Symbol:
Jpt2
Name:
Jupiter microtubule associated homolog 2
RGD ID:
1305117
Description:
Predicted to be involved in endocytosis involved in viral entry into host cell and regulation of calcium-mediated signaling. Predicted to be located in cytosol and plasma membrane. Predicted to be active in nucleus. Orthologous to human JPT2 (Jupiter microtubule associated homolog 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
hematological and neurological expressed 1-like; hematological and neurological expressed 1-like protein; HN1-like protein; Hn1l; LOC360492; MGC108993; RGD1305117; similar to HN1-like protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
JPT2 (Jupiter microtubule associated homolog 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Jpt2 (Jupiter microtubule associated homolog 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Jpt2 (Jupiter microtubule associated homolog 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
JPT2 (Jupiter microtubule associated homolog 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
JPT2 (Jupiter microtubule associated homolog 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Jpt2 (Jupiter microtubule associated homolog 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
JPT2 (Jupiter microtubule associated homolog 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
JPT2 (Jupiter microtubule associated homolog 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Jpt2 (Jupiter microtubule associated homolog 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
JPT2 (Jupiter microtubule associated homolog 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Jpt2 (Jupiter microtubule associated homolog 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
jpt2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
jpt2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 14,467,652 - 14,487,769 (-) NCBI GRCr8 mRatBN7.2 10 13,963,135 - 13,983,212 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 13,963,137 - 13,983,170 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 18,710,164 - 18,730,178 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 18,199,027 - 18,219,041 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 13,698,248 - 13,718,260 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 14,304,108 - 14,324,170 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 14,304,104 - 14,324,211 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 14,120,124 - 14,139,812 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 14,191,222 - 14,211,106 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 14,191,225 - 14,211,106 (-) NCBI Celera 10 13,642,349 - 13,661,670 (-) NCBI Celera Cytogenetic Map 10 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Jpt2 Rat 1,2-dichloroethane increases expression ISO Jpt2 (Mus musculus) 6480464 ethylene dichloride results in increased expression of JPT2 mRNA CTD PMID:28960355 Jpt2 Rat 17beta-estradiol increases expression ISO Jpt2 (Mus musculus) 6480464 Estradiol results in increased expression of JPT2 mRNA CTD PMID:39298647 Jpt2 Rat 17beta-estradiol multiple interactions ISO JPT2 (Homo sapiens) 6480464 Estradiol promotes the reaction [JPT2 protein binds to ESR1 protein] CTD PMID:27156127 Jpt2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Jpt2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of JPT2 mRNA CTD PMID:21570461 and PMID:24680724 Jpt2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of JPT2 mRNA CTD PMID:33387578 Jpt2 Rat 2,6-dimethoxyphenol multiple interactions ISO JPT2 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of and affects the localization of JPT2 protein CTD PMID:38598786 Jpt2 Rat 2-hydroxypropanoic acid decreases expression ISO JPT2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of JPT2 mRNA CTD PMID:30851411 Jpt2 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:23196670 Jpt2 Rat 4,4'-sulfonyldiphenol increases expression ISO Jpt2 (Mus musculus) 6480464 bisphenol S results in increased expression of JPT2 mRNA CTD PMID:39298647 Jpt2 Rat 4-hydroxyphenyl retinamide decreases expression ISO Jpt2 (Mus musculus) 6480464 Fenretinide results in decreased expression of JPT2 mRNA CTD PMID:28973697 Jpt2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of HN1L mRNA and Propylthiouracil results in increased expression of JPT2 mRNA CTD PMID:24780913 and PMID:30047161 Jpt2 Rat aflatoxin B1 increases methylation ISO JPT2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of JPT2 gene CTD PMID:27153756 Jpt2 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of HN1L mRNA CTD PMID:30047161 Jpt2 Rat arsane affects methylation ISO JPT2 (Homo sapiens) 6480464 Arsenic affects the methylation of JPT2 gene CTD PMID:25304211 Jpt2 Rat arsenic atom affects methylation ISO JPT2 (Homo sapiens) 6480464 Arsenic affects the methylation of JPT2 gene CTD PMID:25304211 Jpt2 Rat benzatropine multiple interactions ISO JPT2 (Homo sapiens) 6480464 [Cuprizone co-treated with Benztropine] results in increased expression of JPT2 protein CTD PMID:34122009 Jpt2 Rat benzo[a]pyrene increases methylation ISO Jpt2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of JPT2 promoter CTD PMID:27901495 Jpt2 Rat bisphenol A increases expression ISO JPT2 (Homo sapiens) 6480464 bisphenol A results in increased expression of JPT2 mRNA CTD PMID:20678512 Jpt2 Rat bisphenol A decreases expression ISO JPT2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of JPT2 protein CTD PMID:37567409 Jpt2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of JPT2 mRNA CTD PMID:25181051 Jpt2 Rat bisphenol F increases expression ISO Jpt2 (Mus musculus) 6480464 bisphenol F results in increased expression of JPT2 mRNA CTD PMID:38685157 Jpt2 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of JPT2 mRNA CTD PMID:24136188 Jpt2 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of JPT2 promoter CTD PMID:22457795 Jpt2 Rat cadmium dichloride decreases expression ISO JPT2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of JPT2 mRNA CTD PMID:38568856 Jpt2 Rat carbamazepine affects expression ISO JPT2 (Homo sapiens) 6480464 Carbamazepine affects the expression of JPT2 mRNA CTD PMID:25979313 Jpt2 Rat carbon nanotube increases expression ISO Jpt2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Jpt2 Rat copper atom multiple interactions ISO JPT2 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of JPT2 mRNA CTD PMID:20971185 Jpt2 Rat copper(0) multiple interactions ISO JPT2 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of JPT2 mRNA CTD PMID:20971185 Jpt2 Rat Cuprizon affects expression EXP 6480464 Cuprizone affects the expression of JPT2 mRNA CTD PMID:26577399 Jpt2 Rat Cuprizon multiple interactions ISO JPT2 (Homo sapiens) 6480464 [Cuprizone co-treated with Benztropine] results in increased expression of JPT2 protein CTD PMID:34122009 Jpt2 Rat cyclosporin A decreases expression ISO JPT2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of JPT2 mRNA CTD PMID:25562108 Jpt2 Rat diazinon increases methylation ISO JPT2 (Homo sapiens) 6480464 Diazinon results in increased methylation of JPT2 gene CTD PMID:22964155 Jpt2 Rat Dibutyl phosphate affects expression ISO JPT2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of JPT2 mRNA CTD PMID:37042841 Jpt2 Rat dibutyl phthalate decreases expression ISO Jpt2 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of JPT2 mRNA CTD PMID:21266533 Jpt2 Rat dioxygen multiple interactions ISO Jpt2 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of JPT2 mRNA CTD PMID:30529165 Jpt2 Rat dorsomorphin multiple interactions ISO JPT2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Jpt2 Rat doxorubicin decreases expression ISO JPT2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of JPT2 mRNA CTD PMID:29803840 Jpt2 Rat enzyme inhibitor multiple interactions ISO JPT2 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of JPT2 protein CTD PMID:23301498 Jpt2 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of JPT2 mRNA CTD PMID:34044035 Jpt2 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of JPT2 mRNA CTD PMID:24136188 Jpt2 Rat folic acid decreases expression ISO Jpt2 (Mus musculus) 6480464 Folic Acid results in decreased expression of JPT2 mRNA CTD PMID:25629700 Jpt2 Rat FR900359 decreases phosphorylation ISO JPT2 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of JPT2 protein CTD PMID:37730182 Jpt2 Rat furan increases methylation EXP 6480464 furan results in increased methylation of JPT2 gene CTD PMID:22079235 Jpt2 Rat furfural multiple interactions ISO JPT2 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of JPT2 protein CTD PMID:38598786 Jpt2 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of JPT2 mRNA CTD PMID:24136188 Jpt2 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of JPT2 mRNA CTD PMID:24915197 Jpt2 Rat ivermectin decreases expression ISO JPT2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of JPT2 protein CTD PMID:32959892 Jpt2 Rat lead diacetate decreases expression ISO Jpt2 (Mus musculus) 6480464 lead acetate results in decreased expression of JPT2 mRNA CTD PMID:22613225 Jpt2 Rat lead(0) affects expression ISO JPT2 (Homo sapiens) 6480464 Lead affects the expression of JPT2 mRNA CTD PMID:28903495 Jpt2 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of JPT2 protein CTD PMID:30467583 Jpt2 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of HN1L mRNA CTD PMID:30047161 Jpt2 Rat methotrexate increases expression ISO JPT2 (Homo sapiens) 6480464 Methotrexate results in increased expression of JPT2 mRNA CTD PMID:24449571 Jpt2 Rat miconazole increases expression ISO Jpt2 (Mus musculus) 6480464 Miconazole results in increased expression of JPT2 mRNA CTD PMID:27462272 Jpt2 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of JPT2 mRNA CTD PMID:24136188 Jpt2 Rat nitrates multiple interactions ISO Jpt2 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of JPT2 mRNA CTD PMID:35964746 Jpt2 Rat ozone multiple interactions ISO Jpt2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of JPT2 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of JPT2 mRNA CTD PMID:34911549 Jpt2 Rat paracetamol affects expression ISO Jpt2 (Mus musculus) 6480464 Acetaminophen affects the expression of JPT2 mRNA CTD PMID:17562736 Jpt2 Rat paracetamol increases expression ISO Jpt2 (Mus musculus) 6480464 Acetaminophen results in increased expression of JPT2 mRNA CTD PMID:29246445 Jpt2 Rat paracetamol multiple interactions ISO Jpt2 (Mus musculus) 6480464 PANX1 gene mutant form inhibits the reaction [Acetaminophen results in increased expression of JPT2 mRNA] CTD PMID:29246445 Jpt2 Rat pentachlorophenol increases expression ISO Jpt2 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of JPT2 mRNA CTD PMID:23892564 Jpt2 Rat perfluorohexanesulfonic acid decreases expression ISO Jpt2 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of JPT2 mRNA CTD PMID:37995155 Jpt2 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of JPT2 mRNA CTD PMID:35163327 Jpt2 Rat phenobarbital increases expression ISO Jpt2 (Mus musculus) 6480464 Phenobarbital results in increased expression of JPT2 mRNA CTD PMID:19270015 Jpt2 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of HN1L mRNA CTD PMID:30047161 Jpt2 Rat quercitrin increases expression ISO JPT2 (Homo sapiens) 6480464 quercitrin results in increased expression of JPT2 mRNA CTD PMID:25193878 Jpt2 Rat rac-lactic acid decreases expression ISO JPT2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of JPT2 mRNA CTD PMID:30851411 Jpt2 Rat SB 431542 multiple interactions ISO JPT2 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Jpt2 Rat sodium arsenate increases expression ISO Jpt2 (Mus musculus) 6480464 sodium arsenate results in increased expression of JPT2 mRNA CTD PMID:30953684 Jpt2 Rat sodium arsenite decreases expression ISO JPT2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of JPT2 mRNA CTD PMID:38568856 Jpt2 Rat sodium chloride multiple interactions ISO JPT2 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of JPT2 protein more ... CTD PMID:38598786 Jpt2 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of HN1L mRNA CTD PMID:30047161 Jpt2 Rat sunitinib decreases expression ISO JPT2 (Homo sapiens) 6480464 Sunitinib results in decreased expression of JPT2 mRNA CTD PMID:31533062 Jpt2 Rat tert-butyl hydroperoxide decreases expression ISO JPT2 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of JPT2 mRNA CTD PMID:15336504 Jpt2 Rat tetrachloromethane increases expression ISO Jpt2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of JPT2 mRNA CTD PMID:27339419 and PMID:31919559 Jpt2 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of JPT2 mRNA CTD PMID:31150632 Jpt2 Rat tetrahydropalmatine decreases expression ISO JPT2 (Homo sapiens) 6480464 tetrahydropalmatine results in decreased expression of JPT2 protein CTD PMID:20109541 Jpt2 Rat thiram decreases expression ISO JPT2 (Homo sapiens) 6480464 Thiram results in decreased expression of JPT2 mRNA CTD PMID:38568856 Jpt2 Rat titanium dioxide increases expression ISO Jpt2 (Mus musculus) 6480464 titanium dioxide results in increased expression of JPT2 mRNA CTD PMID:23557971 Jpt2 Rat titanium dioxide decreases expression ISO Jpt2 (Mus musculus) 6480464 titanium dioxide results in decreased expression of JPT2 mRNA CTD PMID:29264374 Jpt2 Rat titanium dioxide decreases methylation ISO Jpt2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of HN1L gene and titanium dioxide results in decreased methylation of HN1L promoter CTD PMID:35295148 Jpt2 Rat topotecan affects response to substance ISO JPT2 (Homo sapiens) 6480464 JPT2 protein affects the susceptibility to Topotecan CTD PMID:16217747 Jpt2 Rat torcetrapib increases expression ISO JPT2 (Homo sapiens) 6480464 torcetrapib results in increased expression of JPT2 mRNA CTD PMID:23228038 Jpt2 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of JPT2 gene CTD PMID:27618143 Jpt2 Rat trichostatin A decreases expression ISO JPT2 (Homo sapiens) 6480464 trichostatin A results in decreased expression of JPT2 mRNA CTD PMID:24935251 and PMID:26272509 Jpt2 Rat trichostatin A multiple interactions ISO JPT2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of JPT2 mRNA CTD PMID:27188386 Jpt2 Rat triphenyl phosphate affects expression ISO JPT2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of JPT2 mRNA CTD PMID:37042841 Jpt2 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of JPT2 mRNA CTD PMID:30589522 Jpt2 Rat valproic acid affects expression ISO JPT2 (Homo sapiens) 6480464 Valproic Acid affects the expression of JPT2 mRNA CTD PMID:25979313 Jpt2 Rat valproic acid decreases expression ISO JPT2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of JPT2 mRNA CTD PMID:26272509 Jpt2 Rat valproic acid multiple interactions ISO JPT2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of JPT2 mRNA CTD PMID:27188386
1,2-dichloroethane (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 2-hydroxypropanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) amitrole (EXP) arsane (ISO) arsenic atom (ISO) benzatropine (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buspirone (EXP) cadmium dichloride (EXP,ISO) carbamazepine (ISO) carbon nanotube (ISO) copper atom (ISO) copper(0) (ISO) Cuprizon (EXP,ISO) cyclosporin A (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) enzyme inhibitor (ISO) fipronil (EXP) flutamide (EXP) folic acid (ISO) FR900359 (ISO) furan (EXP) furfural (ISO) glafenine (EXP) glycidol (EXP) ivermectin (ISO) lead diacetate (ISO) lead(0) (ISO) methapyrilene (EXP) methimazole (EXP) methotrexate (ISO) miconazole (ISO) nimesulide (EXP) nitrates (ISO) ozone (ISO) paracetamol (ISO) pentachlorophenol (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (EXP,ISO) quercitrin (ISO) rac-lactic acid (ISO) SB 431542 (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium chloride (ISO) sulfadimethoxine (EXP) sunitinib (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP,ISO) tetrahydropalmatine (ISO) thiram (ISO) titanium dioxide (ISO) topotecan (ISO) torcetrapib (ISO) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (EXP,ISO) valproic acid (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
GOA pipeline
RGD automated data pipeline
3.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
4.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
5.
Cloning, expression and subcellular localization of HN1 and HN1L genes, as well as characterization of their orthologs, defining an evolutionarily conserved gene family.
Zhou G, etal., Gene 2004 Apr 28;331:115-23.
Jpt2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 14,467,652 - 14,487,769 (-) NCBI GRCr8 mRatBN7.2 10 13,963,135 - 13,983,212 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 13,963,137 - 13,983,170 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 18,710,164 - 18,730,178 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 18,199,027 - 18,219,041 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 13,698,248 - 13,718,260 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 14,304,108 - 14,324,170 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 14,304,104 - 14,324,211 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 14,120,124 - 14,139,812 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 14,191,222 - 14,211,106 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 14,191,225 - 14,211,106 (-) NCBI Celera 10 13,642,349 - 13,661,670 (-) NCBI Celera Cytogenetic Map 10 q12 NCBI
JPT2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 1,678,279 - 1,702,086 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 1,678,256 - 1,702,280 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 1,728,280 - 1,752,087 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 1,668,279 - 1,692,074 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 16 1,940,552 - 1,964,346 (+) NCBI Celera Cytogenetic Map 16 p13.3 NCBI HuRef 16 1,653,268 - 1,677,063 (+) NCBI HuRef CHM1_1 16 1,728,250 - 1,752,045 (+) NCBI CHM1_1 T2T-CHM13v2.0 16 1,694,127 - 1,717,934 (+) NCBI T2T-CHM13v2.0
Jpt2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 25,161,444 - 25,179,597 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 25,156,393 - 25,179,663 (-) Ensembl GRCm39 Ensembl GRCm38 17 24,942,470 - 24,960,623 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 24,937,419 - 24,960,689 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 25,079,415 - 25,097,568 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 24,670,070 - 24,688,223 (-) NCBI MGSCv36 mm8 Celera 17 25,469,375 - 25,488,145 (-) NCBI Celera Cytogenetic Map 17 A3.3 NCBI cM Map 17 12.53 NCBI
Jpt2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955442 15,549,223 - 15,563,268 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955442 15,549,223 - 15,563,027 (-) NCBI ChiLan1.0 ChiLan1.0
JPT2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 1,943,931 - 1,967,296 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 5,725,809 - 5,749,170 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 299,835 - 323,210 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 1,736,162 - 1,754,175 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 1,733,188 - 1,754,175 (+) Ensembl panpan1.1 panPan2
JPT2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 39,181,488 - 39,201,903 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 39,185,213 - 39,201,890 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 40,421,095 - 40,439,825 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 39,498,658 - 39,517,397 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 39,498,678 - 39,517,355 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 39,175,838 - 39,194,570 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 39,148,078 - 39,166,793 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 39,626,358 - 39,645,339 (-) NCBI UU_Cfam_GSD_1.0
Jpt2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 104,425,535 - 104,444,093 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936694 2,265,360 - 2,283,878 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936694 2,265,360 - 2,283,887 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
JPT2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 40,244,011 - 40,256,980 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 40,245,473 - 40,256,960 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 41,709,807 - 41,721,121 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
JPT2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 1,589,553 - 1,611,592 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 1,589,631 - 1,613,046 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666068 29,474,273 - 29,495,781 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Jpt2
.
Predicted Target Of
Count of predictions: 1035 Count of miRNA genes: 331 Interacting mature miRNAs: 431 Transcripts: ENSRNOT00000035513 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 634329 Pia15 Pristane induced arthritis QTL 15 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 1 24158324 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2293680 Bss40 Bone structure and strength QTL 40 5.66 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 10 1 35225947 Rat 7387235 Uae41 Urinary albumin excretion QTL 41 5.26 0.1874 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 10 1 29497586 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 10401803 Kidm50 Kidney mass QTL 50 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 10 418344 45418344 Rat 737820 Alc9 Alcohol consumption QTL 9 2.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 10 5144027 19233348 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 631828 Alc5 Alcohol consumption QTL 5 2.4 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 10 5144027 17245662 Rat 634327 Hc4 Hypercalciuria QTL 4 2.4 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 10 1 38328221 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 631660 Hcar1 Hepatocarcinoma resistance QTL 1 3.4 0.0001 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 10 6154182 15990232 Rat 1576304 Schws7 Schwannoma susceptibility QTL 7 0.0115 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 4765527 19816042 Rat 7411611 Foco17 Food consumption QTL 17 18.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 1 42315980 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat
AI790734
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 13,984,382 - 13,984,466 (+) MAPPER mRatBN7.2 Rnor_6.0 10 14,325,401 - 14,325,484 NCBI Rnor6.0 Rnor_5.0 10 14,141,043 - 14,141,126 UniSTS Rnor5.0 RGSC_v3.4 10 14,212,337 - 14,212,420 UniSTS RGSC3.4 Celera 10 13,662,901 - 13,662,984 UniSTS Cytogenetic Map 10 q12 UniSTS
RH135174
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 2,236,558 - 2,236,730 (+) MAPPER mRatBN7.2 mRatBN7.2 10 13,963,333 - 13,963,513 (+) MAPPER mRatBN7.2 Rnor_6.0 10 14,304,307 - 14,304,486 NCBI Rnor6.0 Rnor_6.0 1 1,860,218 - 1,860,389 NCBI Rnor6.0 Rnor_5.0 10 14,120,323 - 14,120,502 UniSTS Rnor5.0 Rnor_5.0 1 3,556,975 - 3,557,146 UniSTS Rnor5.0 RGSC_v3.4 10 14,191,417 - 14,191,596 UniSTS RGSC3.4 RGSC_v3.4 1 2,428,995 - 2,429,166 UniSTS RGSC3.4 Celera 1 785,348 - 785,519 UniSTS Celera 10 13,642,544 - 13,642,723 UniSTS Cytogenetic Map 1 p13 UniSTS Cytogenetic Map 10 q12 UniSTS
RH140063
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 14,473,087 - 14,473,297 (+) Marker Load Pipeline mRatBN7.2 10 13,968,572 - 13,968,782 (+) MAPPER mRatBN7.2 Rnor_6.0 10 14,309,546 - 14,309,755 NCBI Rnor6.0 Rnor_5.0 10 14,125,562 - 14,125,771 UniSTS Rnor5.0 RGSC_v3.4 10 14,196,656 - 14,196,865 UniSTS RGSC3.4 Celera 10 13,647,783 - 13,647,992 UniSTS Cytogenetic Map 10 q12 UniSTS
AI060075
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 13,963,629 - 13,963,821 (+) MAPPER mRatBN7.2 Rnor_6.0 10 14,304,603 - 14,304,794 NCBI Rnor6.0 Rnor_5.0 10 14,120,619 - 14,120,810 UniSTS Rnor5.0 RGSC_v3.4 10 14,191,713 - 14,191,904 UniSTS RGSC3.4 Celera 10 13,642,840 - 13,643,031 UniSTS RH 3.4 Map 10 173.1 UniSTS Cytogenetic Map 10 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000035513 ⟹ ENSRNOP00000035954
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 13,963,137 - 13,983,170 (-) Ensembl Rnor_6.0 Ensembl 10 14,304,119 - 14,324,170 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000090587 ⟹ ENSRNOP00000071396
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 13,965,281 - 13,979,226 (-) Ensembl Rnor_6.0 Ensembl 10 14,304,104 - 14,324,211 (-) Ensembl
RefSeq Acc Id:
NM_001013182 ⟹ NP_001013200
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 14,467,654 - 14,487,663 (-) NCBI mRatBN7.2 10 13,963,139 - 13,983,152 (-) NCBI Rnor_6.0 10 14,304,112 - 14,324,170 (-) NCBI Rnor_5.0 10 14,120,124 - 14,139,812 (-) NCBI RGSC_v3.4 10 14,191,222 - 14,211,106 (-) RGD Celera 10 13,642,349 - 13,661,670 (-) RGD
Sequence:
GGCCGACATGTTCCGGGGCGCGGACGGCCAAGCTAGCAAGTCGGGCTTCAGATCCATGAAACCCCCGGGAGGAGAGTCGAACGATATTTTTGGAAGCCCAGAAGAAGGTGTTCCTTCAAGCAAGCCTC
hide sequence
RefSeq Acc Id:
XM_063269310 ⟹ XP_063125380
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 14,467,652 - 14,487,524 (-) NCBI
RefSeq Acc Id:
XR_010055200
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 14,467,652 - 14,487,769 (-) NCBI
RefSeq Acc Id:
NP_001013200 ⟸ NM_001013182
- UniProtKB:
Q5BK20 (UniProtKB/Swiss-Prot), A0A059NZV6 (UniProtKB/TrEMBL), A0A8L2R4T4 (UniProtKB/TrEMBL)
- Sequence:
MFRGADGQASKSGFRSMKPPGGESNDIFGSPEEGVPSSKPHRMASNIFGPTEEPKNIPKRTNPPGGKGSGIFDESTPVQTRQRLNPPGGKTSDIFGSPVTATAPLAHPNKPKDHVLLCEGEDCKSDLK
hide sequence
Ensembl Acc Id:
ENSRNOP00000035954 ⟸ ENSRNOT00000035513
Ensembl Acc Id:
ENSRNOP00000071396 ⟸ ENSRNOT00000090587
RefSeq Acc Id:
XP_063125380 ⟸ XM_063269310
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2R4T4 (UniProtKB/TrEMBL)
RGD ID: 13697036 Promoter ID: EPDNEW_R7561 Type: initiation region Name: Jpt2_1 Description: Jupiter microtubule associated homolog 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 14,324,199 - 14,324,259 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-03-29
Jpt2
Jupiter microtubule associated homolog 2
Hn1l
hematological and neurological expressed 1-like
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-06
Hn1l
hematological and neurological expressed 1-like
RGD1305117
similar to HN1-like protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
RGD1305117
similar to HN1-like protein
RGD1305117_predicted
similar to HN1-like protein (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1305117_predicted
similar to HN1-like protein (predicted)
LOC360492_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC360492_predicted
similar to HN1-like protein (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
