Plpp7 (phospholipid phosphatase 7 (inactive))

Advanced Search (OLGA)

Gene: Plpp7 (phospholipid phosphatase 7 (inactive)) Rattus norvegicus

Analyze

Symbol:

Plpp7

Name:

phospholipid phosphatase 7 (inactive)

RGD ID:

1305821

Description:

Predicted to enable sphingosine-1-phosphate phosphatase activity. Predicted to act upstream of or within negative regulation of myotube differentiation. Predicted to be located in endoplasmic reticulum membrane. Predicted to be active in membrane and nuclear envelope. Orthologous to human PLPP7 (phospholipid phosphatase 7 (inactive)); INTERACTS WITH acetamide; alpha-Zearalanol; atrazine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

inactive phospholipid phosphatase 7; LOC296635; MGC109271; phosphatidic acid phosphatase type 2 domain containing 3; phosphatidic acid phosphatase type 2 domain-containing protein 3; phospholipid phosphatase 7; Ppapdc3; probable lipid phosphate phosphatase PPAPDC3; RGD1305821; similar to RIKEN cDNA D830019K17

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PLPP7 (phospholipid phosphatase 7 (inactive))	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Plpp7 (phospholipid phosphatase 7 (inactive))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Plpp7 (phospholipid phosphatase 7 (inactive))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PLPP7 (phospholipid phosphatase 7 (inactive))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PLPP7 (phospholipid phosphatase 7 (inactive))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Plpp7 (phospholipid phosphatase 7 (inactive))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PLPP7 (phospholipid phosphatase 7 (inactive))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103239735 (inactive phospholipid phosphatase 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Plpp7 (phospholipid phosphatase 7 (inactive))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PLPP7 (phospholipid phosphatase 7 (inactive))	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Plpp7 (phospholipid phosphatase 7 (inactive))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	plpp7a (phospholipid phosphatase 7a (inactive))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG31717	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	T13C5.6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	plpp7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	35,782,215 - 35,796,577 (+)	NCBI		GRCr8
mRatBN7.2	3	15,384,461 - 15,398,820 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	15,384,492 - 15,398,883 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	18,453,991 - 18,468,246 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	27,038,981 - 27,053,233 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	25,289,724 - 25,304,159 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	11,114,551 - 11,130,427 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	11,114,551 - 11,130,425 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	16,467,145 - 16,481,235 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	11,209,598 - 11,223,892 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	11,105,969 - 11,120,261 (+)	NCBI
Celera	3	10,131,465 - 10,145,728 (+)	NCBI		Celera
Cytogenetic Map	3	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal recessive limb-girdle muscular dystrophy type 2K (ISO)

developmental and epileptic encephalopathy (ISO)

early infantile epileptic encephalopathy (ISO)

primary coenzyme Q10 deficiency 7 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-bromohexadecanoic acid (ISO)

2-methylcholine (ISO)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

Aflatoxin B2 alpha (ISO)

alpha-Zearalanol (EXP)

aristolochic acid A (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

cantharidin (ISO)

chlordecone (ISO)

chlorpyrifos (ISO)

dibutyl phthalate (EXP)

dorsomorphin (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

FR900359 (ISO)

gentamycin (EXP)

N-methyl-4-phenylpyridinium (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

propanal (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

Soman (EXP)

sunitinib (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triclosan (ISO)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of myotube differentiation (ISO)

Cellular Component

endoplasmic reticulum membrane (IEA)

membrane (IBA)

nuclear envelope (IBA,ISO)

Molecular Function

lipid phosphatase activity (ISO)

sphingosine-1-phosphate phosphatase activity (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:8889548	PMID:15489334	PMID:19704009

Genomics

Comparative Map Data

Plpp7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	35,782,215 - 35,796,577 (+)	NCBI		GRCr8
mRatBN7.2	3	15,384,461 - 15,398,820 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	15,384,492 - 15,398,883 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	18,453,991 - 18,468,246 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	27,038,981 - 27,053,233 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	25,289,724 - 25,304,159 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	11,114,551 - 11,130,427 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	11,114,551 - 11,130,425 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	16,467,145 - 16,481,235 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	11,209,598 - 11,223,892 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	11,105,969 - 11,120,261 (+)	NCBI
Celera	3	10,131,465 - 10,145,728 (+)	NCBI		Celera
Cytogenetic Map	3	p12	NCBI

PLPP7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	131,289,723 - 131,309,261 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	131,289,459 - 131,359,022 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	134,165,110 - 134,184,648 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	133,154,945 - 133,174,468 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	131,194,677 - 131,214,201	NCBI
Celera	9	104,704,143 - 104,723,704 (+)	NCBI		Celera
Cytogenetic Map	9	q34.13	NCBI
HuRef	9	103,655,486 - 103,675,048 (+)	NCBI		HuRef
CHM1_1	9	134,314,643 - 134,334,187 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	143,498,005 - 143,517,537 (+)	NCBI		T2T-CHM13v2.0

Plpp7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	31,985,540 - 32,000,827 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	31,985,540 - 32,000,832 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	32,095,528 - 32,110,815 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	32,095,528 - 32,110,820 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	31,951,171 - 31,966,340 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	31,917,660 - 31,932,829 (+)	NCBI		MGSCv36	mm8
Celera	2	31,799,207 - 31,814,376 (+)	NCBI		Celera
Cytogenetic Map	2	B	NCBI
cM Map	2	22.02	NCBI

Plpp7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955513	1,076,524 - 1,092,025 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955513	1,081,748 - 1,092,025 (+)	NCBI	ChiLan1.0	ChiLan1.0

PLPP7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	8,048,162 - 8,073,856 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	8,050,504 - 8,076,205 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	102,411,095 - 102,431,146 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	131,054,886 - 131,074,449 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	131,055,406 - 131,073,474 (+)	Ensembl	panpan1.1		panPan2

PLPP7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	52,781,110 - 52,796,763 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	52,781,020 - 52,796,433 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	52,043,935 - 52,059,596 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	53,679,783 - 53,702,330 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	53,679,785 - 53,695,393 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	52,457,375 - 52,479,854 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	52,777,850 - 52,800,341 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	52,870,823 - 52,893,382 (-)	NCBI		UU_Cfam_GSD_1.0

Plpp7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	198,338,299 - 198,353,061 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936487	18,106,809 - 18,121,794 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936487	18,106,836 - 18,121,586 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PLPP7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	271,268,870 - 271,283,655 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	271,268,843 - 271,283,657 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	305,285,168 - 305,300,506 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103239735
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	6,832,015 - 6,850,313 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	6,832,283 - 6,849,598 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666079	8,658,852 - 8,709,428 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Plpp7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624760	4,606,409 - 4,619,912 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624760	4,606,693 - 4,619,852 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Plpp7
207 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	123
Count of miRNA genes:	84
Interacting mature miRNAs:	105
Transcripts:	ENSRNOT00000013507
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358357	Srcrtb1	Stress Responsive Cort Basal QTL 1	6.36	0.002	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	8658162	27494778	Rat
6893355	Bw101	Body weight QTL 101	0.4	0.38	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	8227194	47233430	Rat
1298526	Arunc3	Aerobic running capacity QTL 3	2.2		exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	8227194	33703538	Rat
8693641	Alc30	Alcohol consumption QTL 30	2	0.739	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	3	10434306	24512004	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	15005422	76927699	Rat
1558657	Cm43	Cardiac mass QTL 43	6.6	3e-08	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	10778823	30356773	Rat
631568	Bp92	Blood pressure QTL 92	2.2	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	39874793	Rat
6893363	Bw105	Body weight QTL 105	2.6	0.0036	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
61468	Bp15	Blood pressure QTL 15	4.4		blood pressure trait (VT:0000183)	pulse pressure (CMO:0000292)	3	1	33278763	Rat
631831	Alc8	Alcohol consumption QTL 8	2.7		consumption behavior trait (VT:0002069)	calculated ethanol drink intake rate (CMO:0001615)	3	1	33230976	Rat
1558647	Cm46	Cardiac mass QTL 46	5.4	0.0000055	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	10778823	30356773	Rat
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	1	36847613	Rat
1558654	Bw56	Body weight QTL 56	4.5	0.0000171	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
1558650	Cm48	Cardiac mass QTL 48	4	0.0001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	3	10778823	30356773	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
70191	BpQTLcluster4	Blood pressure QTL cluster 4	3		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	3	10778704	50302886	Rat
631545	Bp85	Blood pressure QTL 85	3.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	33278763	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
631679	Cm10	Cardiac mass QTL 10	7.34	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	1	31158234	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
70203	Gcr2	Gastric cancer resistance QTL 2	2.6		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	3	8658162	27494778	Rat
70202	Alc19	Alcohol consumption QTL 19	2.5		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	3	1	27494778	Rat
2312664	Scl62	Serum cholesterol level QTL 62		0.05	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	1	38710544	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat

Markers in Region

RH141132

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	15,398,554 - 15,398,751 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	11,130,162 - 11,130,358	NCBI	Rnor6.0
Rnor_5.0	3	16,480,970 - 16,481,166	UniSTS	Rnor5.0
RGSC_v3.4	3	11,223,627 - 11,223,823	UniSTS	RGSC3.4
Celera	3	10,145,463 - 10,145,659	UniSTS
RH 3.4 Map	3	60.72	UniSTS
Cytogenetic Map	3	p11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001012349	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104753	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283491	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AA900756	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC089948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB771354	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224283	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000013507 ⟹ ENSRNOP00000013507

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	15,384,492 - 15,398,818 (+)	Ensembl
Rnor_6.0 Ensembl	3	11,114,551 - 11,130,425 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000099438 ⟹ ENSRNOP00000090722

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	15,391,490 - 15,398,883 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114409 ⟹ ENSRNOP00000092534

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	15,391,131 - 15,398,883 (+)	Ensembl

RefSeq Acc Id:

NM_001012349 ⟹ NP_001012349

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	35,782,244 - 35,796,577 (+)	NCBI
mRatBN7.2	3	15,384,492 - 15,398,820 (+)	NCBI
Rnor_6.0	3	11,114,551 - 11,130,427 (+)	NCBI
Rnor_5.0	3	16,467,145 - 16,481,235 (+)	NCBI
RGSC_v3.4	3	11,209,598 - 11,223,892 (+)	RGD
Celera	3	10,131,465 - 10,145,728 (+)	RGD

Sequence:

show sequence

TGTGGACTCCTCCGCCTCTCCGTGGCTCTATTGGCGCTGGCCCCTTAAGGGTGGGCTCTATTGG
CTGCCCAGCTGGCATTGACGTCCCCCTCGGAGCCGGGTGGCAGCTGGAGGTAAATAGCCATGTG
CAATTCTCCTCTCTATATTTAACAGCTGCTACAGAGAAGGTGGCGACTCCTGTCTTCTGGGAGA
AGGCCCTTGGAACTGGGCTGGGACTGGCCTTCTCGTAGTGAGCGAGGTCACCATGCCAGTTTCC
CAGAGCCGGGCCCGTGCCAGGGATCGCAACAATGTCCTCAACCGAGCTGAGTTCCTGTCCCTGA
ACCAGCCCCCCAAGGGGACCCAGGAGCCCAGAAGCTCAGGTAGGAAGGCCTCGGGGCCCTCAAC
ACAGCCCCCACCCTCCAGCGACGGGGCCCGGGAGCGTCGCCAGTCACAGCAGCTGCCCGAGGAG
GACTGCATGCAGCTGAACCCCTCATTCAAGGGCATCGCCTTCAACTCCCTGCTGGCTATTGACA
TCTGCATGTCCAAGCGACTGGGGGTATGTGCGGGCCGGGCTGCATCCTGGGCCAGTGCCCGCTC
CATGGTCAAGCTCATTGGCATTACGAGCCATGGCATTCCTTGGATCGGGGGCACCATCCTCTGC
CTGGTGAGAAGCAGCACCCTGGCCGGCCAAGAGGTGCTCATGAACCTGCTGCTAGCCCTGCTCT
TGGACATCATGACAGTGGCTGGAGTACAGAAGCTCATCAAGCGCCGCGGCCCGTATGAGACTAG
CCCTGGGCTCCTGGACTACCTCACCATGGACATCTACGCCTTTCCTGCTGGCCACGCCAGCCGT
GCCGCCATGGTGTCCAAGTTCTTCCTGAGCCACTTGGTGCTGGCGGTGCCGCTACGAGTGCTGC
TGGTGCTCTGGGCCTTCTGCGTGGGTTTGTCTCGGGTGATGATCGGACGCCACCACATTACAGA
CGTCATCTCTGGCTTCATCATCGGCTACTTCCAGTTCCGCCTGGTGGAGCTCGTGTGGATGTCC
TCCAACACCTGCCAGATGCTCATCTCTGCCTGGTGAGCCGCCACCCACCACCCACCTGGGCTCT
GGGCAGAGCTGGCCCCAGAGAAGTGGCTAGCGGTGGGTCAGTGGGGACAGACTGACTCAACTTC
TCCAACCTGGCCAGAGGCTGGTTTGTTAGTACTGTGGGGGCTTTCGTTTTCTTCACTGGACTCT
GTGCATCCTCGGAGGTAGCCGGAATGGCTCACATGGATGCTTAGCCTCCATTCCTTGTCTGAAG
GCAACAGACAAGAACAAGATGGCCGTAGGAGGGGCAGAGTCTTGTCCCCTCGTCACCATGACTG
TGGTAGCTGTACTGTGCCACCACACCATGGCACAAAGTTCAGGGAAGAACGCCCACCACTCATC
CAACACAGGAGCCGATCTATCAGTGGTCACAGACAATTTAGGGTAGCACGCTCCCAATGGTGCC
TGGAGGTCCCAGCCTTCAAGATACTTCTTGGGAAAAGGCTTTTGTGATCCAGTGCATTTTGGGA
AGTCCTGCACACTGGCCCCACAGTGGATGTTCACAAGTGCAGAGTATTTAGAAAGGCACTGGTA
TGTCCTATAGAAAACCCAGCCATTGAAGTCTTGTTTAGCTCAGCATTTCCGAAATGTATTTGAC
CACAGGAGCCTTGTCTTCAGAAATAGCTTCTAACCTACCAGGAACCTATTGAATCTGGGAAACT
GGTGCCCAGGGGCCAGAGGACCTGGGATGTGAGCTCGCCTTTCCCAACACCCAGCCCTGAGGCC
TGGGGAAAGCAGGTGCCCACAGCAAGACCTGGAGGAGGTTCCTGCCATGGTCTCTGGGCACTGA
AGCTGCTTTGGCCCCCAGGGGCCGGACTCTGTGTGACCTAATAGGTCGTTTCCAAGTCAGACAC
TTAGGGATGCGCATTTCATGTGACAATACAGTGATATGCAAATGTAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039104753 ⟹ XP_038960681

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	35,782,215 - 35,796,577 (+)	NCBI
mRatBN7.2	3	15,384,461 - 15,398,820 (+)	NCBI

RefSeq Acc Id:

XM_063283491 ⟹ XP_063139561

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	35,788,842 - 35,796,577 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001012349	(Get FASTA)	NCBI Sequence Viewer
	XP_038960681	(Get FASTA)	NCBI Sequence Viewer
	XP_063139561	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH89948	(Get FASTA)	NCBI Sequence Viewer
	EDL93256	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000013507.4
	ENSRNOP00000090722.1
	ENSRNOP00000092534.1
GenBank Protein	Q5FVJ3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001012349 ⟸ NM_001012349

- UniProtKB:

Q5FVJ3 (UniProtKB/Swiss-Prot), A6JU41 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPVSQSRARARDRNNVLNRAEFLSLNQPPKGTQEPRSSGRKASGPSTQPPPSSDGARERRQSQQ
LPEEDCMQLNPSFKGIAFNSLLAIDICMSKRLGVCAGRAASWASARSMVKLIGITSHGIPWIGG
TILCLVRSSTLAGQEVLMNLLLALLLDIMTVAGVQKLIKRRGPYETSPGLLDYLTMDIYAFPAG
HASRAAMVSKFFLSHLVLAVPLRVLLVLWAFCVGLSRVMIGRHHITDVISGFIIGYFQFRLVEL
VWMSSNTCQMLISAW

hide sequence

Ensembl Acc Id:

ENSRNOP00000013507 ⟸ ENSRNOT00000013507

RefSeq Acc Id:	XP_038960681 ⟸ XM_039104753
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000092534 ⟸ ENSRNOT00000114409

Ensembl Acc Id:

ENSRNOP00000090722 ⟸ ENSRNOT00000099438

RefSeq Acc Id:	XP_063139561 ⟸ XM_063283491
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6AEA9 (UniProtKB/TrEMBL)

Protein Domains

Phosphatidic acid phosphatase type 2/haloperoxidase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5FVJ3-F1-model_v2	AlphaFold	Q5FVJ3	1-271	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691977

Promoter ID:

EPDNEW_R2502

Type:

single initiation site

Name:

Plpp7_1

Description:

phospholipid phosphatase 7

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	11,114,541 - 11,114,601	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305821	AgrOrtholog
BioCyc Gene	G2FUF-50162	BioCyc
Ensembl Genes	ENSRNOG00000010068	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000013507.5	UniProtKB/Swiss-Prot
	ENSRNOT00000099438.1	UniProtKB/TrEMBL
	ENSRNOT00000114409.1	UniProtKB/TrEMBL
Gene3D-CATH	Phosphatidic acid phosphatase type 2/haloperoxidase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7311891	IMAGE-MGC_LOAD
InterPro	P_Acid_Pase_2/haloperoxi_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	P_Acid_Pase_2/haloperoxidase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:296635	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:109271	IMAGE-MGC_LOAD
NCBI Gene	296635	ENTREZGENE
PANTHER	INACTIVE PHOSPHOLIPID PHOSPHATASE 7	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SPHINGOSINE-1-PHOSPHATE PHOSPHOHYDROLASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	PAP2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Plpp7	PhenoGen
RatGTEx	ENSRNOG00000010068	RatGTEx
SMART	acidPPc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF48317	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6AEA9	ENTREZGENE, UniProtKB/TrEMBL
	A6JU41	ENTREZGENE, UniProtKB/TrEMBL
	PLPP7_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-12-01	Plpp7	phospholipid phosphatase 7 (inactive)	Plpp7	phospholipid phosphatase 7	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-10-26	Plpp7	phospholipid phosphatase 7	Ppapdc3	phosphatidic acid phosphatase type 2 domain containing 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-06	Ppapdc3	phosphatidic acid phosphatase type 2 domain containing 3	RGD1305821	similar to RIKEN cDNA D830019K17	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1305821	similar to RIKEN cDNA D830019K17	RGD1305821_predicted	similar to RIKEN cDNA D830019K17 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1305821_predicted	similar to RIKEN cDNA D830019K17 (predicted)	LOC296635_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC296635_predicted	similar to RIKEN cDNA D830019K17 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar