Klhdc2 (kelch domain containing 2)

Gene: Klhdc2 (kelch domain containing 2) Rattus norvegicus

Analyze

Symbol:

Klhdc2

Name:

kelch domain containing 2

RGD ID:

1306504

Description:

Predicted to enable ubiquitin-like ligase-substrate adaptor activity. Predicted to be involved in ubiquitin-dependent protein catabolic process via the C-end degron rule pathway. Predicted to be located in nuclear body and nuclear membrane. Predicted to be part of Cul2-RING ubiquitin ligase complex. Predicted to be active in nucleus. Orthologous to human KLHDC2 (kelch domain containing 2); INTERACTS WITH 2,4-dinitrotoluene; 2,6-dinitrotoluene; 3,3',5,5'-tetrabromobisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

kelch domain-containing protein 2; LOC299113; MGC124658

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	KLHDC2 (kelch domain containing 2)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Klhdc2 (kelch domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Klhdc2 (kelch domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	KLHDC2 (kelch domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	KLHDC2 (kelch domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Klhdc2 (kelch domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	KLHDC2 (kelch domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	KLHDC2 (kelch domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Klhdc2 (kelch domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ZNF574 (zinc finger protein 574)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	KLHDC2 (kelch domain containing 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Klhdc2 (kelch domain containing 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	klhdc2 (kelch domain containing 2)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	KEL1	Alliance	DIOPT (Ensembl Compara\|OrthoInspector)
Saccharomyces cerevisiae (baker's yeast):	KEL2	Alliance	DIOPT (Ensembl Compara\|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):	klhdc2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	93,512,981 - 93,552,809 (+)	NCBI		GRCr8
mRatBN7.2	6	87,777,183 - 87,791,609 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	87,777,183 - 87,804,187 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	88,176,594 - 88,190,674 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	88,476,025 - 88,490,107 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	87,915,780 - 87,929,864 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	91,595,443 - 91,630,479 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	91,595,823 - 91,610,799 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	101,054,444 - 101,068,619 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	91,259,826 - 91,274,820 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	X	90,697,348 - 90,699,040 (+)	NCBI
Celera	6	86,274,599 - 86,288,960 (+)	NCBI		Celera
Cytogenetic Map	6	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Brain-Lung-Thyroid Syndrome (ISO)

genetic disease (ISO)

Intellectual Developmental Disorder with Speech Delay and Axonal Peripheral Neuropathy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3,3',5,5'-tetrabromobisphenol A (EXP)

4,4'-sulfonyldiphenol (EXP,ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

benzatropine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP)

bisphenol F (EXP)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

clozapine (ISO)

copper(II) sulfate (ISO)

Cuprizon (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

ethanol (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

haloperidol (ISO)

lead diacetate (ISO)

methyl methanesulfonate (ISO)

nefazodone (EXP)

ochratoxin A (ISO)

oxaliplatin (EXP)

paracetamol (EXP,ISO)

potassium chromate (ISO)

propiconazole (ISO)

quercetin (ISO)

resveratrol (ISO)

rotenone (ISO)

silicon dioxide (ISO)

tamoxifen (ISO)

tetrachloromethane (ISO)

topotecan (EXP)

triphenyl phosphate (ISO)

tunicamycin (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

proteasome-mediated ubiquitin-dependent protein catabolic process (ISO,ISS)

protein ubiquitination (IEA)

ubiquitin-dependent protein catabolic process via the C-end degron rule pathway (ISO,ISS)

Cellular Component

Cul2-RING ubiquitin ligase complex (ISO,ISS)

nuclear body (ISO)

nuclear membrane (ISO)

nucleoplasm (ISO)

nucleus (ISO,ISS)

Molecular Function

protein binding (ISO)

ubiquitin-like ligase-substrate adaptor activity (ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15489334

Genomics

Comparative Map Data

Klhdc2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	93,512,981 - 93,552,809 (+)	NCBI		GRCr8
mRatBN7.2	6	87,777,183 - 87,791,609 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	87,777,183 - 87,804,187 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	88,176,594 - 88,190,674 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	88,476,025 - 88,490,107 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	87,915,780 - 87,929,864 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	91,595,443 - 91,630,479 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	91,595,823 - 91,610,799 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	101,054,444 - 101,068,619 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	91,259,826 - 91,274,820 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	X	90,697,348 - 90,699,040 (+)	NCBI
Celera	6	86,274,599 - 86,288,960 (+)	NCBI		Celera
Cytogenetic Map	6	q24	NCBI

KLHDC2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	49,768,153 - 49,786,385 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	49,768,130 - 49,786,385 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	50,234,871 - 50,253,103 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	49,304,537 - 49,319,606 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	49,304,536 - 49,319,606	NCBI
Celera	14	30,102,486 - 30,117,555 (+)	NCBI		Celera
Cytogenetic Map	14	q21.3	NCBI
HuRef	14	30,360,014 - 30,375,085 (+)	NCBI		HuRef
CHM1_1	14	50,173,366 - 50,188,436 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	43,973,946 - 43,992,177 (+)	NCBI		T2T-CHM13v2.0

Klhdc2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	69,343,455 - 69,357,461 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	69,343,455 - 69,357,461 (+)	Ensembl		GRCm39 Ensembl
GRCm38	12	69,296,681 - 69,310,687 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	69,296,681 - 69,310,687 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	70,397,668 - 70,411,674 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	63,921,099 - 63,934,795 (+)	NCBI		MGSCv36	mm8
MGSCv36	12	70,215,373 - 70,229,069 (+)	NCBI		MGSCv36	mm8
Celera	12	70,390,958 - 70,408,906 (+)	NCBI		Celera
Cytogenetic Map	12	C2	NCBI
cM Map	12	28.77	NCBI

Klhdc2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955409	12,901,892 - 12,910,562 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955409	12,901,892 - 12,910,562 (-)	NCBI	ChiLan1.0	ChiLan1.0

KLHDC2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	50,902,867 - 50,921,712 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	50,119,664 - 50,134,946 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	30,356,506 - 30,372,018 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	48,666,598 - 48,679,105 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	48,668,025 - 48,679,105 (+)	Ensembl	panpan1.1		panPan2

KLHDC2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	26,353,986 - 26,365,077 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	26,353,871 - 26,364,914 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	26,107,672 - 26,118,743 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	26,531,250 - 26,542,321 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	26,531,095 - 26,544,011 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	26,186,874 - 26,197,945 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	26,260,034 - 26,271,079 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	26,577,781 - 26,588,838 (+)	NCBI		UU_Cfam_GSD_1.0

Klhdc2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	58,419,844 - 58,432,518 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936583	256,394 - 268,998 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936583	256,360 - 269,131 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

KLHDC2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	179,604,921 - 179,633,156 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	179,609,026 - 179,623,168 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	199,945,812 - 199,957,892 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

KLHDC2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	26,816,634 - 26,834,057 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	26,816,842 - 26,833,870 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666053	15,143,096 - 15,159,452 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Klhdc2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624731	18,962,888 - 18,974,096 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624731	18,935,841 - 18,973,879 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Klhdc2
101 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	436
Count of miRNA genes:	195
Interacting mature miRNAs:	222
Transcripts:	ENSRNOT00000004086, ENSRNOT00000006223
Prediction methods:	Microtar, Miranda, Pita, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	72202632	130919985	Rat
634330	Pia16	Pristane induced arthritis QTL 16	3.9		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	6	45790088	104200226	Rat
1331789	Rf37	Renal function QTL 37	3.224		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	72202632	115200186	Rat
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	10894415	110548006	Rat
70176	Mcsm1	Mammary carcinoma susceptibility modifier QTL 1			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	58632962	103632962	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	72227641	130729205	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	85140138	130140138	Rat
1558641	Cm47	Cardiac mass QTL 47	2.9	0.001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	6	57730540	104085867	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	73463459	109394713	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	82523650	110548006	Rat
1641904	Alcrsp4	Alcohol response QTL 4			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	6	67262953	112262953	Rat
724513	Uae14	Urinary albumin excretion QTL 14	6.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	85311061	133478515	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	15107216	107351382	Rat
731173	Uae22	Urinary albumin excretion QTL 22	10.1		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
2293837	Kiddil1	Kidney dilation QTL 1	3.7		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	81132889	104393926	Rat
2293842	Kiddil3	Kidney dilation QTL 3	4.3		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	81132889	104393926	Rat
4889848	Pur25	Proteinuria QTL 25	14	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	56728562	90198260	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	85140138	130140138	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	72202632	130729475	Rat
70196	BpQTLcluster7	Blood pressure QTL cluster 7	6.82		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	72202632	117202632	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	72227641	130729205	Rat
1576302	Schws4	Schwannoma susceptibility QTL 4		0.0078	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	83190345	106747639	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	71201409	116201409	Rat
738034	Anxrr5	Anxiety related response QTL 5	5.9		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	6	84130881	129130881	Rat
2290393	Uae37	Urinary albumin excretion QTL 37		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
12801471	Schws9	Schwannoma susceptibility QTL 9			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	61747639	106747639	Rat
6893332	Cm74	Cardiac mass QTL 74	0.4	0.64	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	57730540	104085867	Rat
1300076	Glom8	Glomerulus QTL 8	7	9e-09	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	6	86894788	131894788	Rat

Markers in Region

AU022198

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	87,791,311 - 87,791,510 (+)	MAPPER	mRatBN7.2
mRatBN7.2	X	67,673,699 - 67,673,898 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	72,449,832 - 72,450,030	NCBI	Rnor6.0
Rnor_6.0	6	91,610,683 - 91,610,881	NCBI	Rnor6.0
Rnor_5.0	6	101,068,322 - 101,068,520	UniSTS	Rnor5.0
Rnor_5.0	X	73,291,717 - 73,291,915	UniSTS	Rnor5.0
RGSC_v3.4	X	90,625,288 - 90,625,486	UniSTS	RGSC3.4
RGSC_v3.4	6	91,274,523 - 91,274,721	UniSTS	RGSC3.4
Celera	6	86,288,663 - 86,288,861	UniSTS
Celera	X	68,027,084 - 68,027,282	UniSTS
Cytogenetic Map	X	q31	UniSTS
Cytogenetic Map	6	q24	UniSTS

UniSTS:236937

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	67,672,892 - 67,673,043 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	72,449,025 - 72,449,175	NCBI	Rnor6.0
Rnor_5.0	X	73,290,910 - 73,291,060	UniSTS	Rnor5.0
RGSC_v3.4	X	90,624,481 - 90,624,631	UniSTS	RGSC3.4
Celera	X	68,026,277 - 68,026,427	UniSTS
Cytogenetic Map	X	q31	UniSTS
Cytogenetic Map	6	q24	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001034133	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017594088	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261703	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC105756	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006223 ⟹ ENSRNOP00000006223

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	87,777,183 - 87,791,608 (+)	Ensembl
Rnor_6.0 Ensembl	6	91,595,823 - 91,610,799 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104323 ⟹ ENSRNOP00000085086

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	87,777,183 - 87,791,625 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113703 ⟹ ENSRNOP00000083418

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	87,777,183 - 87,804,187 (+)	Ensembl

RefSeq Acc Id:

NM_001034133 ⟹ NP_001029305

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	93,513,225 - 93,527,649 (+)	NCBI
mRatBN7.2	6	87,777,183 - 87,791,609 (+)	NCBI
Rnor_6.0	6	91,595,647 - 91,610,980 (+)	NCBI
Rnor_5.0	6	101,054,444 - 101,068,619 (+)	NCBI
RGSC_v3.4	6	91,259,826 - 91,274,820 (+)	RGD
Celera	6	86,274,599 - 86,288,960 (+)	RGD

Sequence:

show sequence

CGAGACCCTCAGCCGCTGTCGGCGCGCGCCCCAGCGCTCGGCCCGGAGGCGGGGGCGCAGCACA
GTAGAGGCGGGTCGTCAGCGCTGGCTGCGCGCCGCGGTCCACCGCTCCGCTTTCCTTTGTCTCC
CGCCTGCGGGGCCGGAGCGGTCTCGGTGCCCAGCGGTGCAGCCTCAAGATGGCTGATGGCAACG
AGGATGCTCGAGCGGAGGACATGCCAGGCCCGGCCTTCGAAGGCTACGAGGCCATGGAGCTGGC
CTGCCCGGCCGAGCGCAGCGGCCACGTCGCCGTCAGCGATGGGCGCCACATGTTCGTCTGGGGC
GGCTACAAGAGTAATCAAGTGAGAGGACTCTATGACTTCTATCTGCCCAGAGAAGAACTGTGGA
TCTACAATATGGAGACTGGAAGATGGAAGAAGATCAACACTGAAGGTGATGTGCCCCCGTCCAT
GTCTGGGAGCTGTGCTGTGTGCGTAGACAGGGTGCTGTACTTGTTTGGAGGCCACCATTCCAGA
GGCAACACAAACAAGTTCTACATGCTGGATTCAAGGTCTGCAGACAGAGTGTTACAGTGGGAAA
GGATTGATTGCCAAGGAATTCCTCCATCATCAAAGGACAAACTTGGTGTCTGGGTATATAAAAA
CAAGTTAATATTTTTTGGAGGCTATGGATATTTACCTGAAGATAAAGTATTGGGAACATTTGAA
TTTGATGAAACATCTTTTTGGAATTCAAGTCATCCAAGAGGATGGAATGATCATGTCCATATTT
TAGACACTGAAACATTTGCCTGGAGCCAGCCCATCACCACTGGCAAGGCACCTTCACCTCGTGC
TGCCCATGCCTGTGCAACTGTTGGAAACAAGGGTTTTGTATTTGGTGGCAGATACCGAGATGCT
AGAATGAATGATCTGCACTATCTTAATCTGGACACATGGGAGTGGAATGAACTAATTCCACAAG
GTATATGCCCTGTTGGCCGCTCCTGGCACTCACTGACACCAGTTTCTTCAGACCATCTTTTTCT
CTTCGGAGGATTTACCACTGAAAAGCAGCCACTAAGTGATGCCTGGACTTACTGCATCAGTAAA
AATGAATGGATTCAGTTTAATCATCCTTATGTTGAAAAACCAAGATTGTGGCATACAGCTTGTG
CGAGCGATGAGGGAGAAGTAATTGTTTTTGGTGGTTGTGCCAACAATCTGCTGGTCCATCATAG
AGCTGCACACAGTAACGAAGTACTTATATTTTCAGTCCAACCAAAATCTCTTGTACGGCTAAGC
TTAGAAGCAGTCATTTGCTTTAAAGAAATGCTAGCCAACTCGTGGAGCTGCCTTCCAAAACACT
TACTTCACAGTGTTAATCAGAGGTTTGGTAGTAACAACACTTCTGGATCATAAGGCTTTGTAGA
TACTACTTCTGGTCTACTTGCATGGAAAACAGCCCTGTATTTGTCAGTGTCATCCTTTGTATAA
TTATATCATTGTTGTAGTTTGCAGCTTTCTGGGTTTTATGTGCATGTGAATGGCCTAGAGAACC
TATTTTTGTGTCTAAAGTTTACAATAAATGTATTTAACACCAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA

hide sequence

RefSeq Acc Id:

XM_063261703 ⟹ XP_063117773

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	93,512,981 - 93,552,809 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001029305	(Get FASTA)	NCBI Sequence Viewer
	XP_063117773	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI05757	(Get FASTA)	NCBI Sequence Viewer
	EDM03510	(Get FASTA)	NCBI Sequence Viewer
	EDM03511	(Get FASTA)	NCBI Sequence Viewer
	EDM03512	(Get FASTA)	NCBI Sequence Viewer
	EDM03513	(Get FASTA)	NCBI Sequence Viewer
	EDM03514	(Get FASTA)	NCBI Sequence Viewer
	EDM03515	(Get FASTA)	NCBI Sequence Viewer
	EDM03516	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006223.3
	ENSRNOP00000083418.1
	ENSRNOP00000085086.1
	ENSRNOP00055012396
	ENSRNOP00060007346
	ENSRNOP00065007462
GenBank Protein	Q3KRE6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001029305 ⟸ NM_001034133

- UniProtKB:

Q3KRE6 (UniProtKB/Swiss-Prot), A0A8I6A1H2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MADGNEDARAEDMPGPAFEGYEAMELACPAERSGHVAVSDGRHMFVWGGYKSNQVRGLYDFYLP
REELWIYNMETGRWKKINTEGDVPPSMSGSCAVCVDRVLYLFGGHHSRGNTNKFYMLDSRSADR
VLQWERIDCQGIPPSSKDKLGVWVYKNKLIFFGGYGYLPEDKVLGTFEFDETSFWNSSHPRGWN
DHVHILDTETFAWSQPITTGKAPSPRAAHACATVGNKGFVFGGRYRDARMNDLHYLNLDTWEWN
ELIPQGICPVGRSWHSLTPVSSDHLFLFGGFTTEKQPLSDAWTYCISKNEWIQFNHPYVEKPRL
WHTACASDEGEVIVFGGCANNLLVHHRAAHSNEVLIFSVQPKSLVRLSLEAVICFKEMLANSWS
CLPKHLLHSVNQRFGSNNTSGS

hide sequence

Ensembl Acc Id:

ENSRNOP00000006223 ⟸ ENSRNOT00000006223

Ensembl Acc Id:

ENSRNOP00000085086 ⟸ ENSRNOT00000104323

Ensembl Acc Id:

ENSRNOP00000083418 ⟸ ENSRNOT00000113703

RefSeq Acc Id:	XP_063117773 ⟸ XM_063261703
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A1H2 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q3KRE6-F1-model_v2	AlphaFold	Q3KRE6	1-406	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306504	AgrOrtholog
BioCyc Gene	G2FUF-37253	BioCyc
Ensembl Genes	ENSRNOG00000004474	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055009150	UniProtKB/Swiss-Prot
	ENSRNOG00060005929	UniProtKB/Swiss-Prot
	ENSRNOG00065006617	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000006223.6	UniProtKB/Swiss-Prot
	ENSRNOT00000104323.1	UniProtKB/TrEMBL
	ENSRNOT00000113703.1	UniProtKB/TrEMBL
	ENSRNOT00055015480	UniProtKB/Swiss-Prot
	ENSRNOT00060009805	UniProtKB/Swiss-Prot
	ENSRNOT00065010226	UniProtKB/Swiss-Prot
Gene3D-CATH	2.120.10.80	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5623547	IMAGE-MGC_LOAD
InterPro	Gal_Oxase/kelch_b-propeller	UniProtKB/TrEMBL
	Kelch-typ_b-propeller	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:299113	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:124658	IMAGE-MGC_LOAD
NCBI Gene	299113	ENTREZGENE
PANTHER	KELCH DOMAIN-CONTAINING PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	KELCH DOMAIN-CONTAINING PROTEIN 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Kelch_3	UniProtKB/TrEMBL
	Kelch_4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Kelch_5	UniProtKB/TrEMBL
PhenoGen	Klhdc2	PhenoGen
RatGTEx	ENSRNOG00000004474	RatGTEx
	ENSRNOG00055009150	RatGTEx
	ENSRNOG00060005929	RatGTEx
	ENSRNOG00065006617	RatGTEx
Superfamily-SCOP	SSF117281	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF50965	UniProtKB/TrEMBL
UniProt	A0A8I6A1H2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6G908_RAT	UniProtKB/TrEMBL
	A6HBV5_RAT	UniProtKB/TrEMBL
	A6HBV6_RAT	UniProtKB/TrEMBL
	A6HBV7_RAT	UniProtKB/TrEMBL
	A6HBV8_RAT	UniProtKB/TrEMBL
	A6HBV9_RAT	UniProtKB/TrEMBL
	A6HBW0_RAT	UniProtKB/TrEMBL
	A6HBW1_RAT	UniProtKB/TrEMBL
	KLDC2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Klhdc2	kelch domain containing 2	Klhdc2_predicted	kelch domain containing 2 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Klhdc2_predicted	kelch domain containing 2 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar