Advanced Search (OLGA)

Gene: Alx4 (ALX homeobox 4) Rattus norvegicus

Analyze

Symbol:

Alx4

Name:

ALX homeobox 4

RGD ID:

1310201

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific; HMG box domain binding activity; and RNA polymerase II transcription regulatory region sequence-specific DNA binding activity. Predicted to be involved in hair follicle development and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including embryonic limb morphogenesis; embryonic skeletal system morphogenesis; and positive regulation of transcription by RNA polymerase II. Predicted to be located in nucleoplasm. Predicted to be part of transcription regulator complex. Biomarker of hepatocellular carcinoma. Human ortholog(s) of this gene implicated in craniosynostosis; frontonasal dysplasia 2; gastrointestinal system cancer (multiple); lung cancer (multiple); and parietal foramina. Orthologous to human ALX4 (ALX homeobox 4); INTERACTS WITH alpha-Zearalanol; atrazine; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

aristaless 4; aristaless-like homeobox 4; homeobox protein aristaless-like 4; LOC296511

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ALX4 (ALX homeobox 4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Alx4 (aristaless-like homeobox 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Alx4 (ALX homeobox 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ALX4 (ALX homeobox 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ALX4 (ALX homeobox 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Alx4 (ALX homeobox 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ALX4 (ALX homeobox 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ALX4 (ALX homeobox 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Alx4 (ALX homeobox 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ALX4 (ALX homeobox 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Alx4 (aristaless-like homeobox 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	alx4a (ALX homeobox 4a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	alx4b (ALX homeobox 4b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	alr-1	Alliance	DIOPT (OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Pph13	Alliance	DIOPT (PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	alx4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	100,067,052 - 100,103,624 (+)	NCBI		GRCr8
mRatBN7.2	3	79,611,682 - 79,648,260 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	79,611,719 - 79,648,260 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	83,085,796 - 83,122,265 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	91,684,866 - 91,721,334 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	89,536,444 - 89,573,057 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	82,548,959 - 82,585,531 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	82,548,959 - 82,585,531 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	89,249,541 - 89,286,113 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	78,057,714 - 78,094,285 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	77,954,190 - 77,990,612 (+)	NCBI
Celera	3	78,814,063 - 78,850,575 (+)	NCBI		Celera
Cytogenetic Map	3	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Adenomatous Polyps (ISO)

bronchiolo-alveolar adenocarcinoma (ISO)

colorectal cancer (ISO)

Craniofacial Abnormalities (ISO)

craniosynostosis (ISO)

Craniosynostosis 5 (ISO)

frontonasal dysplasia (ISO)

frontonasal dysplasia 2 (ISO)

gastric adenocarcinoma (ISO)

genetic disease (ISO)

hepatocellular carcinoma (IEP,ISO)

intellectual disability (ISO)

lung adenocarcinoma (ISO)

lung cancer (ISO)

Lung Neoplasms (ISO)

optic nerve glioma (ISO)

parietal foramina (ISO,ISS)

Parietal Foramina 2 (ISO)

polydactyly (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

cadmium atom (ISO)

copper atom (EXP)

copper(0) (EXP)

diarsenic trioxide (ISO)

diazinon (ISO)

folic acid (ISO)

fonofos (ISO)

formaldehyde (ISO)

gentamycin (EXP)

iron dichloride (ISO)

methapyrilene (ISO)

methoxychlor (EXP)

mono(2-ethylhexyl) phthalate (ISO)

paracetamol (EXP,ISO)

parathion (ISO)

perfluorooctanoic acid (EXP)

terbufos (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triclosan (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anterior/posterior pattern specification (IEA,ISO)

biological_process (ND)

digestive tract development (IEA,ISO)

embryonic digit morphogenesis (IEA,ISO)

embryonic forelimb morphogenesis (IEA,ISO)

embryonic hindlimb morphogenesis (IEA,ISO)

embryonic skeletal system morphogenesis (IEA,ISO)

hair follicle development (IEA,ISO)

limb morphogenesis (IEA,ISO)

muscle organ development (IEA,ISO)

pattern specification process (IEA,ISO)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

post-embryonic development (IEA,ISO)

regulation of apoptotic process (IEA,ISO)

regulation of DNA-templated transcription (IEA)

regulation of transcription by RNA polymerase II (IBA,IEA,ISO)

roof of mouth development (IEA,ISO)

skeletal system morphogenesis (IEA,ISO)

Cellular Component

nucleoplasm (IEA,ISO)

nucleus (IEA,ISO)

transcription regulator complex (IEA,ISO)

Molecular Function

DNA binding (IEA)

DNA-binding transcription activator activity, RNA polymerase II-specific (IBA,IEA,ISO)

DNA-binding transcription factor activity (IEA,ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IEA)

HMG box domain binding (IEA,ISO)

protein binding (ISO)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (IBA,IEA,ISO)

sequence-specific DNA binding (IEA,ISO)

sequence-specific double-stranded DNA binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	AZGP1 autoantibody predicts survival and histone deacetylase inhibitors increase expression in lung adenocarcinoma.	Albertus DL, etal., J Thorac Oncol. 2008 Nov;3(11):1236-44. doi: 10.1097/JTO.0b013e318189f5ec.
2.	Aristaless-like homeobox-4 gene methylation is a potential marker for colorectal adenocarcinomas.	Ebert MP, etal., Gastroenterology. 2006 Nov;131(5):1418-30. doi: 10.1053/j.gastro.2006.08.034. Epub 2006 Aug 18.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Differential expression of aristaless-like homeobox 4: a potential marker for gastric adenocarcinoma.	Ghasemvand F, etal., Gastroenterol Hepatol Bed Bench. 2016 Fall;9(4):286-294.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	Epigenetic silencing of Aristaless-like homeobox-4, a potential tumor suppressor gene associated with lung cancer.	Liu WB, etal., Int J Cancer. 2014 Mar 15;134(6):1311-22. doi: 10.1002/ijc.28472. Epub 2013 Nov 11.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Comprehensive gene review and curation	RGD comprehensive gene curation
12.	Methylation pattern of ALX4 gene promoter as a potential biomarker for blood-based early detection of colorectal cancer.	Salehi R, etal., Adv Biomed Res. 2015 Nov 30;4:252. doi: 10.4103/2277-9175.170677. eCollection 2015.
13.	Overexpression of Aristaless-Like Homeobox-4 Inhibits Proliferation, Invasion, and EMT in Hepatocellular Carcinoma Cells.	Shi Y, etal., Oncol Res. 2017 Jan 2;25(1):11-18. doi: 10.3727/096504016X14685034103833.
14.	Performance of epigenetic markers SEPT9 and ALX4 in plasma for detection of colorectal precancerous lesions.	Tänzer M, etal., PLoS One. 2010 Feb 4;5(2):e9061. doi: 10.1371/journal.pone.0009061.
15.	Epigenetic silencing of ALX4 regulates microcystin-LR induced hepatocellular carcinoma through the P53 pathway.	Zhao J, etal., Sci Total Environ. 2019 Sep 15;683:317-330. doi: 10.1016/j.scitotenv.2019.05.144. Epub 2019 May 15.

Additional References at PubMed

PMID:9268572	PMID:9272948	PMID:9374397	PMID:9786416	PMID:9847249	PMID:11641221	PMID:11696550	PMID:15728667	PMID:16582099	PMID:19692347

Genomics

Comparative Map Data

Alx4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	100,067,052 - 100,103,624 (+)	NCBI		GRCr8
mRatBN7.2	3	79,611,682 - 79,648,260 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	79,611,719 - 79,648,260 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	83,085,796 - 83,122,265 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	91,684,866 - 91,721,334 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	89,536,444 - 89,573,057 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	82,548,959 - 82,585,531 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	82,548,959 - 82,585,531 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	89,249,541 - 89,286,113 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	78,057,714 - 78,094,285 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	77,954,190 - 77,990,612 (+)	NCBI
Celera	3	78,814,063 - 78,850,575 (+)	NCBI		Celera
Cytogenetic Map	3	q31	NCBI

ALX4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	44,260,440 - 44,310,139 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	44,260,440 - 44,310,139 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	44,281,990 - 44,331,689 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	44,242,734 - 44,288,292 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	44,242,733 - 44,288,292	NCBI
Celera	11	44,429,565 - 44,479,005 (-)	NCBI		Celera
Cytogenetic Map	11	p11.2	NCBI
HuRef	11	43,991,253 - 44,040,694 (-)	NCBI		HuRef
CHM1_1	11	44,281,300 - 44,330,733 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	44,415,783 - 44,465,465 (-)	NCBI		T2T-CHM13v2.0

Alx4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	93,472,779 - 93,511,686 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	93,472,729 - 93,511,684 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	93,642,434 - 93,681,341 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	93,642,384 - 93,681,339 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	93,482,591 - 93,521,496 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	93,443,273 - 93,478,775 (+)	NCBI		MGSCv36	mm8
Celera	2	95,046,101 - 95,085,009 (+)	NCBI		Celera
Cytogenetic Map	2	E1	NCBI
cM Map	2	51.62	NCBI

Alx4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955422	3,278,615 - 3,291,714 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955422	3,278,615 - 3,290,799 (+)	NCBI	ChiLan1.0	ChiLan1.0

ALX4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	46,474,416 - 46,524,451 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	46,464,895 - 46,530,312 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	44,219,865 - 44,269,597 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	44,714,503 - 44,729,758 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

ALX4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	44,922,042 - 44,967,557 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	44,922,150 - 44,967,550 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	43,590,411 - 43,635,910 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	45,583,479 - 45,629,082 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	45,583,532 - 45,629,081 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	45,066,662 - 45,112,191 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	44,620,210 - 44,665,671 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	45,356,336 - 45,401,930 (+)	NCBI		UU_Cfam_GSD_1.0

Alx4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	22,204,908 - 22,218,129 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936562	4,314,870 - 4,326,000 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936562	4,316,550 - 4,326,022 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ALX4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	18,037,401 - 18,085,683 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	18,070,726 - 18,085,685 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	19,626,044 - 19,627,294 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ALX4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	21,051,413 - 21,099,159 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	21,051,580 - 21,097,605 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	118,279,875 - 118,329,166 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Alx4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624767	3,770,762 - 3,805,323 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624767	3,770,755 - 3,808,511 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Alx4
282 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	76
Count of miRNA genes:	60
Interacting mature miRNAs:	69
Transcripts:	ENSRNOT00000000009
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	43827364	90905114	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	53184692	89878207	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	39454637	89115240	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	89115240	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	73376539	118376539	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	53781112	91609953	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	38517803	83517803	Rat
631200	Cm25	Cardiac mass QTL 25	4.8	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	3	61134348	89115068	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	30356773	98535386	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	41874578	104104347	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	45	111	54	51	22	25	22	6	166	93	91	34	57	29

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106553	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000009 ⟹ ENSRNOP00000000009

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	79,611,719 - 79,648,260 (+)	Ensembl
Rnor_6.0 Ensembl	3	82,548,959 - 82,585,531 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114813 ⟹ ENSRNOP00000090110

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	79,611,719 - 79,645,833 (+)	Ensembl

RefSeq Acc Id:

NM_001106553 ⟹ NP_001100023

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	100,067,052 - 100,103,624 (+)	NCBI
mRatBN7.2	3	79,611,682 - 79,648,260 (+)	NCBI
Rnor_6.0	3	82,548,959 - 82,585,531 (+)	NCBI
Rnor_5.0	3	89,249,541 - 89,286,113 (+)	NCBI
RGSC_v3.4	3	78,057,714 - 78,094,285 (+)	RGD
Celera	3	78,814,063 - 78,850,575 (+)	RGD

Sequence:

show sequence

AGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGACAGGCAGGCCGGGCG
CAGAGCACTGCCACCGCCTCCTTGGCTCCCCAACTCCCAGCCAAGGCGCGCGGTGGCGTCCTCG
CGCCCTCGCCGGCGCCCCCGCCCCGTCACCCGCGCAGGCCAGGCATGAACGCTGAGACTTGCGT
CTCTTACTGCGAGTCGCCGGCCACTGCCATGGACGCCTACTACAGCCCGGTGTCGCAGAGCCGG
GAAGGTTCGTCGCCTTTTAGGGGATTCCCAGGAGGCGACAAGTTCGGTACAACTTTTCTGTCGG
CCGCGGCCAAAGGACAGGGATTCGGGGACGCCAAGGGCCGGGCCCGCTACGGCGCGGGGCAGCA
GGACCTGGCGGCACCGCTGGAAAGCAACGCTGGGGCGCGGGGATCCTTTAACAAGTTCCAGCCG
CAGCCGCCCACCCCGCAGCCGCCGCCCGCTCCGCCCGCGCCGCCTGCGCATCTCTACTTGCAGA
GGGGCGCCTGCAAAACGCCCCCGGACGGCAGCCTCAAGCTCCAGGAGGGCAGCGGCGGCCACAA
CGCGGCCTTGCAGGTCCCCTGCTACGCCAAAGAGAGCAACCTGGGTGAGCCAGAGCTGCCCCCT
GACTCTGAGCCCGTGGGCATGGACAACAGCTACCTCAGTGTGAAGGAGACAGGGGCCAAGGGGC
CCCAAGACCGGGCTGGCGCTGAAATACCAAGCCCCCTGGAAAAAACCGACTCTGAGAGTAGCAA
AGGCAAGAAGCGGCGGAACAGAACCACCTTCACGAGCTACCAGCTGGAGGAGCTGGAGAAAGTC
TTCCAGAAGACACACTACCCTGATGTGTATGCCCGGGAGCAGCTGGCTATGAGGACCGACCTCA
CCGAGGCCCGCGTGCAGGTTTGGTTCCAGAACCGGAGGGCCAAGTGGCGAAAGAGGGAGCGCTT
TGGGCAGATGCAGCAGGTCCGAACCCACTTCTCCACGGCCTATGAGTTGCCCCTCCTCACCCGA
GCCGAGAACTATGCCCAGATTCAGAACCCGTCCTGGATTGGCAACAATGGGGCTGCCTCGCCAG
TGCCAGCCTGTGTGGTCCCCTGTGACCCAGTGCCTGCCTGCATGTCCCCTCACGCTCACCCTCC
TGGCTCTGGAGCCAGCAGCGTCTCCGACTTCTTGAGTGTCTCTGGAGCTGGCAGTCACGTGGGC
CAGACACACATGGGCAGCCTGTTTGGAGCAGCTGGCATCAGTCCGGGCCTCAACGGCTACGAGA
TGAATGGCGAGCCAGACCGCAAGACCTCGAGTATTGCTGCCCTGCGCATGAAGGCCAAGGAGCA
CAGTGCAGCCATCTCTTGGGCCACATGACAGAGCCCCTCCTGCCACTCCTGATGTCATCCCCTT
CCCTGGGGCCCTGGCCATGCCCCTGTTTTCCAGGCCCCAGCTTCCCACTTGACTTTCCTCTTAG
GAACCTGGCCTGGCCCAGGGGCCTGGCCCTCAGCACTTTCAGCCACCCCAAGTCTGAGACCCCA
GGGACTGCTGGGAGGGAGGGGGCGAGGGTAGGCTCTTGCCCCTCCCTGGCTCTGAGGTCATGAC
CCCTGCTCCCTGCCAAAGGCAGTGGAGAAAGCCAGGTGGCCCTGTGTGTAGCTTTGCATCACGT
AAGCTGAGGCCCTGTCTCTCTTCCTGTTCTTTTGCCCCTTCCATTTGACTTGAGTCAAAGTTAG
GCTCCCTTCCAGACCTAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001100023	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL79594	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000000009
	ENSRNOP00000000009.4
	ENSRNOP00000090110.1

RefSeq Acc Id:

NP_001100023 ⟸ NM_001106553

- UniProtKB:

D3ZEM1 (UniProtKB/TrEMBL), A6HNJ3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNAETCVSYCESPATAMDAYYSPVSQSREGSSPFRGFPGGDKFGTTFLSAAAKGQGFGDAKGRA
RYGAGQQDLAAPLESNAGARGSFNKFQPQPPTPQPPPAPPAPPAHLYLQRGACKTPPDGSLKLQ
EGSGGHNAALQVPCYAKESNLGEPELPPDSEPVGMDNSYLSVKETGAKGPQDRAGAEIPSPLEK
TDSESSKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAK
WRKRERFGQMQQVRTHFSTAYELPLLTRAENYAQIQNPSWIGNNGAASPVPACVVPCDPVPACM
SPHAHPPGSGASSVSDFLSVSGAGSHVGQTHMGSLFGAAGISPGLNGYEMNGEPDRKTSSIAAL
RMKAKEHSAAISWAT

hide sequence

Ensembl Acc Id:

ENSRNOP00000000009 ⟸ ENSRNOT00000000009

Ensembl Acc Id:

ENSRNOP00000090110 ⟸ ENSRNOT00000114813

Protein Domains

Homeobox OAR

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZEM1-F1-model_v2	AlphaFold	D3ZEM1	1-399	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310201	AgrOrtholog
BioCyc Gene	G2FUF-48667	BioCyc
Ensembl Genes	ENSRNOG00000000008	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000000009	ENTREZGENE
	ENSRNOT00000000009.6	UniProtKB/TrEMBL
	ENSRNOT00000114813.1	UniProtKB/TrEMBL
Gene3D-CATH	Homeodomain-like	UniProtKB/TrEMBL
InterPro	Homeobox	UniProtKB/TrEMBL
	Homeobox_CS	UniProtKB/TrEMBL
	Homeodomain-like	UniProtKB/TrEMBL
	OAR_dom	UniProtKB/TrEMBL
	Paired_Homeobox_TFs	UniProtKB/TrEMBL
KEGG Report	rno:296511	UniProtKB/TrEMBL
NCBI Gene	296511	ENTREZGENE
PANTHER	HOMEOBOX PROTEIN ARISTALESS	UniProtKB/TrEMBL
	PTHR24329:SF322	UniProtKB/TrEMBL
Pfam	Homeobox	UniProtKB/TrEMBL
	OAR	UniProtKB/TrEMBL
PhenoGen	Alx4	PhenoGen
PROSITE	HOMEOBOX_1	UniProtKB/TrEMBL
	HOMEOBOX_2	UniProtKB/TrEMBL
	OAR	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000000008	RatGTEx
SMART	HOX	UniProtKB/TrEMBL
Superfamily-SCOP	Homeodomain_like	UniProtKB/TrEMBL
UniProt	A0A8I6AD61_RAT	UniProtKB/TrEMBL
	A6HNJ3	ENTREZGENE, UniProtKB/TrEMBL
	D3ZEM1	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2010-03-11	Alx4	ALX homeobox 4	Alx4	aristaless-like homeobox 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-26	Alx4	aristaless-like homeobox 4	Alx4	aristaless 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Alx4	aristaless 4	Alx4_predicted	aristaless 4 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Alx4_predicted	aristaless 4 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM