Symbol:
P2ry1
Name:
purinergic receptor P2Y, G-protein coupled 1
RGD ID:
11043
MGI Page
MGI
Description:
Predicted to enable several functions, including A1 adenosine receptor binding activity; G protein-coupled purinergic nucleotide receptor activity; and adenyl ribonucleotide binding activity. Acts upstream of or within positive regulation of monoatomic ion transport. Located in plasma membrane. Is expressed in several structures, including alimentary system; brain; genitourinary system; integumental system; and liver and biliary system. Orthologous to human P2RY1 (purinergic receptor P2Y1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
ADP receptor; ATP receptor; P2Y; P2Y purinoceptor 1; P2Y1; P2Y1 receptor; P2y1r
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
P2RY1 (purinergic receptor P2Y1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
P2ry1 (purinergic receptor P2Y1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
P2ry1 (purinergic receptor P2Y1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
P2RY1 (purinergic receptor P2Y1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
P2RY1 (purinergic receptor P2Y1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
P2ry1 (purinergic receptor P2Y1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
P2RY1 (purinergic receptor P2Y1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
P2RY1 (purinergic receptor P2Y1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
P2ry1 (purinergic receptor P2Y1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
P2ry1 (purinergic receptor P2Y1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
P2RY1 (purinergic receptor P2Y1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
p2ry1 (purinergic receptor P2Y1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Xenopus tropicalis (tropical clawed frog):
p2ry1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 60,910,206 - 60,916,403 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 60,910,216 - 60,916,403 (+) Ensembl GRCm39 Ensembl GRCm38 3 61,002,785 - 61,008,982 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 61,002,795 - 61,008,982 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 60,806,717 - 60,812,901 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 61,090,724 - 61,096,908 (+) NCBI MGSCv36 mm8 Celera 3 60,703,955 - 60,710,141 (+) NCBI Celera Cytogenetic Map 3 E1 NCBI cM Map 3 29.24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
P2ry1 Mouse (+)-schisandrin B multiple interactions ISO P2ry1 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of P2RY1 mRNA] CTD PMID:31150632 P2ry1 Mouse 1,2-dichloroethane decreases expression EXP 6480464 ethylene dichloride results in decreased expression of P2RY1 mRNA CTD PMID:28960355 P2ry1 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of P2RY1 mRNA CTD PMID:22206623 P2ry1 Mouse 17beta-estradiol multiple interactions ISO P2ry1 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of P2RY1 mRNA CTD PMID:26496021 P2ry1 Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of P2RY1 mRNA CTD PMID:39298647 P2ry1 Mouse 17beta-estradiol multiple interactions ISO P2RY1 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of P2RY1 mRNA CTD PMID:30165855 P2ry1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO P2ry1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of P2RY1 mRNA CTD PMID:21215274 and PMID:33387578 P2ry1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of P2RY1 mRNA CTD PMID:28922406 P2ry1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of P2RY1 mRNA CTD PMID:26377647 P2ry1 Mouse 2,4,6-trinitrobenzenesulfonic acid increases expression ISO P2ry1 (Rattus norvegicus) 6480464 Trinitrobenzenesulfonic Acid results in increased expression of P2RY1 mRNA CTD PMID:23537331 P2ry1 Mouse 2,6-dinitrotoluene affects expression ISO P2ry1 (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of P2RY1 mRNA CTD PMID:21346803 P2ry1 Mouse 3'-O-(4-Benzoyl)benzoyl ATP multiple interactions ISO P2RY1 (Homo sapiens) 6480464 P2RY1 protein promotes the reaction [NAD inhibits the reaction [3'-O-(4-benzoyl)benzoyladenosine 5'-triphosphate results in increased secretion of IL1B protein]] CTD PMID:29642561 P2ry1 Mouse 3'-phospho-5'-adenylyl sulfate decreases activity ISO P2RY1 (Homo sapiens) 6480464 Phosphoadenosine Phosphosulfate results in decreased activity of P2RY1 protein CTD PMID:22273509 P2ry1 Mouse 3,3',4,4'-tetrachlorobiphenyl multiple interactions EXP 6480464 3 more ... CTD PMID:19467301 P2ry1 Mouse 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions ISO P2RY1 (Homo sapiens) 6480464 bisindolylmaleimide I inhibits the reaction [P2RY1 protein results in increased phosphorylation of and results in increased activity of AKT1 protein] CTD PMID:16236484 P2ry1 Mouse 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions ISO P2ry1 (Rattus norvegicus) 6480464 bisindolylmaleimide I inhibits the reaction [P2RY1 protein affects the reaction [Nucleotides results in increased phosphorylation of and results in increased activity of MAPK1 protein]] and bisindolylmaleimide I inhibits the reaction [P2RY1 protein affects the reaction [Nucleotides results in increased phosphorylation of and results in increased activity of MAPK3 protein]] CTD PMID:17620283 P2ry1 Mouse 3-methylcholanthrene multiple interactions EXP 6480464 [Methylcholanthrene co-treated with Tetradecanoylphorbol Acetate] results in increased expression of P2RY1 mRNA CTD PMID:23519560 P2ry1 Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of P2RY1 mRNA CTD PMID:39298647 P2ry1 Mouse 4-hydroxyphenyl retinamide decreases expression EXP 6480464 Fenretinide results in decreased expression of P2RY1 mRNA CTD PMID:28973697 P2ry1 Mouse 5-bromo-2'-deoxyuridine multiple interactions EXP 6480464 [Bromodeoxyuridine co-treated with furan] affects the expression of P2RY1 mRNA CTD PMID:24910943 P2ry1 Mouse 6-propyl-2-thiouracil decreases expression ISO P2ry1 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of P2RY1 mRNA CTD PMID:24780913 more ... P2ry1 Mouse acetamide decreases expression ISO P2ry1 (Rattus norvegicus) 6480464 acetamide results in decreased expression of P2RY1 mRNA CTD PMID:31881176 P2ry1 Mouse acetylsalicylic acid decreases response to substance ISO P2RY1 (Homo sapiens) 6480464 P2RY1 polymorphism results in decreased susceptibility to Aspirin and P2RY1 SNP results in decreased susceptibility to Aspirin CTD PMID:15757620 and PMID:21429568 P2ry1 Mouse acetylsalicylic acid affects response to substance ISO P2RY1 (Homo sapiens) 6480464 P2RY1 affects the susceptibility to Aspirin CTD PMID:17559347 P2ry1 Mouse acrolein affects expression ISO P2ry1 (Rattus norvegicus) 6480464 Acrolein affects the expression of P2RY1 mRNA CTD PMID:38090360 P2ry1 Mouse acrylamide affects expression ISO P2ry1 (Rattus norvegicus) 6480464 Acrylamide affects the expression of P2RY1 mRNA CTD PMID:28959563 P2ry1 Mouse aflatoxin B1 decreases methylation ISO P2RY1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of P2RY1 gene CTD PMID:27153756 P2ry1 Mouse amitrole decreases expression ISO P2ry1 (Rattus norvegicus) 6480464 Amitrole results in decreased expression of P2RY1 mRNA CTD PMID:30047161 P2ry1 Mouse ammonium chloride affects expression ISO P2ry1 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of P2RY1 mRNA CTD PMID:16483693 P2ry1 Mouse arsenite(3-) increases methylation ISO P2RY1 (Homo sapiens) 6480464 arsenite results in increased methylation of P2RY1 promoter CTD PMID:23974009 P2ry1 Mouse ATP multiple interactions ISO P2RY1 (Homo sapiens) 6480464 [Adenosine Triphosphate binds to and results in increased activity of P2RY1 protein] which results in increased abundance of Calcium more ... CTD PMID:12694404 and PMID:22129738 P2ry1 Mouse ATP multiple interactions ISO P2ry1 (Rattus norvegicus) 6480464 [N(6)-methyl-2'-deoxyadenosine 3' and 5'-diphosphate binds to and results in decreased activity of P2RY1 protein] inhibits the reaction [Adenosine Triphosphate results in increased uptake of Calcium] CTD PMID:16973929 P2ry1 Mouse ATP affects activity EXP 6480464 Adenosine Triphosphate affects the activity of P2RY1 protein CTD PMID:15243297 P2ry1 Mouse avobenzone decreases expression ISO P2RY1 (Homo sapiens) 6480464 avobenzone results in decreased expression of P2RY1 mRNA CTD PMID:31016361 P2ry1 Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of P2RY1 mRNA CTD PMID:22228805 P2ry1 Mouse benzo[a]pyrene affects methylation ISO P2RY1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of P2RY1 exon CTD PMID:27901495 P2ry1 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of P2RY1 mRNA CTD PMID:23735875 P2ry1 Mouse bis(2-ethylhexyl) phthalate multiple interactions ISO P2RY1 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of P2RY1 gene CTD PMID:33872906 P2ry1 Mouse bisphenol A multiple interactions ISO P2ry1 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of P2RY1 mRNA and [bisphenol A co-treated with Testosterone] results in decreased expression of P2RY1 mRNA CTD PMID:26496021 P2ry1 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of P2RY1 mRNA CTD PMID:32156529 P2ry1 Mouse bisphenol A increases expression ISO P2ry1 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of P2RY1 mRNA CTD PMID:34947998 P2ry1 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of P2RY1 mRNA CTD PMID:25594700 P2ry1 Mouse bisphenol A decreases expression ISO P2ry1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of P2RY1 mRNA CTD PMID:25181051 and PMID:30816183 P2ry1 Mouse butan-1-ol multiple interactions ISO P2RY1 (Homo sapiens) 6480464 1-Butanol inhibits the reaction [P2RY1 protein results in increased phosphorylation of and results in increased activity of AKT1 protein] CTD PMID:16236484 P2ry1 Mouse butan-1-ol multiple interactions ISO P2ry1 (Rattus norvegicus) 6480464 1-Butanol inhibits the reaction [P2RY1 protein affects the reaction [Nucleotides results in increased phosphorylation of and results in increased activity of MAPK1 protein]] and 1-Butanol inhibits the reaction [P2RY1 protein affects the reaction [Nucleotides results in increased phosphorylation of and results in increased activity of MAPK3 protein]] CTD PMID:17620283 P2ry1 Mouse butanal increases expression ISO P2RY1 (Homo sapiens) 6480464 butyraldehyde results in increased expression of P2RY1 mRNA CTD PMID:26079696 P2ry1 Mouse calcium atom multiple interactions ISO P2RY1 (Homo sapiens) 6480464 [Adenosine Triphosphate binds to and results in increased activity of P2RY1 protein] which results in increased abundance of Calcium more ... CTD PMID:12694404 and PMID:16236484 P2ry1 Mouse calcium atom multiple interactions ISO P2ry1 (Rattus norvegicus) 6480464 [N(6)-methyl-2'-deoxyadenosine 3' and 5'-diphosphate binds to and results in decreased activity of P2RY1 protein] inhibits the reaction [Adenosine Triphosphate results in increased uptake of Calcium] CTD PMID:16973929 P2ry1 Mouse calcium(0) multiple interactions ISO P2RY1 (Homo sapiens) 6480464 [Adenosine Triphosphate binds to and results in increased activity of P2RY1 protein] which results in increased abundance of Calcium more ... CTD PMID:12694404 and PMID:16236484 P2ry1 Mouse calcium(0) multiple interactions ISO P2ry1 (Rattus norvegicus) 6480464 [N(6)-methyl-2'-deoxyadenosine 3' and 5'-diphosphate binds to and results in decreased activity of P2RY1 protein] inhibits the reaction [Adenosine Triphosphate results in increased uptake of Calcium] CTD PMID:16973929 P2ry1 Mouse carbon nanotube affects expression ISO P2RY1 (Homo sapiens) 6480464 Nanotubes and Carbon affects the expression of P2RY1 mRNA CTD PMID:25511174 P2ry1 Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes more ... CTD PMID:25620056 P2ry1 Mouse cisplatin increases expression ISO P2RY1 (Homo sapiens) 6480464 Cisplatin results in increased expression of P2RY1 mRNA CTD PMID:27392435 P2ry1 Mouse cobalt dichloride decreases expression ISO P2ry1 (Rattus norvegicus) 6480464 cobaltous chloride results in decreased expression of P2RY1 mRNA CTD PMID:24386269 P2ry1 Mouse decabromodiphenyl ether decreases expression ISO P2ry1 (Rattus norvegicus) 6480464 decabromobiphenyl ether results in decreased expression of P2RY1 mRNA CTD PMID:23914054 P2ry1 Mouse dibenz[a,h]anthracene increases expression EXP 6480464 1 more ... CTD PMID:26377693 P2ry1 Mouse dibutyl phthalate decreases expression ISO P2ry1 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in decreased expression of P2RY1 mRNA CTD PMID:15620428 P2ry1 Mouse dibutyl phthalate increases expression ISO P2ry1 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in increased expression of P2RY1 mRNA CTD PMID:21266533 P2ry1 Mouse dichloroacetic acid increases expression EXP 6480464 Dichloroacetic Acid results in increased expression of P2RY1 mRNA CTD PMID:28962523 P2ry1 Mouse dorsomorphin multiple interactions ISO P2RY1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of P2RY1 mRNA CTD PMID:27188386 P2ry1 Mouse flutamide decreases expression ISO P2ry1 (Rattus norvegicus) 6480464 Flutamide results in decreased expression of P2RY1 mRNA CTD PMID:24793618 P2ry1 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of P2RY1 mRNA CTD PMID:25629700 P2ry1 Mouse furan multiple interactions EXP 6480464 [Bromodeoxyuridine co-treated with furan] affects the expression of P2RY1 mRNA CTD PMID:24910943 P2ry1 Mouse genistein multiple interactions ISO P2ry1 (Rattus norvegicus) 6480464 [Genistein co-treated with Methoxychlor] results in decreased expression of P2RY1 mRNA CTD PMID:21782745 P2ry1 Mouse genistein increases expression EXP 6480464 Genistein results in increased expression of P2RY1 mRNA CTD PMID:32186404 P2ry1 Mouse gentamycin decreases expression ISO P2ry1 (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of P2RY1 mRNA CTD PMID:33387578 P2ry1 Mouse glycidol decreases expression ISO P2ry1 (Rattus norvegicus) 6480464 glycidol results in decreased expression of P2RY1 mRNA CTD PMID:24915197 P2ry1 Mouse glyphosate increases expression EXP 6480464 Glyphosate results in increased expression of P2RY1 mRNA CTD PMID:35897073 P2ry1 Mouse hydrogen peroxide multiple interactions ISO P2RY1 (Homo sapiens) 6480464 N(6)-methyl-2'-deoxyadenosine 3' more ... CTD PMID:22129738 P2ry1 Mouse lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of P2RY1 mRNA CTD PMID:22609695 P2ry1 Mouse lead(0) affects expression ISO P2RY1 (Homo sapiens) 6480464 Lead affects the expression of P2RY1 mRNA CTD PMID:28903495 P2ry1 Mouse lipopolysaccharide multiple interactions ISO P2RY1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of P2RY1 mRNA CTD PMID:35811015 P2ry1 Mouse lipopolysaccharide decreases expression ISO P2RY1 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of P2RY1 mRNA CTD PMID:35811015 P2ry1 Mouse methimazole decreases expression ISO P2ry1 (Rattus norvegicus) 6480464 Methimazole results in decreased expression of P2RY1 mRNA CTD PMID:30047161 P2ry1 Mouse methoxychlor multiple interactions ISO P2ry1 (Rattus norvegicus) 6480464 [Genistein co-treated with Methoxychlor] results in decreased expression of P2RY1 mRNA CTD PMID:21782745 P2ry1 Mouse mono(2-ethylhexyl) phthalate multiple interactions ISO P2RY1 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of P2RY1 gene CTD PMID:33872906 P2ry1 Mouse NAD zwitterion multiple interactions ISO P2RY1 (Homo sapiens) 6480464 P2RY1 protein promotes the reaction [NAD inhibits the reaction [3'-O-(4-benzoyl)benzoyladenosine 5'-triphosphate results in increased secretion of IL1B protein]] CTD PMID:29642561 P2ry1 Mouse NAD(+) multiple interactions ISO P2RY1 (Homo sapiens) 6480464 P2RY1 protein promotes the reaction [NAD inhibits the reaction [3'-O-(4-benzoyl)benzoyladenosine 5'-triphosphate results in increased secretion of IL1B protein]] CTD PMID:29642561 P2ry1 Mouse nickel atom increases expression ISO P2RY1 (Homo sapiens) 6480464 Nickel results in increased expression of P2RY1 mRNA CTD PMID:24768652 and PMID:25583101 P2ry1 Mouse Nonylphenol decreases expression ISO P2ry1 (Rattus norvegicus) 6480464 nonylphenol results in decreased expression of P2RY1 mRNA CTD PMID:15620428 P2ry1 Mouse okadaic acid increases expression ISO P2RY1 (Homo sapiens) 6480464 Okadaic Acid results in increased expression of P2RY1 mRNA CTD PMID:38832940 P2ry1 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of P2RY1 mRNA CTD PMID:34911549 P2ry1 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of P2RY1 mRNA CTD PMID:17562736 P2ry1 Mouse paracetamol increases expression ISO P2ry1 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of P2RY1 mRNA CTD PMID:33387578 P2ry1 Mouse paraquat increases expression ISO P2ry1 (Rattus norvegicus) 6480464 Paraquat results in increased expression of P2RY1 mRNA CTD PMID:18198484 P2ry1 Mouse pentanal increases expression ISO P2RY1 (Homo sapiens) 6480464 pentanal results in increased expression of P2RY1 mRNA CTD PMID:26079696 P2ry1 Mouse phencyclidine increases expression EXP 6480464 Phencyclidine results in increased expression of P2RY1 mRNA CTD PMID:12105081 P2ry1 Mouse phorbol 13-acetate 12-myristate multiple interactions EXP 6480464 [Methylcholanthrene co-treated with Tetradecanoylphorbol Acetate] results in increased expression of P2RY1 mRNA CTD PMID:23519560 P2ry1 Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of P2RY1 mRNA CTD PMID:18301758 P2ry1 Mouse potassium dichromate decreases expression EXP 6480464 Potassium Dichromate results in decreased expression of P2RY1 mRNA CTD PMID:23608068 P2ry1 Mouse pregnenolone 16alpha-carbonitrile increases expression ISO P2ry1 (Rattus norvegicus) 6480464 Pregnenolone Carbonitrile results in increased expression of P2RY1 mRNA CTD PMID:19162173 P2ry1 Mouse rottlerin multiple interactions ISO P2ry1 (Rattus norvegicus) 6480464 rottlerin inhibits the reaction [P2RY1 protein affects the reaction [Nucleotides results in increased phosphorylation of and results in increased activity of MAPK1 protein]] and rottlerin inhibits the reaction [P2RY1 protein affects the reaction [Nucleotides results in increased phosphorylation of and results in increased activity of MAPK3 protein]] CTD PMID:17620283 P2ry1 Mouse S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO P2RY1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of P2RY1 mRNA CTD PMID:35811015 P2ry1 Mouse SB 431542 multiple interactions ISO P2RY1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of P2RY1 mRNA CTD PMID:27188386 P2ry1 Mouse silicon dioxide increases expression ISO P2RY1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of P2RY1 mRNA CTD PMID:23806026 P2ry1 Mouse silicon dioxide decreases expression ISO P2RY1 (Homo sapiens) 6480464 Silicon Dioxide results in decreased expression of P2RY1 mRNA CTD PMID:25351596 P2ry1 Mouse silicon dioxide increases expression ISO P2ry1 (Rattus norvegicus) 6480464 Silicon Dioxide results in increased expression of P2RY1 mRNA CTD PMID:32721576 P2ry1 Mouse sodium arsenite affects expression ISO P2RY1 (Homo sapiens) 6480464 sodium arsenite affects the expression of P2RY1 mRNA CTD PMID:34032870 P2ry1 Mouse sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of P2RY1 mRNA CTD PMID:37682722 P2ry1 Mouse sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of P2RY1 mRNA CTD PMID:36209798 P2ry1 Mouse sodium dodecyl sulfate decreases expression ISO P2RY1 (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in decreased expression of P2RY1 mRNA CTD PMID:31734321 P2ry1 Mouse sulfadimethoxine decreases expression ISO P2ry1 (Rattus norvegicus) 6480464 Sulfadimethoxine results in decreased expression of P2RY1 mRNA CTD PMID:30047161 P2ry1 Mouse testosterone multiple interactions ISO P2ry1 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Testosterone] results in decreased expression of P2RY1 mRNA CTD PMID:26496021 P2ry1 Mouse tetrachloromethane affects expression ISO P2ry1 (Rattus norvegicus) 6480464 Carbon Tetrachloride affects the expression of P2RY1 mRNA CTD PMID:12734012 P2ry1 Mouse tetrachloromethane decreases expression ISO P2ry1 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of P2RY1 mRNA CTD PMID:31150632 P2ry1 Mouse tetrachloromethane multiple interactions ISO P2ry1 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of P2RY1 mRNA] CTD PMID:31150632 P2ry1 Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of P2RY1 mRNA CTD PMID:23557971 P2ry1 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of P2RY1 promoter CTD PMID:35295148 P2ry1 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of P2RY1 gene CTD PMID:35295148 P2ry1 Mouse trichloroethene multiple interactions ISO P2RY1 (Homo sapiens) 6480464 Trichloroethylene inhibits the reaction [[Adenosine Triphosphate binds to and results in increased activity of P2RY1 protein] which results in increased abundance of Calcium] CTD PMID:12694404 P2ry1 Mouse trichloroethene increases expression ISO P2ry1 (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of P2RY1 mRNA CTD PMID:33387578 P2ry1 Mouse trichloroethene decreases activity ISO P2RY1 (Homo sapiens) 6480464 Trichloroethylene results in decreased activity of P2RY1 protein CTD PMID:12694404 P2ry1 Mouse triphenyl phosphate affects expression ISO P2RY1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of P2RY1 mRNA CTD PMID:37042841 P2ry1 Mouse valproic acid increases expression ISO P2RY1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of P2RY1 mRNA CTD PMID:26272509 P2ry1 Mouse valproic acid multiple interactions ISO P2RY1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of P2RY1 mRNA CTD PMID:27188386 P2ry1 Mouse vinclozolin increases expression ISO P2ry1 (Rattus norvegicus) 6480464 vinclozolin results in increased expression of P2RY1 mRNA CTD PMID:23034163
(+)-schisandrin B (ISO) 1,2-dichloroethane (EXP) 1,2-dimethylhydrazine (EXP) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2,6-dinitrotoluene (ISO) 3'-O-(4-Benzoyl)benzoyl ATP (ISO) 3'-phospho-5'-adenylyl sulfate (ISO) 3,3',4,4'-tetrachlorobiphenyl (EXP) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO) 3-methylcholanthrene (EXP) 4,4'-sulfonyldiphenol (EXP) 4-hydroxyphenyl retinamide (EXP) 5-bromo-2'-deoxyuridine (EXP) 6-propyl-2-thiouracil (ISO) acetamide (ISO) acetylsalicylic acid (ISO) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (ISO) amitrole (ISO) ammonium chloride (ISO) arsenite(3-) (ISO) ATP (EXP,ISO) avobenzone (ISO) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) butan-1-ol (ISO) butanal (ISO) calcium atom (ISO) calcium(0) (ISO) carbon nanotube (EXP,ISO) cisplatin (ISO) cobalt dichloride (ISO) decabromodiphenyl ether (ISO) dibenz[a,h]anthracene (EXP) dibutyl phthalate (ISO) dichloroacetic acid (EXP) dorsomorphin (ISO) flutamide (ISO) folic acid (EXP) furan (EXP) genistein (EXP,ISO) gentamycin (ISO) glycidol (ISO) glyphosate (EXP) hydrogen peroxide (ISO) lead diacetate (EXP) lead(0) (ISO) lipopolysaccharide (ISO) methimazole (ISO) methoxychlor (ISO) mono(2-ethylhexyl) phthalate (ISO) NAD zwitterion (ISO) NAD(+) (ISO) nickel atom (ISO) Nonylphenol (ISO) okadaic acid (ISO) ozone (EXP) paracetamol (EXP,ISO) paraquat (ISO) pentanal (ISO) phencyclidine (EXP) phorbol 13-acetate 12-myristate (EXP) pirinixic acid (EXP) potassium dichromate (EXP) pregnenolone 16alpha-carbonitrile (ISO) rottlerin (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (EXP,ISO) sodium dodecyl sulfate (ISO) sulfadimethoxine (ISO) testosterone (ISO) tetrachloromethane (ISO) titanium dioxide (EXP) trichloroethene (ISO) triphenyl phosphate (ISO) valproic acid (ISO) vinclozolin (ISO)
Biological Process
adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway (IEA,ISO) blood vessel diameter maintenance (IEA,ISO) cellular response to purine-containing compound (ISO,ISS) eating behavior (IEA,ISO) establishment of localization in cell (IGI,IMP) G protein-coupled adenosine receptor signaling pathway (IEA,ISO) G protein-coupled purinergic nucleotide receptor signaling pathway (IEA,ISO) G protein-coupled receptor signaling pathway (ISO) glial cell migration (IEA,ISO) microglial cell activation (ISO) monoatomic ion transport (IGI,IMP) negative regulation of norepinephrine secretion (IEA,ISO) phospholipase C-activating G protein-coupled receptor signaling pathway (IBA,ISO,ISS) platelet activation (IEA) positive regulation of cytosolic calcium ion concentration (IEA,ISO) positive regulation of ERK1 and ERK2 cascade (IEA,ISO) positive regulation of hormone secretion (IEA,ISO) positive regulation of inositol trisphosphate biosynthetic process (IEA,ISO) positive regulation of monoatomic ion transport (IGI,IMP) positive regulation of penile erection (IEA,ISO) positive regulation of protein phosphorylation (ISO) positive regulation of transcription by RNA polymerase II (IEA,ISO) protein localization to plasma membrane (IEA,ISO) regulation of cell shape (ISO,ISS) regulation of presynaptic cytosolic calcium ion concentration (IEA,ISO) regulation of synaptic vesicle exocytosis (IEA,ISO) relaxation of muscle (IEA) response to growth factor (IEA,ISO) response to mechanical stimulus (IEA,ISO) signal transduction involved in regulation of gene expression (IEA,ISO)
Cellular Component
apical plasma membrane (IEA,ISO) basolateral plasma membrane (IEA,ISO) cell body (IEA,ISO) cilium (ISO) dendrite (IEA,ISO) glutamatergic synapse (IEA,ISO) plasma membrane (IBA,IDA,ISO,ISS) postsynaptic density (IEA,ISO) postsynaptic membrane (IEA,ISO) presynaptic active zone membrane (IEA,ISO)
Molecular Function
A1 adenosine receptor binding (IBA,IEA,ISO) ADP binding (IEA,ISO) ATP binding (IBA,ISO,ISS) G protein-coupled ADP receptor activity (IBA,ISO,ISS) G protein-coupled ATP receptor activity (IBA,IEA,ISO) G protein-coupled purinergic nucleotide receptor activity (ISO) protein binding (ISO) protein heterodimerization activity (IEA,ISO) scaffold protein binding (IEA,ISO) signaling receptor regulator activity (ISO)
1.
P2 receptor-mediated stimulation of the PI3-K/Akt-pathway in vivo.
Franke H, etal., Glia. 2009 Aug 1;57(10):1031-45.
2.
Management of erectile function by penile purinergic p2 receptors in the diabetic rat.
Gur S, etal., J Urol. 2009 May;181(5):2375-82. Epub 2009 Mar 19.
3.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
4.
MGDs mouse GO annotations
MGD data from the GO Consortium
5.
MGD IEA
MGD IEA
6.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
7.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Cloning of rat and mouse P2Y purinoceptors.
Tokuyama Y, etal., Biochem Biophys Res Commun 1995 Jun 6;211(1):211-8.
P2ry1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 60,910,206 - 60,916,403 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 60,910,216 - 60,916,403 (+) Ensembl GRCm39 Ensembl GRCm38 3 61,002,785 - 61,008,982 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 61,002,795 - 61,008,982 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 60,806,717 - 60,812,901 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 61,090,724 - 61,096,908 (+) NCBI MGSCv36 mm8 Celera 3 60,703,955 - 60,710,141 (+) NCBI Celera Cytogenetic Map 3 E1 NCBI cM Map 3 29.24 NCBI
P2RY1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 152,835,131 - 152,841,439 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 152,835,131 - 152,841,439 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 152,552,920 - 152,559,228 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 154,035,426 - 154,038,535 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 154,035,433 - 154,038,539 NCBI Celera 3 150,971,424 - 150,974,533 (+) NCBI Celera Cytogenetic Map 3 q25.2 NCBI HuRef 3 149,943,255 - 149,946,364 (+) NCBI HuRef CHM1_1 3 152,516,451 - 152,519,560 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 155,605,520 - 155,611,828 (+) NCBI T2T-CHM13v2.0
P2ry1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 147,391,661 - 147,397,870 (+) NCBI GRCr8 mRatBN7.2 2 145,241,975 - 145,248,186 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 145,241,849 - 145,248,457 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 151,917,488 - 151,923,701 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 150,001,941 - 150,008,136 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 144,634,335 - 144,640,530 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 151,314,818 - 151,320,312 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 151,314,818 - 151,320,319 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 170,730,012 - 170,735,506 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 150,460,361 - 150,465,855 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 150,410,323 - 150,415,818 (+) NCBI Celera 2 139,634,729 - 139,640,224 (+) NCBI Celera Cytogenetic Map 2 q31 NCBI
P2ry1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955448 4,366,706 - 4,372,626 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955448 4,366,706 - 4,372,626 (+) NCBI ChiLan1.0 ChiLan1.0
P2RY1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 150,726,644 - 150,733,886 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 150,731,389 - 150,738,619 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 149,859,748 - 149,865,873 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 157,426,423 - 157,432,339 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 157,426,692 - 157,427,813 (+) Ensembl panpan1.1 panPan2
P2RY1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 23 47,249,496 - 47,253,203 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 23 47,249,496 - 47,253,203 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 23 47,112,593 - 47,116,262 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 23 47,878,074 - 47,881,878 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 23 47,878,074 - 47,881,878 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 23 47,462,527 - 47,466,223 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 23 47,517,721 - 47,521,447 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 23 47,800,041 - 47,803,744 (+) NCBI UU_Cfam_GSD_1.0
P2ry1
P2RY1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 92,991,152 - 92,997,700 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 92,991,150 - 92,997,702 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 101,032,051 - 101,038,362 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
P2RY1
P2ry1
.
Predicted Target Of
Count of predictions: 596 Count of miRNA genes: 359 Interacting mature miRNAs: 437 Transcripts: ENSMUST00000029331 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
4142399 Aec1_m autoimmune exocrinopathy 1 (mouse) Not determined 7586174 102690034 Mouse 14746977 Manh53_m mandible shape 53 (mouse) 3 35925280 69925280 Mouse 26884378 Skwq6_m skull length QTL 6, 10 week (mouse) 3 51907421 102307316 Mouse 15039332 Nmrs6_m NAFLD-associated magnetic resonance shift 6 (mouse) 3 34170741 68170741 Mouse 1301585 Cd4ts1_m CD4 T cell subset 1 (mouse) Not determined 3 39704102 73704231 Mouse 4141116 Lgaq4_m late growth adjusted QTL 4 (mouse) Not determined 10249221 83184946 Mouse 4141563 Lgq3_m late growth QTL 3 (mouse) Not determined 10249221 83184946 Mouse 1357584 Splq6_m spleen weight QTL 6 (mouse) Not determined 3 10249221 83184946 Mouse 26884382 Bzwq1_m bi-zygomatic width QTL 1, 5 week (mouse) 3 52207421 137205761 Mouse 11041901 Lmr11b_m leishmaniasis resistance 11b (mouse) 3 39704102 73704231 Mouse 1357585 Manln3_m mandible length 3 (mouse) Not determined 3 52625509 86625745 Mouse 26884380 Skwq1_m skull length QTL 1, 5 week (mouse) 3 43954435 101607316 Mouse 13464139 Nhdlq17_m non-HDL QTL 17 (mouse) 3 52923183 86923183 Mouse 1300895 Hdl5_m HDL level 5 (mouse) Not determined 3 49495005 83495118 Mouse 15039336 Nmrs2_m NAFLD-associated magnetic resonance shift 2 (mouse) 3 34576103 68576103 Mouse 26884436 Zlq3_m zygomatic length QTL 3, 10 week (mouse) 3 3265060 142405761 Mouse 1301917 Tshp4_m tooth shape 4 (mouse) Not determined 3 52625509 86625745 Mouse 26884427 Cvht4_m cranial vault height 4, 10 week (mouse) 3 16054164 109707316 Mouse 1301824 Susp_m suppressor of superoxide production (mouse) Not determined 3 49495005 83495118 Mouse 1357440 Hrtpq1_m heart weight percentage QTL 1 (mouse) Not determined 3 10249221 83184946 Mouse 10755516 Amzn1_m anatomical modifier of Zfp423 1 (mouse) 3 39704102 73704231 Mouse 1558925 Hivan1_m HIV-associated nephropathy 1 (mouse) Not determined 3 7586174 68716946 Mouse 9587784 Afw13_m abdominal fat weight QTL 13 (mouse) Not determined 3 33752045 67752228 Mouse 1301705 Sles3_m systemic lupus erythmatosus suppressor 3 (mouse) Not determined 3 37174862 143353183 Mouse 39128206 Lwq18_m liver weight QTL 18 (mouse) 3 10249221 83184946 Mouse 13207570 Tcq12_m total cholesterol QTL 12 (mouse) 3 16504164 130163649 Mouse 26884422 Cvht7_m cranial vault height 7, 16 week (mouse) 3 28954149 118893649 Mouse 1300593 Skull4_m skull morphology 4 (mouse) Not determined 3 52625509 86625745 Mouse 12880419 V125Dq4_m vitamin D active form serum level QTL 4 (mouse) 3 58907307 92907307 Mouse 4141079 Ath23_m atherosclerosis 23 (mouse) Not determined 49357581 83357581 Mouse 18337272 Bmd46_m bone mineral density 46, males (mouse) 3 35407421 69407421 Mouse 11039513 Ltpr3a_m Leishmania tropica response 3a (mouse) 3 39704102 73704231 Mouse 1300961 Bh4p_m bar holding four paws (mouse) Not determined 3 31837854 65837997 Mouse 10043882 Bwtq13_m body weight QTL 13 (mouse) Not determined 3 33752045 67752228 Mouse 10412073 Ssen2_m suseptibility to Sendai virus 2 (mouse) Not determined 3 33535465 67535615 Mouse 11039519 Ltpr3_m Leishmania tropica response 3 (mouse) 3 56704102 100464137 Mouse 4141255 W10q3_m weight 10 weeks QTL 3 (mouse) Not determined 10249221 83184946 Mouse 1300587 Aod2_m autoimmune ovarian dysgenesis 2 (mouse) Not determined 3 37179742 68716946 Mouse 1302056 Orgwq4_m organ weight QTL 4 (mouse) Not determined 3 30067588 147304689 Mouse 13208566 Bmiq5_m body mass index QTL 5 (mouse) 3 40954435 115793649 Mouse 26884389 Skwq10_m skull length QTL 10, 16 week (mouse) 3 43954435 65307421 Mouse
U22829
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 3 61,006,927 - 61,007,001 UniSTS GRCm38 MGSCv37 3 60,810,849 - 60,810,923 UniSTS GRCm37 Celera 3 60,708,085 - 60,708,159 UniSTS Cytogenetic Map 3 D UniSTS Whitehead_YAC 18 UniSTS
PMC34459P1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 3 61,003,711 - 61,004,362 UniSTS GRCm38 MGSCv37 3 60,807,633 - 60,808,284 UniSTS GRCm37 Celera 3 60,704,871 - 60,705,522 UniSTS Cytogenetic Map 3 D UniSTS
P2ry1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 3 61,004,436 - 61,004,555 UniSTS GRCm38 MGSCv37 3 60,808,358 - 60,808,477 UniSTS GRCm37 Celera 3 60,705,596 - 60,705,715 UniSTS Cytogenetic Map 3 D UniSTS cM Map UN UniSTS cM Map 3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000029331 ⟹ ENSMUSP00000029331
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 60,910,216 - 60,916,400 (+) Ensembl GRCm38.p6 Ensembl 3 61,002,795 - 61,008,979 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000193201 ⟹ ENSMUSP00000142006
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 60,910,216 - 60,916,403 (+) Ensembl GRCm38.p6 Ensembl 3 61,002,795 - 61,008,982 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000193943 ⟹ ENSMUSP00000141371
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 60,910,220 - 60,912,422 (+) Ensembl GRCm38.p6 Ensembl 3 61,002,799 - 61,005,001 (+) Ensembl
RefSeq Acc Id:
NM_001282016 ⟹ NP_001268945
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 60,910,206 - 60,916,403 (+) NCBI GRCm38 3 61,002,785 - 61,008,982 (+) NCBI Celera 3 60,703,945 - 60,710,144 (+) NCBI
Sequence:
TGCCCCCTGCACTCGAGACCCAGCCGAGCGCGGAGACGAGCTGCAGCCTTCATGGACTGTGAGCGGGGTACAGGGTAGGTAGTACGCCAGGGTCCGAGGCCACGCGCTCTCCAAAAGACCTCCAAGGT
hide sequence
RefSeq Acc Id:
NM_008772 ⟹ NP_032798
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 60,910,206 - 60,916,403 (+) NCBI GRCm38 3 61,002,785 - 61,008,982 (+) NCBI MGSCv37 3 60,806,717 - 60,812,901 (+) RGD Celera 3 60,703,945 - 60,710,144 (+) NCBI cM Map 3 ENTREZGENE
Sequence:
TGCCCCCTGCACTCGAGACCCAGCCGAGCGCGGAGACGAGCTGCAGCCTTCATGGACTGTGAGC
hide sequence
RefSeq Acc Id:
NP_032798 ⟸ NM_008772
- UniProtKB:
P49650 (UniProtKB/Swiss-Prot), Q544J5 (UniProtKB/TrEMBL), Q8BMJ5 (UniProtKB/TrEMBL)
- Sequence:
MTEVPWSVVPNGTDAAFLAGLGSLWGNSTVASTAAVSSSFQCALTKTGFQFYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQR
hide sequence
RefSeq Acc Id:
NP_001268945 ⟸ NM_001282016
- UniProtKB:
P49650 (UniProtKB/Swiss-Prot), Q544J5 (UniProtKB/TrEMBL), Q8BMJ5 (UniProtKB/TrEMBL)
- Sequence:
MTEVPWSVVPNGTDAAFLAGLGSLWGNSTVASTAAVSSSFQCALTKTGFQFYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQR
hide sequence
Ensembl Acc Id:
ENSMUSP00000029331 ⟸ ENSMUST00000029331
Ensembl Acc Id:
ENSMUSP00000141371 ⟸ ENSMUST00000193943
Ensembl Acc Id:
ENSMUSP00000142006 ⟸ ENSMUST00000193201
RGD ID: 6834186 Promoter ID: MM_KWN:34452 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Kidney, Liver, Lung, Spleen Transcripts: NM_008772, UC008PJK.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 3 60,806,306 - 60,806,897 (+) MPROMDB
RGD ID: 6880766 Promoter ID: EPDNEW_M3834 Type: multiple initiation site Name: P2ry1_1 Description: Mus musculus purinergic receptor P2Y, G-protein coupled 1 , transcriptvariant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M3835 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 3 61,002,795 - 61,002,855 EPDNEW
RGD ID: 6880768 Promoter ID: EPDNEW_M3835 Type: single initiation site Name: P2ry1_2 Description: Mus musculus purinergic receptor P2Y, G-protein coupled 1 , transcriptvariant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M3834 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 3 61,003,368 - 61,003,428 EPDNEW
