Mrpl54 (mitochondrial ribosomal protein L54)

Advanced Search (OLGA)

Gene: Mrpl54 (mitochondrial ribosomal protein L54) Rattus norvegicus

Analyze

Symbol:

Mrpl54

Name:

mitochondrial ribosomal protein L54

RGD ID:

1305694

Description:

Predicted to be a structural constituent of ribosome. Predicted to be located in mitochondrion. Predicted to be part of mitochondrial large ribosomal subunit. Orthologous to human MRPL54 (mitochondrial ribosomal protein L54); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

39S ribosomal protein L54, mitochondrial; large ribosomal subunit protein mL54; LOC299628

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MRPL54 (mitochondrial ribosomal protein L54)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Mrpl54 (mitochondrial ribosomal protein L54)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mrpl54 (mitochondrial ribosomal protein L54)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MRPL54 (mitochondrial ribosomal protein L54)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MRPL54 (mitochondrial ribosomal protein L54)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mrpl54 (mitochondrial ribosomal protein L54)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MRPL54 (mitochondrial ribosomal protein L54)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MRPL54 (mitochondrial ribosomal protein L54)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mrpl54 (mitochondrial ribosomal protein L54)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	MRPL54 (mitochondrial ribosomal protein L54)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mrpl54 (mitochondrial ribosomal protein L54)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mrpl54 (mitochondrial ribosomal protein L54)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	MRPL37	Alliance	DIOPT (OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	mRpL54	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mrpl-54	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mrpl54	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	9,103,525 - 9,106,045 (+)	NCBI		GRCr8
mRatBN7.2	7	8,452,801 - 8,455,321 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	8,452,716 - 8,455,321 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	11,337,148 - 11,339,518 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	13,212,631 - 13,215,001 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	11,080,199 - 11,082,469 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	11,321,057 - 11,323,577 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	11,321,057 - 11,323,577 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	11,488,465 - 11,490,985 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	9,936,603 - 9,939,123 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	9,936,616 - 9,939,119 (+)	NCBI
Celera	7	6,641,125 - 6,643,645 (+)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

amenorrhea (ISO)

RASopathy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

(S)-nicotine (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

2-methylcholine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

chlormequat chloride (EXP)

chlorpyrifos (ISO)

clofibrate (ISO)

cyclosporin A (ISO)

cyproconazole (ISO)

diclofenac (ISO)

dioxygen (ISO)

diuron (ISO)

epoxiconazole (ISO)

ethyl methanesulfonate (ISO)

fenthion (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

gentamycin (EXP)

glafenine (EXP)

ibuprofen (ISO)

inulin (ISO)

lipopolysaccharide (ISO)

methidathion (ISO)

methimazole (EXP)

nicotine (ISO)

ochratoxin A (EXP)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

rac-lactic acid (ISO)

selenomethionine (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

sulindac (EXP)

Testosterone propionate (ISO)

triphenyl phosphate (ISO)

tungsten (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

mitochondrial large ribosomal subunit (IBA,ISO)

mitochondrion (ISO)

Molecular Function

protein binding (ISO)

structural constituent of ribosome (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:18614015	PMID:22681889	PMID:25838379	PMID:28892042

Genomics

Comparative Map Data

Mrpl54
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	9,103,525 - 9,106,045 (+)	NCBI		GRCr8
mRatBN7.2	7	8,452,801 - 8,455,321 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	8,452,716 - 8,455,321 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	11,337,148 - 11,339,518 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	13,212,631 - 13,215,001 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	11,080,199 - 11,082,469 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	11,321,057 - 11,323,577 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	11,321,057 - 11,323,577 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	11,488,465 - 11,490,985 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	9,936,603 - 9,939,123 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	9,936,616 - 9,939,119 (+)	NCBI
Celera	7	6,641,125 - 6,643,645 (+)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

MRPL54
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	3,762,682 - 3,767,565 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	3,762,682 - 3,768,575 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	3,762,680 - 3,767,563 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	3,713,665 - 3,718,563 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	3,713,671 - 3,718,555	NCBI
Celera	19	3,700,310 - 3,705,207 (+)	NCBI		Celera
Cytogenetic Map	19	p13.3	NCBI
HuRef	19	3,527,380 - 3,532,329 (+)	NCBI		HuRef
CHM1_1	19	3,762,292 - 3,767,188 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	3,741,934 - 3,746,816 (+)	NCBI		T2T-CHM13v2.0

Mrpl54
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	81,100,556 - 81,102,760 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	81,100,547 - 81,102,768 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	81,264,722 - 81,266,926 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	81,264,713 - 81,266,934 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	80,727,467 - 80,729,671 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	80,667,851 - 80,670,055 (-)	NCBI		MGSCv36	mm8
Celera	10	82,285,070 - 82,287,274 (-)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	39.72	NCBI

Mrpl54
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955495	5,655,560 - 5,657,699 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955495	5,655,510 - 5,659,103 (+)	NCBI	ChiLan1.0	ChiLan1.0

MRPL54
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	8,158,376 - 8,163,105 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	7,390,025 - 7,394,734 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	2,786,348 - 2,791,063 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	3,735,103 - 3,739,571 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	3,735,103 - 3,739,571 (+)	Ensembl	panpan1.1		panPan2

MRPL54
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	55,709,341 - 55,712,729 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	55,710,281 - 55,712,268 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	55,434,730 - 55,438,201 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	56,369,463 - 56,372,935 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	56,369,522 - 56,372,925 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	55,425,304 - 55,428,772 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	55,907,308 - 55,910,765 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	56,106,043 - 56,109,520 (-)	NCBI		UU_Cfam_GSD_1.0

Mrpl54
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	215,701,434 - 215,703,492 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936588	2,131,286 - 2,133,341 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936588	2,131,291 - 2,133,349 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MRPL54
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	74,925,070 - 74,928,167 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	74,925,064 - 74,928,196 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	75,516,538 - 75,519,665 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MRPL54
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	3,518,333 - 3,523,178 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	3,518,028 - 3,523,186 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666081	4,726,814 - 4,731,747 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mrpl54
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624828	6,406,083 - 6,409,326 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624828	6,405,998 - 6,409,721 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Mrpl54
19 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	106
Count of miRNA genes:	94
Interacting mature miRNAs:	101
Transcripts:	ENSRNOT00000027737
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	44782185	Rat
1300176	Hrtrt10	Heart rate QTL 10	3.19		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	664270	26029351	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	5329019	50329019	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1	44822433	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
10755438	Coatc9	Coat color QTL 9		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	3529280	48529280	Rat
9590142	Scort5	Serum corticosterone level QTL 5	24.4	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	1	31962314	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	7573985	52573985	Rat
2317047	Wbc4	White blood cell count QTL 4		0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	7	1	35342956	Rat
10755440	Coatc10	Coat color QTL 10		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	7496499	52496499	Rat
2298550	Neuinf6	Neuroinflammation QTL 6	3.3		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	7	1	27829089	Rat
724560	Plsm3	Polydactyly-luxate syndrome (PLS) morphotypes QTL 3		0.0003	tibia length (VT:0004357)	tibia length (CMO:0000450)	7	1	34000259	Rat
7411566	Bw136	Body weight QTL 136	10.4	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	1	31962314	Rat

Markers in Region

RH131643

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	8,453,925 - 8,455,178 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	11,322,182 - 11,323,434	NCBI	Rnor6.0
Rnor_5.0	7	11,489,590 - 11,490,842	UniSTS	Rnor5.0
RGSC_v3.4	7	9,937,728 - 9,938,980	UniSTS	RGSC3.4
Celera	7	6,642,250 - 6,643,502	UniSTS
RH 3.4 Map	2	723.6	UniSTS
Cytogenetic Map	7	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106770	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC094643	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211295	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211839	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217217	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221492	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224331	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224393	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224740	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000027737 ⟹ ENSRNOP00000027737

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	8,452,716 - 8,455,321 (+)	Ensembl
Rnor_6.0 Ensembl	7	11,321,057 - 11,323,577 (+)	Ensembl

RefSeq Acc Id:

NM_001106770 ⟹ NP_001100240

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	9,103,525 - 9,106,045 (+)	NCBI
mRatBN7.2	7	8,452,801 - 8,455,321 (+)	NCBI
Rnor_6.0	7	11,321,057 - 11,323,577 (+)	NCBI
Rnor_5.0	7	11,488,465 - 11,490,985 (+)	NCBI
RGSC_v3.4	7	9,936,603 - 9,939,123 (+)	RGD
Celera	7	6,641,125 - 6,643,645 (+)	RGD

Sequence:

show sequence

GTAACACGGAAGCATGCACGTGTGAGCGGCCGGCGAGCGTCATGGCGGCCGCCAGTCTCCTCGG
GGCAACCCGGGTGTGGGCCCGCTGGCATCCCCGGGCGCTCCCGGTCCCCGGGAGACCTGGAGAA
TTATTTATCCGGGAATATGCCAAGAAGGCAGTCAGCAAGGGTGGCAAGGGTGGCGTGGCCGCTG
AGGCCCTGAAGGACCCCGAGGTGTGCACAGACCCCTCTCAGCTCACCACACACGCCATGGGGGT
CAACATCTACAAGGAAGGCCAGGAGGTGGCCCTGAAGCCAGACTCTGAGTACCCGACATGGCTG
TTCCAGGTGGACCTGGGTCCCCCCAAAAAGCTAGAGGACCTAGAACCGGAGTCCCGAGAGTACT
GGCGACTGCTTCGCAAACAGAACATCTGGCGTCACAACAGGCTGAGCAAGAACAAGAAGCTGTA
ATGTGAGTGTGGGCACTTCCTCCCAGGAGCCAGCCTGGTGCCAGCCAGAACGGGGAGAACCGAG
TCCTTCATTCGCTCACCGTGATGTGCAGGCCTTACACACACTAAATAAACAAAGATGAAAATGA
AGGGCAAAATAAAGGGACCTGCGGCAGTCACGCCC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001100240	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL89172	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000027737.5

RefSeq Acc Id:	NP_001100240 ⟸ NM_001106770
- UniProtKB:	A6K8A2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAAASLLGATRVWARWHPRALPVPGRPGELFIREYAKKAVSKGGKGGVAAEALKDPEVCTDPSQ LTTHAMGVNIYKEGQEVALKPDSEYPTWLFQVDLGPPKKLEDLEPESREYWRLLRKQNIWRHNR LSKNKKL hide sequence

Ensembl Acc Id:

ENSRNOP00000027737 ⟸ ENSRNOT00000027737

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3Z9K2-F1-model_v2	AlphaFold	D3Z9K2	1-135	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694980

Promoter ID:

EPDNEW_R5505

Type:

multiple initiation site

Name:

Mrpl54_1

Description:

mitochondrial ribosomal protein L54

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	11,321,070 - 11,321,130	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305694	AgrOrtholog
BioCyc Gene	G2FUF-35010	BioCyc
Ensembl Genes	ENSRNOG00000020464	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000027737.6	UniProtKB/TrEMBL
InterPro	Ribosomal_L37_mit	UniProtKB/TrEMBL
KEGG Report	rno:299628	UniProtKB/TrEMBL
NCBI Gene	299628	ENTREZGENE
PANTHER	39S RIBOSOMAL PROTEIN L54, MITOCHONDRIAL	UniProtKB/TrEMBL
	PTHR28595	UniProtKB/TrEMBL
Pfam	Ribosomal_L37	UniProtKB/TrEMBL
PhenoGen	Mrpl54	PhenoGen
RatGTEx	ENSRNOG00000020464	RatGTEx
UniProt	A6K8A2	ENTREZGENE, UniProtKB/TrEMBL
	D3Z9K2_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Mrpl54	mitochondrial ribosomal protein L54	Mrpl54_predicted	mitochondrial ribosomal protein L54 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Mrpl54_predicted	mitochondrial ribosomal protein L54 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar