospholipid transporting 8B3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ATP8B3 (ATPase phospholipid transporting 8B3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ATP8B3 (ATPase phospholipid transporting 8B3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Atp8b3 (ATPase phospholipid transporting 8B3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ATP8B3 (ATPase phospholipid transporting 8B3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ATP8B3 (ATPase phospholipid transporting 8B3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Atp8b3 (ATPase phospholipid transporting 8B3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
ATP8B3 (ATPase phospholipid transporting 8B3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Atp8b3 (ATPase, class I, type 8B, member 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
atp8b3 (ATPase phospholipid transporting 8B3)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
ATP8B
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
tat-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
atp8b3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 9,823,496 - 9,846,137 (+) NCBI GRCr8 mRatBN7.2 7 9,175,544 - 9,195,449 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 9,175,391 - 9,195,442 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 7 12,043,764 - 12,063,668 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 12,043,794 - 12,063,650 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 12,211,288 - 12,231,163 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 10,685,983 - 10,705,570 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 10,685,976 - 10,705,327 (+) NCBI Celera 7 7,357,658 - 7,377,501 (+) NCBI Celera Cytogenetic Map 7 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Atp8b3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 9,823,496 - 9,846,137 (+) NCBI GRCr8 mRatBN7.2 7 9,175,544 - 9,195,449 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 9,175,391 - 9,195,442 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 7 12,043,764 - 12,063,668 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 12,043,794 - 12,063,650 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 12,211,288 - 12,231,163 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 10,685,983 - 10,705,570 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 10,685,976 - 10,705,327 (+) NCBI Celera 7 7,357,658 - 7,377,501 (+) NCBI Celera Cytogenetic Map 7 q11 NCBI
ATP8B3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 1,782,075 - 1,812,276 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 1,782,075 - 1,812,276 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 1,782,074 - 1,812,275 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 1,733,074 - 1,763,270 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 1,733,075 - 1,763,270 NCBI Celera 19 1,716,184 - 1,746,354 (-) NCBI Celera Cytogenetic Map 19 p13.3 NCBI HuRef 19 1,553,724 - 1,583,779 (-) NCBI HuRef CHM1_1 19 1,781,666 - 1,811,878 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 1,753,422 - 1,783,592 (-) NCBI T2T-CHM13v2.0
Atp8b3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 80,355,418 - 80,374,987 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 80,355,418 - 80,374,958 (-) Ensembl GRCm39 Ensembl GRCm38 10 80,519,584 - 80,539,154 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 80,519,584 - 80,539,124 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 79,982,330 - 80,001,869 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 79,922,714 - 79,942,253 (-) NCBI MGSCv36 mm8 Celera 10 81,537,386 - 81,556,922 (-) NCBI Celera Cytogenetic Map 10 C1 NCBI cM Map 10 39.72 NCBI
Atp8b3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955495 6,222,602 - 6,242,569 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955495 6,222,764 - 6,242,104 (+) NCBI ChiLan1.0 ChiLan1.0
ATP8B3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 6,151,863 - 6,183,206 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 5,381,293 - 5,414,240 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 779,958 - 810,455 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 1,761,039 - 1,792,419 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 1,761,992 - 1,791,878 (-) Ensembl panpan1.1 panPan2
ATP8B3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 57,144,740 - 57,160,402 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 57,148,281 - 57,160,347 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 56,937,609 - 56,952,836 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 57,875,496 - 57,891,405 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 20 56,933,299 - 56,948,516 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 57,412,902 - 57,428,134 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 57,614,422 - 57,629,651 (+) NCBI UU_Cfam_GSD_1.0
Atp8b3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 216,806,091 - 216,822,681 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936588 1,012,233 - 1,028,287 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936588 1,012,069 - 1,028,113 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ATP8B3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 76,722,247 - 76,745,898 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 76,722,257 - 76,745,899 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 77,402,720 - 77,425,991 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ATP8B3
Atp8b3
.
Assembly: Rnor_5.0 Assembly: Rnor_6.0
Predicted Target Of
Count of predictions: 78 Count of miRNA genes: 71 Interacting mature miRNAs: 73 Transcripts: ENSRNOT00000039813 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1300176 Hrtrt10 Heart rate QTL 10 3.19 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 664270 26029351 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 9590142 Scort5 Serum corticosterone level QTL 5 24.4 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 1 31962314 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 2298550 Neuinf6 Neuroinflammation QTL 6 3.3 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 7 1 27829089 Rat 724560 Plsm3 Polydactyly-luxate syndrome (PLS) morphotypes QTL 3 0.0003 tibia length (VT:0004357) tibia length (CMO:0000450) 7 1 34000259 Rat 7411566 Bw136 Body weight QTL 136 10.4 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 1 31962314 Rat
BE110037
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 9,195,226 - 9,195,378 (+) MAPPER mRatBN7.2 Rnor_6.0 7 12,063,439 - 12,063,590 NCBI Rnor6.0 Rnor_5.0 7 12,230,941 - 12,231,092 UniSTS Rnor5.0 RGSC_v3.4 7 10,705,349 - 10,705,500 UniSTS RGSC3.4 Celera 7 7,377,272 - 7,377,423 UniSTS RH 3.4 Map 7 38.4 UniSTS Cytogenetic Map 7 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
27
113
55
54
24
25
24
6
144
70
93
33
60
30
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000039813 ⟹ ENSRNOP00000031877
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 9,176,399 - 9,195,442 (+) Ensembl Rnor_6.0 Ensembl 7 12,043,794 - 12,063,650 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114677 ⟹ ENSRNOP00000085902
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 9,175,391 - 9,195,442 (+) Ensembl
RefSeq Acc Id:
XM_039080446 ⟹ XP_038936374
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,823,496 - 9,846,137 (+) NCBI mRatBN7.2 7 9,175,544 - 9,195,449 (+) NCBI
RefSeq Acc Id:
XM_039080447 ⟹ XP_038936375
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,823,496 - 9,841,558 (+) NCBI mRatBN7.2 7 9,175,544 - 9,190,876 (+) NCBI
RefSeq Acc Id:
XM_039080448 ⟹ XP_038936376
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,823,496 - 9,840,834 (+) NCBI mRatBN7.2 7 9,175,544 - 9,190,113 (+) NCBI
RefSeq Acc Id:
XM_234937 ⟹ XP_234937
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,823,496 - 9,846,137 (+) NCBI mRatBN7.2 7 9,175,544 - 9,195,449 (+) NCBI Rnor_6.0 7 12,043,764 - 12,063,668 (+) NCBI Rnor_5.0 7 12,211,288 - 12,231,163 (+) NCBI RGSC_v3.4 7 10,685,983 - 10,705,570 (+) RGD
Sequence:
ATGCCCCGCCCCACGAGCCCGCGCCGCCCGTTTCTGACCGGTTGGCACCAGGCTAACAGCTCCACAACATCGTTGGCCCTGGACGCCGCTGGCGGCCCGCCCTAGGCAGCCAGGCCCCACTAAGCCCA
hide sequence
RefSeq Acc Id:
XP_234937 ⟸ XM_234937
- Peptide Label:
isoform X1
- Sequence:
MDDAHLEEDLEDKDTEFTWEVKANDRAYHKQFRKKGFLCWRQKKYKSNAIHTAKYNVFSFLPLNLYEQFRRVSNLYFLFIIILQSIPEISTLPWFTLFAPLVCLLMIRAARDLVDDIGRHRSDRIINN
hide sequence
Ensembl Acc Id:
ENSRNOP00000031877 ⟸ ENSRNOT00000039813
RefSeq Acc Id:
XP_038936374 ⟸ XM_039080446
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038936375 ⟸ XM_039080447
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038936376 ⟸ XM_039080448
- Peptide Label:
isoform X4
Ensembl Acc Id:
ENSRNOP00000085902 ⟸ ENSRNOT00000114677
RGD ID: 13695037 Promoter ID: EPDNEW_R5541 Type: initiation region Name: Atp8b3_1 Description: ATPase phospholipid transporting 8B3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 12,043,827 - 12,043,887 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-17
Atp8b3
ATPase phospholipid transporting 8B3
Atp8b3
ATPase, aminophospholipid transporter, class I, type 8B, member 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-07-30
Atp8b3
ATPase, aminophospholipid transporter, class I, type 8B, member 3
Atp8b3
ATPase, Class I, type 8B, member 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Atp8b3
ATPase, Class I, type 8B, member 3
Atp8b3_predicted
ATPase, Class I, type 8B, member 3 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Atp8b3_predicted
ATPase, Class I, type 8B, member 3 (predicted)
Symbol and Name status set to approved
70820 APPROVED
