Advanced Search (OLGA)

Gene: Alx4 (ALX homeobox 4) Ictidomys tridecemlineatus

Subscribe to Updates

Analyze

Symbol:

Alx4

Name:

ALX homeobox 4

RGD ID:

12456859

Description:

ENCODES a protein that exhibits DNA binding (inferred); DNA-binding transcription activator activity, RNA polymerase II-specific (inferred); DNA-binding transcription factor activity (inferred); INVOLVED IN positive regulation of transcription by RNA polymerase II (ortholog); ASSOCIATED WITH Adenomatous Polyps (ortholog); bronchiolo-alveolar adenocarcinoma (ortholog); colorectal cancer (ortholog); FOUND IN nucleoplasm (inferred); nucleus (inferred); transcription regulator complex (inferred)

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

homeobox protein aristaless-like 4

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ALX4 (ALX homeobox 4)	NCBI	Ortholog
Mus musculus (house mouse):	Alx4 (aristaless-like homeobox 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):	Alx4 (ALX homeobox 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Alx4 (ALX homeobox 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ALX4 (ALX homeobox 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ALX4 (ALX homeobox 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ALX4 (ALX homeobox 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ALX4 (ALX homeobox 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Alx4 (ALX homeobox 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline

Latest Assembly:

SpeTri2.0 - Squirrel SpeTri2.0 Assembly

Position:

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	22,204,908 - 22,218,129 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936562	4,314,870 - 4,326,000 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936562	4,316,550 - 4,326,022 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Alx4	Squirrel	Adenomatous Polyps	severity	ISO	ALX4 (Homo sapiens)	9068941	DNA:altered methylation:plasma:	RGD	PMID:20140221 and REF_RGD_ID:153344541
Alx4	Squirrel	bronchiolo-alveolar adenocarcinoma	ameliorates	ISO	ALX4 (Homo sapiens)	9068941		RGD	PMID:24037716 and REF_RGD_ID:153344522
Alx4	Squirrel	colorectal cancer		ISO	ALX4 (Homo sapiens)	9068941	DNA:hypermethylation:serum:	RGD	PMID:17101318 more ...
Alx4	Squirrel	gastric adenocarcinoma	severity	ISO	ALX4 (Homo sapiens)	9068941		RGD	PMID:27895854 and REF_RGD_ID:153344544
Alx4	Squirrel	hepatocellular carcinoma		ISO	ALX4 (Homo sapiens)	9068941	mRNA and protein:decreased expression:liver	RGD	PMID:28081728 and REF_RGD_ID:153323329
Alx4	Squirrel	hepatocellular carcinoma	ameliorates	ISO	ALX4 (Homo sapiens)	9068941		RGD	PMID:31132711 and REF_RGD_ID:153323330
Alx4	Squirrel	hepatocellular carcinoma		ISO	Alx4 (Rattus norvegicus)	9068941	mRNA and protein:decreased expression:liver	RGD	PMID:31132711 and REF_RGD_ID:153323330
Alx4	Squirrel	lung adenocarcinoma	disease_progression	ISO	ALX4 (Homo sapiens)	9068941		RGD	PMID:18978557 and REF_RGD_ID:153350135
Alx4	Squirrel	lung cancer		ISO	ALX4 (Homo sapiens)	9068941	DNA:hypermethylation:CpG_island:	RGD	PMID:24037716 and REF_RGD_ID:153344522

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Alx4	Squirrel	Craniosynostosis 5		ISO	ALX4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Craniosynostosis 5 and susceptibility to	ClinVar	PMID:22829454 more ...
Alx4	Squirrel	frontonasal dysplasia 2		ISO	ALX4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Frontonasal dysplasia 2	ClinVar	PMID:19692347 more ...
Alx4	Squirrel	genetic disease		ISO	ALX4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:19692347 more ...
Alx4	Squirrel	intellectual disability		ISO	ALX4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar
Alx4	Squirrel	optic nerve glioma		ISO	ALX4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Optic nerve glioma	ClinVar	PMID:25741868
Alx4	Squirrel	parietal foramina		ISO	ALX4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Cranium bifidum occultum	ClinVar
Alx4	Squirrel	Parietal Foramina 2		ISO	ALX4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Parietal foramina 2	ClinVar	PMID:11106354 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Alx4	Squirrel	Craniofacial Abnormalities		ISO	ALX4 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:9847249
Alx4	Squirrel	craniosynostosis		ISO	ALX4 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD
Alx4	Squirrel	frontonasal dysplasia		ISO	ALX4 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD
Alx4	Squirrel	Lung Neoplasms		ISO	ALX4 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:24037716
Alx4	Squirrel	polydactyly		ISO	ALX4 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:9847249

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Alx4	Squirrel	Craniosynostosis 5		ISO	ALX4 (Homo sapiens)	7240710		OMIM
Alx4	Squirrel	frontonasal dysplasia 2		ISO	ALX4 (Homo sapiens)	7240710		OMIM
Alx4	Squirrel	Parietal Foramina 2		ISO	ALX4 (Homo sapiens)	7240710		OMIM

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Alx4	Squirrel	anterior/posterior pattern specification	acts_upstream_of_or_within	IEA	UniProtKB:O35137 and ensembl:ENSMUSP00000047962	150520179		Ensembl	GO_REF:0000107
Alx4	Squirrel	digestive tract development	acts_upstream_of_or_within	IEA	UniProtKB:O35137 and ensembl:ENSMUSP00000047962	150520179		Ensembl	GO_REF:0000107
Alx4	Squirrel	embryonic digit morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:O35137 and ensembl:ENSMUSP00000047962	150520179		Ensembl	GO_REF:0000107
Alx4	Squirrel	embryonic forelimb morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:O35137 and ensembl:ENSMUSP00000047962	150520179		Ensembl	GO_REF:0000107
Alx4	Squirrel	embryonic hindlimb morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:O35137 and ensembl:ENSMUSP00000047962	150520179		Ensembl	GO_REF:0000107
Alx4	Squirrel	embryonic skeletal system morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:O35137 and ensembl:ENSMUSP00000047962	150520179		Ensembl	GO_REF:0000107
Alx4	Squirrel	hair follicle development	involved_in	IEA	UniProtKB:Q9H161 and ensembl:ENSP00000498217	150520179		Ensembl	GO_REF:0000107
Alx4	Squirrel	limb morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:O35137 and ensembl:ENSMUSP00000047962	150520179		Ensembl	GO_REF:0000107
Alx4	Squirrel	muscle organ development	acts_upstream_of_or_within	IEA	UniProtKB:O35137 and ensembl:ENSMUSP00000047962	150520179		Ensembl	GO_REF:0000107
Alx4	Squirrel	pattern specification process	acts_upstream_of_or_within	IEA	UniProtKB:O35137 and ensembl:ENSMUSP00000047962	150520179		Ensembl	GO_REF:0000107
Alx4	Squirrel	positive regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	IEA	UniProtKB:O35137 and ensembl:ENSMUSP00000047962	150520179		Ensembl	GO_REF:0000107
Alx4	Squirrel	positive regulation of transcription by RNA polymerase II	involved_in	ISO	Alx4 (Mus musculus)	9068941	PMID:9847249	NTNU_SB	PMID:9847249
Alx4	Squirrel	post-embryonic development	acts_upstream_of_or_within	IEA	UniProtKB:O35137 and ensembl:ENSMUSP00000047962	150520179		Ensembl	GO_REF:0000107
Alx4	Squirrel	regulation of apoptotic process	acts_upstream_of_or_within	IEA	UniProtKB:O35137 and ensembl:ENSMUSP00000047962	150520179		Ensembl	GO_REF:0000107
Alx4	Squirrel	regulation of DNA-templated transcription	involved_in	IEA	InterPro:IPR017970	150520179		InterPro	GO_REF:0000002
Alx4	Squirrel	regulation of transcription by RNA polymerase II	involved_in	IEA	PANTHER:PTN001965393	150520179		TreeGrafter	GO_REF:0000118
Alx4	Squirrel	regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	IEA	UniProtKB:O35137 and ensembl:ENSMUSP00000047962	150520179		Ensembl	GO_REF:0000107
Alx4	Squirrel	roof of mouth development	acts_upstream_of_or_within	IEA	UniProtKB:O35137 and ensembl:ENSMUSP00000047962	150520179		Ensembl	GO_REF:0000107
Alx4	Squirrel	skeletal system morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:O35137 and ensembl:ENSMUSP00000047962	150520179		Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Alx4	Squirrel	nucleoplasm	located_in	IEA	UniProtKB:Q9H161 and ensembl:ENSP00000498217	150520179		Ensembl	GO_REF:0000107
Alx4	Squirrel	nucleus	located_in	IEA	UniRule:UR000401037	150520179		UniProt	GO_REF:0000104
Alx4	Squirrel	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	150520179		UniProt	GO_REF:0000043
Alx4	Squirrel	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	150520179		UniProt	GO_REF:0000044
Alx4	Squirrel	nucleus	located_in	IEA	UniProtKB:O35137 more ...	150520179		Ensembl	GO_REF:0000107
Alx4	Squirrel	transcription regulator complex	part_of	IEA	UniProtKB:O35137 and ensembl:ENSMUSP00000047962	150520179		Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Alx4	Squirrel	DNA binding	enables	IEA	UniRule:UR000401037	150520179		UniProt	GO_REF:0000104
Alx4	Squirrel	DNA binding	enables	IEA	InterPro:IPR001356	150520179		InterPro	GO_REF:0000002
Alx4	Squirrel	DNA binding	enables	IEA	UniProtKB-KW:KW-0238 and UniProtKB-KW:KW-0371	150520179		UniProt	GO_REF:0000043
Alx4	Squirrel	DNA-binding transcription activator activity, RNA polymerase II-specific	enables	IEA	PANTHER:PTN001965393	150520179		TreeGrafter	GO_REF:0000118
Alx4	Squirrel	DNA-binding transcription activator activity, RNA polymerase II-specific	enables	IEA	UniProtKB:O35137 and ensembl:ENSMUSP00000047962	150520179		Ensembl	GO_REF:0000107
Alx4	Squirrel	DNA-binding transcription factor activity	enables	IEA	UniProtKB:O35137 and ensembl:ENSMUSP00000047962	150520179		Ensembl	GO_REF:0000107
Alx4	Squirrel	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IEA	PANTHER:PTN001965393	150520179		TreeGrafter	GO_REF:0000118
Alx4	Squirrel	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IEA	InterPro:IPR017970	150520179		InterPro	GO_REF:0000002
Alx4	Squirrel	HMG box domain binding	enables	IEA	UniProtKB:O35137 and ensembl:ENSMUSP00000047962	150520179		Ensembl	GO_REF:0000107
Alx4	Squirrel	protein binding	enables	ISO	UniProtKB:Q08999	9068941	PMID:9786416	MGI	PMID:9786416
Alx4	Squirrel	protein binding	enables	ISO	PR:Q8C8B0	9068941	PMID:9847249	MGI	PMID:9847249
Alx4	Squirrel	protein binding	enables	ISO	PR:P27782	9068941	PMID:11696550	MGI	PMID:11696550
Alx4	Squirrel	protein binding	enables	ISO	UniProtKB:Q8NA54 and UniProtKB:Q9HBI0	9068941	PMID:32296183	IntAct	PMID:32296183
Alx4	Squirrel	RNA polymerase II transcription regulatory region sequence-specific DNA binding	enables	IEA	PANTHER:PTN001965393	150520179		TreeGrafter	GO_REF:0000118
Alx4	Squirrel	RNA polymerase II transcription regulatory region sequence-specific DNA binding	enables	IEA	UniProtKB:O35137 and ensembl:ENSMUSP00000047962	150520179		Ensembl	GO_REF:0000107
Alx4	Squirrel	sequence-specific DNA binding	enables	IEA	UniProtKB:O35137 and ensembl:ENSMUSP00000047962	150520179		Ensembl	GO_REF:0000107
Alx4	Squirrel	sequence-specific double-stranded DNA binding	enables	IEA	UniProtKB:Q9H161 and ensembl:ENSP00000498217	150520179		Ensembl	GO_REF:0000107

PMID:30032202

Alx4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	22,204,908 - 22,218,129 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936562	4,314,870 - 4,326,000 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936562	4,316,550 - 4,326,022 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ALX4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	44,260,440 - 44,310,139 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	44,260,440 - 44,310,139 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	44,281,990 - 44,331,689 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	44,242,734 - 44,288,292 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	44,242,733 - 44,288,292	NCBI
Celera	11	44,429,565 - 44,479,005 (-)	NCBI		Celera
Cytogenetic Map	11	p11.2	NCBI
HuRef	11	43,991,253 - 44,040,694 (-)	NCBI		HuRef
CHM1_1	11	44,281,300 - 44,330,733 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	44,415,783 - 44,465,465 (-)	NCBI		T2T-CHM13v2.0

Alx4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	93,472,779 - 93,511,686 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	93,472,729 - 93,511,684 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	93,642,434 - 93,681,341 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	93,642,384 - 93,681,339 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	93,482,591 - 93,521,496 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	93,443,273 - 93,478,775 (+)	NCBI		MGSCv36	mm8
Celera	2	95,046,101 - 95,085,009 (+)	NCBI		Celera
Cytogenetic Map	2	E1	NCBI
cM Map	2	51.62	NCBI

Alx4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	100,067,052 - 100,103,624 (+)	NCBI		GRCr8
mRatBN7.2	3	79,611,682 - 79,648,260 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	79,611,719 - 79,648,260 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	83,085,796 - 83,122,265 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	91,684,866 - 91,721,334 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	89,536,444 - 89,573,057 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	82,548,959 - 82,585,531 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	82,548,959 - 82,585,531 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	89,249,541 - 89,286,113 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	78,057,714 - 78,094,285 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	77,954,190 - 77,990,612 (+)	NCBI
Celera	3	78,814,063 - 78,850,575 (+)	NCBI		Celera
Cytogenetic Map	3	q31	NCBI

Alx4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955422	3,278,615 - 3,291,714 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955422	3,278,615 - 3,290,799 (+)	NCBI	ChiLan1.0	ChiLan1.0

ALX4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	46,474,416 - 46,524,451 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	46,464,895 - 46,530,312 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	44,219,865 - 44,269,597 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	44,714,503 - 44,729,758 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

ALX4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	44,922,042 - 44,967,557 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	44,922,150 - 44,967,550 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	43,590,411 - 43,635,910 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	45,583,479 - 45,629,082 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	45,583,532 - 45,629,081 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	45,066,662 - 45,112,191 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	44,620,210 - 44,665,671 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	45,356,336 - 45,401,930 (+)	NCBI		UU_Cfam_GSD_1.0

ALX4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	18,037,401 - 18,085,683 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	18,070,726 - 18,085,685 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	19,626,044 - 19,627,294 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ALX4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	21,051,413 - 21,099,159 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	21,051,580 - 21,097,605 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	118,279,875 - 118,329,166 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Alx4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624767	3,770,762 - 3,805,323 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624767	3,770,755 - 3,808,511 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	XM_005330087	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAESOR010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSSTOT00000021489 ⟹ ENSSTOP00000022296

Type:

CODING

Position:

Squirrel Assembly	Chr	Position (strand)	Source
SpeTri2.0 Ensembl	NW_004936562	4,314,870 - 4,326,000 (+)	Ensembl

RefSeq Acc Id:

XM_005330087 ⟹ XP_005330144

Type:

CODING

Position:

Squirrel Assembly	Chr	Position (strand)	Source
HiC_Itri_2	NW_024404947	22,204,908 - 22,218,129 (+)	NCBI
SpeTri2.0	NW_004936562	4,316,550 - 4,326,022 (+)	NCBI

Sequence:

show sequence

ATGGCCTCCAAAGCTGTCCCCAGACCTACTCTGGGCAGTCACCTCTGCCCGATTTTCCTCAATGCCATGGAGACAGCGGGGGACAGAGCCAAAGAGAGCTCCCTGGGGGAGCCGGAGTTGCCCCCCGA
CCCTGACGCCGTGGGCATGGACAGCAGCTACCTCAGTGTGAAGGAGGCTGGGGTCAAGGGGCCCCAGGACCGGGCCGGCTCCGAGCTCCCCAGCCCCCTGGAGAAGGCGGACTCGGAGAGCAACAAGG
GCAAGAAGCGGCGGAACCGCACCACCTTCACCAGCTACCAGCTGGAGGAGCTGGAGAAGGTCTTCCAGAAGACGCACTACCCCGACGTGTACGCGCGCGAGCAGCTGGCCATGAGGACCGACCTCACC
GAGGCCCGCGTGCAGGTCTGGTTCCAGAACCGGAGGGCCAAGTGGAGGAAGAGGGAGCGCTTCGGGCAGATGCAGCAGGTGCGGACCCACTTCTCCACGGCCTACGAGCTGCCCCTGCTCACCCGGGC
TGAGAACTACGCGCAGATTCAGAACCCGTCCTGGATCAGCAACAACGGGGCTGCCTCGCCGGTGCCGGCCTGTGTGGTCCCCTGTGACCCGGTGCCTGCCTGCATGTCCCCTCACGCCCACCCCCCTG
GCTCTGGGGCCAGCGGTGTCACCGACTTCCTGAGTGTCTCTGGGGCTGGCAGCCACGTGGGCCAGACGCACATGGGCAGCCTGTTCGGAGCGGCTGGCCTCAGCCCGGGCCTCAACGGCTATGAGCTC
AATGGCGAGCCGGACCGCAAGACCTCGAGCATCGCGGCGCTGCGCATGAAGGCCAAGGAGCACAGTGCGGCCATCTCCTGGGCCACATGACAGGGCCCCTCCCGTCCGGCCC

hide sequence


Protein RefSeqs	XP_005330144	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSSTOP00000022296.2
GenBank Protein	KAG3285432	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

XP_005330144 ⟸ XM_005330087

- Sequence:

show sequence

MASKAVPRPTLGSHLCPIFLNAMETAGDRAKESSLGEPELPPDPDAVGMDSSYLSVKEAGVKGPQDRAGSELPSPLEKADSESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLT
EARVQVWFQNRRAKWRKRERFGQMQQVRTHFSTAYELPLLTRAENYAQIQNPSWISNNGAASPVPACVVPCDPVPACMSPHAHPPGSGASGVTDFLSVSGAGSHVGQTHMGSLFGAAGLSPGLNGYEL
NGEPDRKTSSIAALRMKAKEHSAAISWAT

hide sequence

Ensembl Acc Id:

ENSSTOP00000022296 ⟸ ENSSTOT00000021489

Protein Domains

Homeobox OAR

Database	Acc Id	Source(s)
Ensembl Genes	ENSSTOG00000029078	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSSTOT00000021489.2	UniProtKB/TrEMBL
Gene3D-CATH	Homeodomain-like	UniProtKB/TrEMBL
InterPro	Homeobox-like_sf	UniProtKB/TrEMBL
	Homeobox_CS	UniProtKB/TrEMBL
	Homeobox_dom	UniProtKB/TrEMBL
	OAR_dom	UniProtKB/TrEMBL
	Paired_Homeobox_TFs	UniProtKB/TrEMBL
NCBI Gene	Alx4	ENTREZGENE
PANTHER	HOMEOBOX PROTEIN ARISTALESS	UniProtKB/TrEMBL
	PTHR24329:SF322	UniProtKB/TrEMBL
Pfam	Homeodomain	UniProtKB/TrEMBL
	OAR	UniProtKB/TrEMBL
PROSITE	HOMEOBOX_1	UniProtKB/TrEMBL
	HOMEOBOX_2	UniProtKB/TrEMBL
	OAR	UniProtKB/TrEMBL
SMART	HOX	UniProtKB/TrEMBL
Superfamily-SCOP	SSF46689	UniProtKB/TrEMBL
UniProt	I3ND49_ICTTR	UniProtKB/TrEMBL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM