Advanced Search (OLGA)

Gene: Comtd1 (catechol-O-methyltransferase domain containing 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Comtd1

Name:

catechol-O-methyltransferase domain containing 1

RGD ID:

1306581

Description:

Predicted to enable S-adenosylmethionine-dependent methyltransferase activity. Predicted to be involved in methylation. Predicted to be located in mitochondrion. Orthologous to human COMTD1 (catechol-O-methyltransferase domain containing 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

catechol O-methyltransferase domain-containing protein 1; LOC305685

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	2,509,121 - 2,512,232 (+)	NCBI		GRCr8
mRatBN7.2	15	2,459,783 - 2,462,895 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	2,459,783 - 2,462,895 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	2,467,227 - 2,470,346 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	3,853,673 - 3,856,792 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	2,466,022 - 2,469,141 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	2,631,529 - 2,634,640 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	2,631,529 - 2,634,640 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	2,612,542 - 2,615,653 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	2,512,204 - 2,515,315 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	2,512,247 - 2,514,099 (+)	NCBI
Celera	15	2,119,181 - 2,122,292 (-)	NCBI		Celera
Cytogenetic Map	15	p16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Comtd1	Rat	Genitopatellar Syndrome		ISO	COMTD1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Genitopatellar syndrome	ClinVar	PMID:22077973 more ...

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Comtd1	Rat	(+)-catechin	multiple interactions	ISO	COMTD1 (Homo sapiens)	6480464	[Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of COMTD1 mRNA	CTD	PMID:24763279
Comtd1	Rat	(-)-demecolcine	decreases expression	ISO	COMTD1 (Homo sapiens)	6480464	Demecolcine results in decreased expression of COMTD1 mRNA	CTD	PMID:23649840
Comtd1	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	Comtd1 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of COMTD1 mRNA	CTD	PMID:36331819
Comtd1	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Comtd1 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of COMTD1 mRNA	CTD	PMID:22206623
Comtd1	Rat	2,2',5,5'-tetrachlorobiphenyl	decreases expression	ISO	COMTD1 (Homo sapiens)	6480464	2 more ...	CTD	PMID:36804509
Comtd1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Comtd1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of COMTD1 mRNA	CTD	PMID:21570461
Comtd1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of COMTD1 mRNA	CTD	PMID:33387578
Comtd1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of COMTD1 mRNA	CTD	PMID:34747641
Comtd1	Rat	2,4,6-trinitrotoluene	affects expression	EXP		6480464	Trinitrotoluene affects the expression of COMTD1 mRNA	CTD	PMID:21346803
Comtd1	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of COMTD1 mRNA	CTD	PMID:21346803
Comtd1	Rat	3-chloropropane-1,2-diol	increases expression	EXP		6480464	alpha-Chlorohydrin results in increased expression of COMTD1 protein	CTD	PMID:34915118
Comtd1	Rat	4,4'-sulfonyldiphenol	affects expression	ISO	Comtd1 (Mus musculus)	6480464	bisphenol S affects the expression of COMTD1 mRNA	CTD	PMID:39298647
Comtd1	Rat	4-amino-2,6-dinitrotoluene	affects expression	EXP		6480464	4-amino-2 and 6-dinitrotoluene affects the expression of COMTD1 mRNA	CTD	PMID:21346803
Comtd1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of COMTD1 mRNA	CTD	PMID:30047161
Comtd1	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of COMTD1 mRNA	CTD	PMID:31881176
Comtd1	Rat	acrylamide	decreases expression	ISO	COMTD1 (Homo sapiens)	6480464	Acrylamide results in decreased expression of COMTD1 mRNA	CTD	PMID:32763439
Comtd1	Rat	all-trans-retinoic acid	decreases expression	ISO	COMTD1 (Homo sapiens)	6480464	Tretinoin results in decreased expression of COMTD1 mRNA	CTD	PMID:23724009
Comtd1	Rat	aristolochic acid A	decreases expression	ISO	COMTD1 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of COMTD1 mRNA	CTD	PMID:33212167
Comtd1	Rat	arsane	multiple interactions	ISO	COMTD1 (Homo sapiens)	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of COMTD1 mRNA	CTD	PMID:32525701
Comtd1	Rat	arsenic atom	multiple interactions	ISO	COMTD1 (Homo sapiens)	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of COMTD1 mRNA	CTD	PMID:32525701
Comtd1	Rat	arsenite(3-)	increases expression	ISO	Comtd1 (Mus musculus)	6480464	arsenite results in increased expression of COMTD1 protein	CTD	PMID:37955338
Comtd1	Rat	atrazine	decreases expression	EXP		6480464	Atrazine results in decreased expression of COMTD1 mRNA	CTD	PMID:36841081
Comtd1	Rat	belinostat	increases expression	ISO	COMTD1 (Homo sapiens)	6480464	belinostat results in increased expression of COMTD1 mRNA	CTD	PMID:26272509
Comtd1	Rat	belinostat	multiple interactions	ISO	COMTD1 (Homo sapiens)	6480464	[NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of COMTD1 mRNA	CTD	PMID:27188386
Comtd1	Rat	benzo[a]pyrene	decreases expression	ISO	Comtd1 (Mus musculus)	6480464	Benzo(a)pyrene results in decreased expression of COMTD1 mRNA	CTD	PMID:22228805
Comtd1	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of COMTD1 mRNA	CTD	PMID:25181051
Comtd1	Rat	bisphenol F	decreases expression	ISO	Comtd1 (Mus musculus)	6480464	bisphenol F results in decreased expression of COMTD1 mRNA	CTD	PMID:38685157
Comtd1	Rat	C60 fullerene	decreases expression	EXP		6480464	fullerene C60 results in decreased expression of COMTD1 mRNA	CTD	PMID:19167457
Comtd1	Rat	carbon nanotube	increases expression	ISO	Comtd1 (Mus musculus)	6480464	Nanotubes and Carbon analog results in increased expression of COMTD1 mRNA	CTD	PMID:25554681
Comtd1	Rat	choline	multiple interactions	ISO	Comtd1 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of and results in increased expression of COMTD1 and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of COMTD1 gene	CTD	PMID:20938992
Comtd1	Rat	cisplatin	multiple interactions	ISO	COMTD1 (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in increased expression of COMTD1 mRNA	CTD	PMID:27392435
Comtd1	Rat	clofibrate	decreases expression	ISO	Comtd1 (Mus musculus)	6480464	Clofibrate results in decreased expression of COMTD1 mRNA	CTD	PMID:25270620
Comtd1	Rat	cobalt dichloride	decreases expression	EXP		6480464	cobaltous chloride results in decreased expression of COMTD1 mRNA	CTD	PMID:24386269
Comtd1	Rat	copper(II) sulfate	decreases expression	ISO	COMTD1 (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of COMTD1 mRNA	CTD	PMID:19549813
Comtd1	Rat	crocidolite asbestos	increases expression	ISO	Comtd1 (Mus musculus)	6480464	Asbestos and Crocidolite results in increased expression of COMTD1 mRNA	CTD	PMID:19446018
Comtd1	Rat	cyclosporin A	increases expression	ISO	COMTD1 (Homo sapiens)	6480464	Cyclosporine results in increased expression of COMTD1 mRNA	CTD	PMID:27989131
Comtd1	Rat	DDE	increases expression	ISO	COMTD1 (Homo sapiens)	6480464	Dichlorodiphenyl Dichloroethylene results in increased expression of COMTD1 mRNA	CTD	PMID:38568856
Comtd1	Rat	Dibutyl phosphate	affects expression	ISO	COMTD1 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of COMTD1 mRNA	CTD	PMID:37042841
Comtd1	Rat	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of COMTD1 mRNA	CTD	PMID:21266533
Comtd1	Rat	dicrotophos	decreases expression	ISO	COMTD1 (Homo sapiens)	6480464	dicrotophos results in decreased expression of COMTD1 mRNA	CTD	PMID:28302478
Comtd1	Rat	dorsomorphin	multiple interactions	ISO	COMTD1 (Homo sapiens)	6480464	[NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
Comtd1	Rat	doxorubicin	increases expression	ISO	COMTD1 (Homo sapiens)	6480464	Doxorubicin results in increased expression of COMTD1 mRNA	CTD	PMID:29803840
Comtd1	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of COMTD1 mRNA	CTD	PMID:29391264
Comtd1	Rat	entinostat	multiple interactions	ISO	COMTD1 (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of COMTD1 mRNA	CTD	PMID:27188386
Comtd1	Rat	entinostat	increases expression	ISO	COMTD1 (Homo sapiens)	6480464	entinostat results in increased expression of COMTD1 mRNA	CTD	PMID:26272509 and PMID:27188386
Comtd1	Rat	finasteride	increases expression	EXP		6480464	Finasteride results in increased expression of COMTD1 mRNA	CTD	PMID:24136188
Comtd1	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of COMTD1 mRNA	CTD	PMID:24136188
Comtd1	Rat	folic acid	multiple interactions	ISO	Comtd1 (Mus musculus)	6480464	[1 more ...	CTD	PMID:20938992 and PMID:22206623
Comtd1	Rat	genistein	multiple interactions	ISO	COMTD1 (Homo sapiens)	6480464	ESR2 promotes the reaction [Genistein results in increased expression of COMTD1 protein]	CTD	PMID:20884965
Comtd1	Rat	genistein	increases expression	ISO	COMTD1 (Homo sapiens)	6480464	Genistein results in increased expression of COMTD1 protein	CTD	PMID:20884965
Comtd1	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of COMTD1 mRNA	CTD	PMID:22061828 and PMID:33387578
Comtd1	Rat	L-methionine	multiple interactions	ISO	Comtd1 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of and results in increased expression of COMTD1 and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of COMTD1 gene	CTD	PMID:20938992
Comtd1	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of COMTD1 mRNA	CTD	PMID:30047161
Comtd1	Rat	methylphenidate	decreases expression	ISO	Comtd1 (Mus musculus)	6480464	Methylphenidate results in decreased expression of COMTD1 mRNA	CTD	PMID:22470460
Comtd1	Rat	nefazodone	increases expression	EXP		6480464	nefazodone results in increased expression of COMTD1 mRNA	CTD	PMID:24136188
Comtd1	Rat	nimesulide	increases expression	EXP		6480464	nimesulide results in increased expression of COMTD1 mRNA	CTD	PMID:24136188
Comtd1	Rat	panobinostat	increases expression	ISO	COMTD1 (Homo sapiens)	6480464	panobinostat results in increased expression of COMTD1 mRNA	CTD	PMID:26272509
Comtd1	Rat	panobinostat	multiple interactions	ISO	COMTD1 (Homo sapiens)	6480464	[NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of COMTD1 mRNA	CTD	PMID:27188386
Comtd1	Rat	paracetamol	decreases expression	ISO	COMTD1 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of COMTD1 mRNA	CTD	PMID:22230336
Comtd1	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of COMTD1 mRNA	CTD	PMID:33387578
Comtd1	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Comtd1 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of COMTD1 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of COMTD1 mRNA	CTD	PMID:36331819
Comtd1	Rat	phenylmercury acetate	increases expression	ISO	COMTD1 (Homo sapiens)	6480464	Phenylmercuric Acetate results in increased expression of COMTD1 mRNA	CTD	PMID:26272509
Comtd1	Rat	phenylmercury acetate	multiple interactions	ISO	COMTD1 (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of COMTD1 mRNA	CTD	PMID:27188386
Comtd1	Rat	pirinixic acid	decreases expression	ISO	Comtd1 (Mus musculus)	6480464	pirinixic acid results in decreased expression of COMTD1 mRNA	CTD	PMID:17426115
Comtd1	Rat	pirinixic acid	increases expression	ISO	Comtd1 (Mus musculus)	6480464	pirinixic acid results in increased expression of COMTD1 mRNA	CTD	PMID:18301758 and PMID:23811191
Comtd1	Rat	pirinixic acid	multiple interactions	ISO	COMTD1 (Homo sapiens)	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of COMTD1 mRNA	CTD	PMID:19710929
Comtd1	Rat	resveratrol	increases expression	ISO	Comtd1 (Mus musculus)	6480464	resveratrol results in increased expression of COMTD1 protein	CTD	PMID:25505154
Comtd1	Rat	rotenone	increases expression	EXP		6480464	Rotenone results in increased expression of COMTD1 mRNA	CTD	PMID:28374803
Comtd1	Rat	SB 431542	multiple interactions	ISO	COMTD1 (Homo sapiens)	6480464	[NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
Comtd1	Rat	sodium arsenate	multiple interactions	ISO	COMTD1 (Homo sapiens)	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of COMTD1 mRNA	CTD	PMID:32525701
Comtd1	Rat	sodium arsenite	decreases expression	ISO	COMTD1 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of COMTD1 mRNA	CTD	PMID:38568856
Comtd1	Rat	temozolomide	increases expression	ISO	COMTD1 (Homo sapiens)	6480464	Temozolomide results in increased expression of COMTD1 mRNA	CTD	PMID:31758290
Comtd1	Rat	tetrachloromethane	increases expression	ISO	Comtd1 (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of COMTD1 mRNA	CTD	PMID:27339419 and PMID:31919559
Comtd1	Rat	thiram	decreases expression	ISO	COMTD1 (Homo sapiens)	6480464	Thiram results in decreased expression of COMTD1 mRNA	CTD	PMID:38568856
Comtd1	Rat	titanium dioxide	decreases methylation	ISO	Comtd1 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of COMTD1 gene and titanium dioxide results in decreased methylation of COMTD1 promoter	CTD	PMID:35295148
Comtd1	Rat	tunicamycin	increases expression	ISO	COMTD1 (Homo sapiens)	6480464	Tunicamycin results in increased expression of COMTD1 mRNA	CTD	PMID:29453283
Comtd1	Rat	valproic acid	affects expression	ISO	COMTD1 (Homo sapiens)	6480464	Valproic Acid affects the expression of COMTD1 mRNA	CTD	PMID:25979313
Comtd1	Rat	valproic acid	multiple interactions	ISO	COMTD1 (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of COMTD1 mRNA	CTD	PMID:27188386
Comtd1	Rat	valproic acid	increases expression	ISO	COMTD1 (Homo sapiens)	6480464	Valproic Acid results in increased expression of COMTD1 mRNA	CTD	PMID:23179753 more ...
Comtd1	Rat	valproic acid	increases methylation	ISO	COMTD1 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of COMTD1 gene	CTD	PMID:29154799
Comtd1	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of COMTD1 mRNA	CTD	PMID:22570695
Comtd1	Rat	vincristine	decreases expression	ISO	COMTD1 (Homo sapiens)	6480464	Vincristine results in decreased expression of COMTD1 mRNA	CTD	PMID:23649840

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Comtd1	Rat	methylation	involved_in	IEA	UniProtKB-KW:KW-0489	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Comtd1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Comtd1	Rat	mitochondrion	located_in	ISO	COMTD1 (Homo sapiens)	9068941	PMID:34800366	FlyBase	PMID:34800366

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Comtd1	Rat	methyltransferase activity	enables	IEA	UniProtKB-KW:KW-0489	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Comtd1	Rat	O-methyltransferase activity	enables	IEA	InterPro:IPR002935	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Comtd1	Rat	protein binding	enables	ISO	COMTD1 (Homo sapiens)	1624291	UniProtKB:Q9UMX0-2 and PMID:25416956	RGD	PMID:25416956
Comtd1	Rat	S-adenosylmethionine-dependent methyltransferase activity	enables	IBA	PANTHER:PTN000053484 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Comtd1	Rat	transferase activity	enables	IEA	UniProtKB-KW:KW-0808	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

BioCyc Pathways

guaiacol biosynthesis	L-dopa degradation I (mammalian)	noradrenaline and adrenaline degradation	dopamine degradation

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:18614015	PMID:34800366

Comtd1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	2,509,121 - 2,512,232 (+)	NCBI		GRCr8
mRatBN7.2	15	2,459,783 - 2,462,895 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	2,459,783 - 2,462,895 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	2,467,227 - 2,470,346 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	3,853,673 - 3,856,792 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	2,466,022 - 2,469,141 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	2,631,529 - 2,634,640 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	2,631,529 - 2,634,640 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	2,612,542 - 2,615,653 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	2,512,204 - 2,515,315 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	2,512,247 - 2,514,099 (+)	NCBI
Celera	15	2,119,181 - 2,122,292 (-)	NCBI		Celera
Cytogenetic Map	15	p16	NCBI

COMTD1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	75,233,641 - 75,235,957 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	75,233,641 - 75,236,030 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	76,993,399 - 76,995,715 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	76,663,735 - 76,665,776 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	76,663,735 - 76,665,776	NCBI
Celera	10	70,281,988 - 70,284,029 (-)	NCBI		Celera
Cytogenetic Map	10	q22.2	NCBI
HuRef	10	70,992,121 - 70,994,162 (-)	NCBI		HuRef
CHM1_1	10	77,275,551 - 77,277,592 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	10	76,107,149 - 76,109,465 (-)	NCBI		T2T-CHM13v2.0

Comtd1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	21,895,929 - 21,898,978 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	21,895,923 - 21,899,045 (-)	Ensembl		GRCm39 Ensembl
GRCm38	14	21,845,861 - 21,848,910 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	21,845,855 - 21,848,977 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	22,665,083 - 22,668,132 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	20,634,413 - 20,637,462 (-)	NCBI		MGSCv36	mm8
Celera	14	18,228,558 - 18,231,648 (-)	NCBI		Celera
Cytogenetic Map	14	A3	NCBI
cM Map	14	11.92	NCBI

Comtd1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955437	16,853,518 - 16,854,867 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955437	16,853,516 - 16,854,867 (+)	NCBI	ChiLan1.0	ChiLan1.0

COMTD1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	87,394,214 - 87,396,365 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	87,399,539 - 87,401,670 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	71,766,326 - 71,768,451 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	74,429,376 - 74,431,497 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	74,429,376 - 74,431,497 (-)	Ensembl	panpan1.1		panPan2

COMTD1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	25,464,448 - 25,466,218 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	25,464,454 - 25,466,323 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	25,597,675 - 25,601,325 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	25,745,174 - 25,748,819 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	25,747,121 - 25,748,809 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	25,640,221 - 25,643,858 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	25,840,812 - 25,844,442 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	26,199,026 - 26,200,730 (-)	NCBI		UU_Cfam_GSD_1.0

Comtd1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	55,624,859 - 55,629,829 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936521	4,116,995 - 4,120,184 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936521	4,116,893 - 4,121,782 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

COMTD1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	77,782,672 - 77,786,837 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	77,783,064 - 77,786,871 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

COMTD1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	56,135,882 - 56,142,754 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	56,136,659 - 56,138,553 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	16,623,941 - 16,628,822 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Comtd1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624754	8,603,257 - 8,610,243 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624754	8,604,935 - 8,606,633 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Comtd1
12 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	306
Count of miRNA genes:	191
Interacting mature miRNAs:	227
Transcripts:	ENSRNOT00000018897
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1641913	Colcr2	Colorectal carcinoma resistance QTL 2	6.57	0.0197	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	15	2266368	22711984	Rat
10401805	Kidm51	Kidney mass QTL 51			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	15	306329	45306329	Rat
5684946	Bss98	Bone structure and strength QTL 98	3.9	0.0026	tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	15	1058250	14481294	Rat
1354657	Despr13	Despair related QTL 13		0.0022	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	15	1	29912054	Rat
1641887	Alcrsp14	Alcohol response QTL 14			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	15	1	42356671	Rat
2298549	Neuinf12	Neuroinflammation QTL 12	3.5		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	15	1	55302115	Rat
731170	Pur3	Proteinuria QTL 3	2.3	0.0005	urine protein amount (VT:0005160)	urine protein excretion rate (CMO:0000759)	15	1	41686771	Rat
8552920	Pigfal8	Plasma insulin-like growth factor 1 level QTL 8	3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	15	1	34723002	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2266368	46921453	Rat
8694361	Abfw6	Abdominal fat weight QTL 6	10.2	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	15	1	34723002	Rat
9589149	Insul29	Insulin level QTL 29	9.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	15	1	34723002	Rat

RH142258

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	2,461,323 - 2,461,493 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	2,633,070 - 2,633,239	NCBI	Rnor6.0
Rnor_5.0	15	2,614,083 - 2,614,252	UniSTS	Rnor5.0
RGSC_v3.4	15	2,513,745 - 2,513,914	UniSTS	RGSC3.4
Celera	15	2,120,582 - 2,120,751	UniSTS
RH 3.4 Map	15	45.3	UniSTS
Cytogenetic Map	15	p16	UniSTS

RH135028

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	2,462,675 - 2,462,856 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	2,634,421 - 2,634,601	NCBI	Rnor6.0
Rnor_5.0	15	2,615,434 - 2,615,614	UniSTS	Rnor5.0
RGSC_v3.4	15	2,515,096 - 2,515,276	UniSTS	RGSC3.4
Celera	15	2,119,220 - 2,119,400	UniSTS
RH 3.4 Map	15	44.6	UniSTS
Cytogenetic Map	15	p16	UniSTS

RH141113

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	2,461,338 - 2,461,538 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	2,633,085 - 2,633,284	NCBI	Rnor6.0
Rnor_5.0	15	2,614,098 - 2,614,297	UniSTS	Rnor5.0
RGSC_v3.4	15	2,513,760 - 2,513,959	UniSTS	RGSC3.4
Celera	15	2,120,537 - 2,120,736	UniSTS
RH 3.4 Map	4	632.72	UniSTS
Cytogenetic Map	15	p16	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001107249	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474061	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018897 ⟹ ENSRNOP00000018897

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	2,459,783 - 2,462,895 (+)	Ensembl
Rnor_6.0 Ensembl	15	2,631,529 - 2,634,640 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098144 ⟹ ENSRNOP00000079281

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	2,459,805 - 2,462,895 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111951 ⟹ ENSRNOP00000090138

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	2,459,783 - 2,462,895 (+)	Ensembl

RefSeq Acc Id:

NM_001107249 ⟹ NP_001100719

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	2,509,121 - 2,512,232 (+)	NCBI
mRatBN7.2	15	2,459,783 - 2,462,895 (+)	NCBI
Rnor_6.0	15	2,631,529 - 2,634,640 (+)	NCBI
Rnor_5.0	15	2,612,542 - 2,615,653 (+)	NCBI
RGSC_v3.4	15	2,512,204 - 2,515,315 (+)	RGD
Celera	15	2,119,181 - 2,122,292 (-)	RGD

Sequence:

show sequence

TTACTGGTCCCAGTCCGGTCCCCTCTACTCCAGCACACGTGATCTCCGCCGCCGCTAACCCACACCATGGCCCTGCCCGTGCCTCGGCTATCTATCCCTGCCGCGCTGGCCTTGGGCTCCGCCGCGCT
GGGCGCCGCCTTCGCTACTGGTCTCTTTCTGGGGAAACGGTGGCCTCCGTGGGGGTACAGGCGGCATCAGCGCCTGCTGCCCCCTCAGGACAATCCCCTGTGGCAGTATCTGCTGAGCCGCTCCATGA
GGGAACACCCAGCGCTGCGGAGCCTGCGACTGCTGACCCTGGAGCAGCCGCAGGGGGATTCCATGATGACCTGTGAACAGGCCCAGCTTCTGGCCAACCTGGCGCGGCTCATCAAAGCCAAGAAAGCT
CTGGATCTGGGTACTTTCACGGGCTACTCGGCCCTGGCCCTAGCCTTGGCGCTTCCCGAGGCTGGCCGCGTAGTGACCTGCGAGGTGGACGCAGAGCCCCCGAAGCTGGGACGGCCCCTGTGGAAGCA
GGCAGAAGTGGAGCAGAAGATCGACCTTCGGCTGCAGCCCGCCCTGCAGACTTTGGATGAGCTCCTGGCGGCGGGCGAGGCCGGAACCTTCGACATAGCGGTGGTGGACGCAGACAAGGAGAACTGTA
CCGCCTACTACGAGCGCTGTCTGCAGCTCCTACGCCCGGGAGGCGTGCTCGCCGTGCTCAGAGTCCTGTGGCGCGGAGAGGTGCTCCAGCCTCAGCCCAAGAACAAGGCTGTTGAATGTGTGCGGAAC
CTAAACGAGCGCATCCTGCGGGACGCCAGGGTCTACATTAGCCTCCTGCCCCTGGATGACGGGCTCTCCTTGGCCTTTAAGATCTAGGGTAACATCATGCTTAGGGCTTGGGTGTGAGAAGCTAAGAA
ACCCAGCCAGTGACCCGACGTTTAAACCTGAAAGTAAAGGTACTGGAACACGCGACCTTCTGAGCATCCATTTCCGACGTTCATTTAGGCAGTTTTTCCAGTAAAGTGGTCTCCCTGGCACCAAGGCT
CGTGGCCCTATCTGACCGGATAGTTTAATAAATTTCCCCTGCTGTACGCATTGAGTACAGTTCCAACAGGCTCCGAGGACTTTGATAAAGGGAGGACCCTGTCTCTTGTGTCCTAGCCACATGCCACA
CCTTGTCGACACCACCTAGTTATGGGTACTTTATAGTTAGGTCAGGTCTGCTGGCAGTCTACCCACGTTTTCACAGGGCTGTTGCCTCCCCAGTGTGCAGTGGAAACCCTAACAGTGGCTATTACTTG
AGAAGCAACCCTCTTGACCCAAACCAGAGGACCTAAGGTTGGCTGGTATTTCTATCTGCTGCCTCACCGGCTTGAGTCCTAAGGGAAGAAACTGATGTCCAAGGGTTAATTAAAGCAGACAGGAGGGT
GGGTAGCCAACCTCATTCAAGGAACCTCAAGAACTTAAAAACTTTTCCAGCACAGTCCCTTGTGGGGGACACTATAAGGAGCCAACCTTTATTGACCTGGGGCCTGGTGCTTTGCTGCTCTGGAAGAA
GGGTGACATTCTTTATACTGAGGCACAAAGGACAGTTTCTGGGACCACAGGTTTGCCACCTATGGTTAAGGCCCAAGTGAAACACACCCAGCAGCGGCTCCAAGTACAGCTGCATGAGCCCACAACTG
AGTCTGTCCAAGCCCCACGTCCCTGCCACACACCAACCCACTGGGAACTATTCCTTCACAAGTACATACCGAGGTGCACACAGGGGACCTGGCCACTCCATTTTGAGAAGTACCTTTGACATACTGGT
AACCCACATGTGTACTCTAGCCAGAGCAGAGCCAGCGTGAAGTGCACTTGTTAGCTGAGGAAGGAGCACTAGGCCACGGGACAGTGGGCACGCACCATTTCTACTGGGGAAGCCCCAAAGTACTCCAA
CAAGTTCACAACTAGACCTCAGGAGTGACGCTCACCTCTCATCTTTGATTACCCCTCACCTGTGACCTACCTCCTCCCCCGGGCAGTACTACTTTTCCAACTAGAGTCACTAGGTAATGCAAATCACC
CAGGTGATGGCTACAGGGGGGGGGGGGGGCTGCCAGGGCCCAAACCTCTCAGCTCAGCTTCCCAATACCTGTCTATGGGAGAGTCCGTCCACTTCCGCCTTCCTGCCTTGCTTCGAGGCTCAGAAGAA
AGGGCTCCCATGCCTATTTAACCCTTCAGCACCACTGCTGCTTTTCCTTCCCTCATCGTCCATGGATTAAGTCATTCACTGGAACTTTGCACAAACTTAGAAACTGCAGAGTATTAAAGCATGTATCC
TTGT

hide sequence


Protein RefSeqs	NP_001100719	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL86279	(Get FASTA)	NCBI Sequence Viewer
	EDL86280	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018897
	ENSRNOP00000018897.4
	ENSRNOP00000079281.1
	ENSRNOP00000090138.1

RefSeq Acc Id:

NP_001100719 ⟸ NM_001107249

- UniProtKB:

D3ZM21 (UniProtKB/TrEMBL), A6KKT5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MALPVPRLSIPAALALGSAALGAAFATGLFLGKRWPPWGYRRHQRLLPPQDNPLWQYLLSRSMREHPALRSLRLLTLEQPQGDSMMTCEQAQLLANLARLIKAKKALDLGTFTGYSALALALALPEAG
RVVTCEVDAEPPKLGRPLWKQAEVEQKIDLRLQPALQTLDELLAAGEAGTFDIAVVDADKENCTAYYERCLQLLRPGGVLAVLRVLWRGEVLQPQPKNKAVECVRNLNERILRDARVYISLLPLDDGL
SLAFKI

hide sequence

Ensembl Acc Id:

ENSRNOP00000018897 ⟸ ENSRNOT00000018897

Ensembl Acc Id:

ENSRNOP00000079281 ⟸ ENSRNOT00000098144

Ensembl Acc Id:

ENSRNOP00000090138 ⟸ ENSRNOT00000111951

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZM21-F1-model_v2	AlphaFold	D3ZM21	1-262	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13699545

Promoter ID:

EPDNEW_R10069

Type:

initiation region

Name:

Comtd1_1

Description:

catechol-O-methyltransferase domain containing 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	15	2,631,560 - 2,631,620	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-14602	BioCyc
BioCyc Pathway	PWY-6334 [L-dopa degradation I (mammalian)]	BioCyc
	PWY-6342 [noradrenaline and adrenaline degradation]	BioCyc
	PWY18C3-23 [guaiacol biosynthesis]	BioCyc
	PWY6666-2 [dopamine degradation]	BioCyc
BioCyc Pathway Image	PWY-6334	BioCyc
	PWY-6342	BioCyc
	PWY18C3-23	BioCyc
	PWY6666-2	BioCyc
Ensembl Genes	ENSRNOG00000013968	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000018897	ENTREZGENE
	ENSRNOT00000018897.6	UniProtKB/TrEMBL
	ENSRNOT00000098144.1	UniProtKB/TrEMBL
	ENSRNOT00000111951.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.150	UniProtKB/TrEMBL
InterPro	Cation-dep_OMT	UniProtKB/TrEMBL
	O-MeTrfase_3	UniProtKB/TrEMBL
	SAM-dependent_MTases-like	UniProtKB/TrEMBL
KEGG Report	rno:305685	UniProtKB/TrEMBL
NCBI Gene	305685	ENTREZGENE
PANTHER	CATECHOL O-METHYLTRANSFERASE DOMAIN-CONTAINING PROTEIN 1	UniProtKB/TrEMBL
	O-METHYLTRANSFERASE-RELATED	UniProtKB/TrEMBL
Pfam	Methyltransf_3	UniProtKB/TrEMBL
PhenoGen	Comtd1	PhenoGen
PROSITE	SAM_OMT_I	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000013968	RatGTEx
Superfamily-SCOP	SSF53335	UniProtKB/TrEMBL
UniProt	A0A8I5ZME1_RAT	UniProtKB/TrEMBL
	A0A8I6A9G9_RAT	UniProtKB/TrEMBL
	A6KKT5	ENTREZGENE, UniProtKB/TrEMBL
	D3ZM21	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Comtd1	catechol-O-methyltransferase domain containing 1	Comtd1_predicted	catechol-O-methyltransferase domain containing 1 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Comtd1_predicted	catechol-O-methyltransferase domain containing 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar

BioCyc Pathways