Symbol:
Ednra
Name:
endothelin receptor type A
RGD ID:
2535
Description:
Enables endothelin receptor activity. Involved in several processes, including cellular response to mechanical stimulus; glomerular filtration; and maternal process involved in parturition. Located in T-tubule and nuclear membrane. Used to study hypertension; myocardial infarction; portal hypertension; pulmonary emphysema; and pulmonary hypertension. Biomarker of several diseases, including hyperhomocysteinemia; impotence; obstructive sleep apnea; renal fibrosis; and type 2 diabetes mellitus. Human ortholog(s) of this gene implicated in hypertension (multiple); lung disease; mandibulofacial dysostosis with alopecia; migraine; and obstructive sleep apnea. Orthologous to human EDNRA (endothelin receptor type A); PARTICIPATES IN endothelin signaling pathway; inflammatory response pathway; Rho/Rac/Cdc42 mediated signaling pathway; INTERACTS WITH (R)-noradrenaline; 11-deoxycorticosterone; 2,2',4,4'-Tetrabromodiphenyl ether.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
ENDOR; endothelin A receptor; endothelin-1 receptor; endothelin-1 receptor-like; ET-A; ET-AR; Eta; LOC100366209; RATENDOR; RGD1559432
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Is Marker For:
QTLs:
Scl12
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 47,137,360 - 47,207,961 (+) NCBI GRCr8 mRatBN7.2 19 30,233,540 - 30,303,727 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 30,233,571 - 30,297,049 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 37,065,939 - 37,130,121 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 37,719,814 - 37,783,991 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 39,968,901 - 40,033,091 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 33,928,356 - 33,991,703 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 33,928,356 - 33,991,703 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 44,812,252 - 44,874,904 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 32,042,366 - 32,108,153 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 32,051,058 - 32,110,066 (+) NCBI Celera 19 29,719,589 - 29,778,843 (+) NCBI Celera Cytogenetic Map 19 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ednra Rat (R)-noradrenaline multiple interactions EXP 6480464 [cyclo(Trp-Asp-Pro-Val-Leu) binds to and results in decreased activity of EDNRA protein] which results in decreased susceptibility to Norepinephrine CTD PMID:15834289 Ednra Rat (S)-nicotine decreases expression ISO EDNRA (Homo sapiens) 6480464 Nicotine results in decreased expression of EDNRA mRNA CTD PMID:18247414 Ednra Rat 1,2-dimethylhydrazine multiple interactions ISO Ednra (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of EDNRA mRNA CTD PMID:22206623 Ednra Rat 1,2-dimethylhydrazine increases expression ISO Ednra (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of EDNRA mRNA CTD PMID:22206623 Ednra Rat 11-deoxycorticosterone multiple interactions EXP 6480464 [5-(dimethylamino)-N-(3 more ... CTD PMID:16271043 and PMID:22431579 Ednra Rat 11-deoxycorticosterone affects response to substance EXP 6480464 EDNRA protein affects the susceptibility to Desoxycorticosterone CTD PMID:12600921 Ednra Rat 17beta-estradiol increases expression ISO EDNRA (Homo sapiens) 6480464 Estradiol results in increased expression of EDNRA mRNA CTD PMID:19943105 Ednra Rat 17beta-estradiol increases expression ISO Ednra (Mus musculus) 6480464 Estradiol results in increased expression of EDNRA mRNA CTD PMID:39298647 Ednra Rat 17beta-estradiol multiple interactions ISO EDNRA (Homo sapiens) 6480464 Tamoxifen inhibits the reaction [Estradiol results in increased expression of EDNRA mRNA] CTD PMID:19943105 Ednra Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:27291303 Ednra Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ednra (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression of EDNRA mRNA CTD PMID:25975270 Ednra Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of EDNRA mRNA CTD PMID:34747641 Ednra Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of EDNRA mRNA CTD PMID:32109520 Ednra Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Ednra (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of EDNRA mRNA CTD PMID:26290441 Ednra Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Ednra (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Ednra Rat 2-naphthylamine decreases expression ISO EDNRA (Homo sapiens) 6480464 2-Naphthylamine results in decreased expression of EDNRA mRNA CTD PMID:18247414 Ednra Rat 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine increases expression EXP 6480464 Puromycin Aminonucleoside results in increased expression of EDNRA mRNA CTD PMID:12972712 Ednra Rat 4,4'-sulfonyldiphenol increases expression ISO Ednra (Mus musculus) 6480464 bisphenol S results in increased expression of EDNRA mRNA CTD PMID:30951980 Ednra Rat 4,4'-sulfonyldiphenol decreases methylation ISO EDNRA (Homo sapiens) 6480464 bisphenol S results in decreased methylation of EDNRA gene CTD PMID:31601247 Ednra Rat 4,4'-sulfonyldiphenol affects expression ISO Ednra (Mus musculus) 6480464 bisphenol S affects the expression of EDNRA mRNA CTD PMID:39298647 Ednra Rat 5-(dimethylamino)-N-(3,4-dimethyl-5-isoxazolyl)-1-naphthalenesulfonamide multiple interactions EXP 6480464 [5-(dimethylamino)-N-(3 more ... CTD PMID:16271043 Ednra Rat 5-fluorouracil affects response to substance ISO EDNRA (Homo sapiens) 6480464 EDNRA protein affects the susceptibility to Fluorouracil CTD PMID:17032313 Ednra Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of EDNRA mRNA CTD PMID:24780913 and PMID:25825206 Ednra Rat acadesine multiple interactions EXP 6480464 acadesine inhibits the reaction [Smoke results in increased expression of EDNRA protein] CTD PMID:36183783 Ednra Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of EDNRA mRNA CTD PMID:31881176 Ednra Rat acrolein multiple interactions ISO EDNRA (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of EDNRA mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of EDNRA mRNA CTD PMID:32699268 Ednra Rat acrolein decreases expression EXP 6480464 Acrolein results in decreased expression of EDNRA mRNA CTD PMID:38090360 Ednra Rat acrylamide increases expression ISO EDNRA (Homo sapiens) 6480464 Acrylamide results in increased expression of EDNRA mRNA CTD PMID:38554842 Ednra Rat actinomycin D multiple interactions EXP 6480464 [Dimethyl Sulfoxide co-treated with Dactinomycin] results in decreased expression of EDNRA mRNA more ... CTD PMID:20561571 Ednra Rat actinomycin D multiple interactions ISO EDNRA (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of EDNRA mRNA CTD PMID:38460933 Ednra Rat aflatoxin B1 decreases methylation ISO EDNRA (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of EDNRA gene CTD PMID:27153756 Ednra Rat aflatoxin B1 increases expression ISO EDNRA (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of EDNRA mRNA CTD PMID:32234424 Ednra Rat aflatoxin B1 increases methylation ISO EDNRA (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of EDNRA exon CTD PMID:30157460 Ednra Rat Aflatoxin B2 alpha increases methylation ISO EDNRA (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of EDNRA exon and aflatoxin B2 results in increased methylation of EDNRA intron CTD PMID:30157460 Ednra Rat agmatine multiple interactions ISO EDNRA (Homo sapiens) 6480464 Agmatine inhibits the reaction [Palmitic Acid results in decreased expression of EDNRA protein] CTD PMID:35747990 Ednra Rat aldehydo-D-glucose increases expression ISO EDNRA (Homo sapiens) 6480464 Glucose results in increased expression of EDNRA mRNA CTD PMID:31655124 Ednra Rat aldosterone multiple interactions EXP 6480464 [cyclo(Trp-Asp-Pro-Val-Leu) binds to and results in decreased activity of EDNRA protein] inhibits the reaction [Aldosterone results in increased expression of IL18 mRNA] and [EDN1 protein binds to and results in increased activity of EDNRA protein] promotes the reaction [Aldosterone results in increased expression of IL18 mRNA] CTD PMID:18660453 Ednra Rat all-trans-retinoic acid increases expression ISO EDNRA (Homo sapiens) 6480464 Tretinoin results in increased expression of EDNRA mRNA CTD PMID:21934132 Ednra Rat all-trans-retinoic acid multiple interactions ISO Ednra (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of EDNRA mRNA CTD PMID:30951980 Ednra Rat all-trans-retinoic acid decreases expression ISO EDNRA (Homo sapiens) 6480464 Tretinoin results in decreased expression of EDNRA mRNA CTD PMID:23724009 Ednra Rat alpha-pinene multiple interactions ISO EDNRA (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of EDNRA mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of EDNRA mRNA CTD PMID:32699268 Ednra Rat ambrisentan multiple interactions ISO EDNRA (Homo sapiens) 6480464 ambrisentan binds to and results in decreased activity of EDNRA protein CTD PMID:16219361 Ednra Rat aminoguanidine multiple interactions EXP 6480464 pimagedine inhibits the reaction [Isoproterenol results in increased expression of EDNRA mRNA] CTD PMID:18594475 Ednra Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of EDNRA mRNA CTD PMID:30047161 Ednra Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions EXP 6480464 pyrazolanthrone inhibits the reaction [Particulate Matter results in increased expression of EDNRA mRNA] and pyrazolanthrone inhibits the reaction [Particulate Matter results in increased expression of EDNRA protein] CTD PMID:20561571 Ednra Rat antirheumatic drug increases expression ISO EDNRA (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of EDNRA mRNA CTD PMID:24449571 Ednra Rat apocynin multiple interactions EXP 6480464 acetovanillone inhibits the reaction [Oxygen deficiency results in increased expression of EDNRA mRNA] and acetovanillone inhibits the reaction [Oxygen deficiency results in increased expression of EDNRA protein] CTD PMID:23270704 Ednra Rat arsane affects expression ISO Ednra (Mus musculus) 6480464 Arsenic affects the expression of EDNRA mRNA CTD PMID:19654921 Ednra Rat arsenic atom affects expression ISO Ednra (Mus musculus) 6480464 Arsenic affects the expression of EDNRA mRNA CTD PMID:19654921 Ednra Rat aspartame decreases expression ISO EDNRA (Homo sapiens) 6480464 Aspartame results in decreased expression of EDNRA mRNA CTD PMID:31655124 Ednra Rat atorvastatin calcium multiple interactions EXP 6480464 Atorvastatin promotes the reaction [Losartan results in decreased expression of EDNRA mRNA] and Losartan promotes the reaction [Atorvastatin results in decreased expression of EDNRA mRNA] CTD PMID:23091284 Ednra Rat atorvastatin calcium decreases expression EXP 6480464 Atorvastatin results in decreased expression of EDNRA mRNA CTD PMID:23091284 Ednra Rat atrasentan multiple interactions ISO Ednra (Mus musculus) 6480464 atrasentan binds to and results in decreased activity of EDNRA protein CTD PMID:18516094 Ednra Rat atrasentan multiple interactions EXP 6480464 Atrasentan inhibits the reaction [NG-Nitroarginine Methyl Ester results in increased expression of EDNRA mRNA] CTD PMID:34102242 Ednra Rat atrasentan multiple interactions ISO EDNRA (Homo sapiens) 6480464 atrasentan binds to and results in decreased activity of EDNRA protein CTD PMID:12193141 more ... Ednra Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of EDNRA mRNA CTD PMID:36841081 Ednra Rat Azoxymethane multiple interactions ISO Ednra (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of EDNRA mRNA CTD PMID:29950665 Ednra Rat belinostat increases expression ISO EDNRA (Homo sapiens) 6480464 belinostat results in increased expression of EDNRA mRNA CTD PMID:26272509 Ednra Rat belinostat multiple interactions ISO EDNRA (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of EDNRA mRNA CTD PMID:27188386 Ednra Rat benzo[a]pyrene decreases expression ISO EDNRA (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of EDNRA mRNA CTD PMID:18247414 Ednra Rat benzo[a]pyrene increases methylation ISO EDNRA (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of EDNRA promoter CTD PMID:27901495 Ednra Rat benzo[a]pyrene decreases expression ISO Ednra (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of EDNRA mRNA CTD PMID:22228805 Ednra Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of EDNRA mRNA CTD PMID:20920545 Ednra Rat bis(2-ethylhexyl) phthalate decreases expression ISO EDNRA (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of EDNRA mRNA CTD PMID:31163220 Ednra Rat bisphenol A increases expression ISO Ednra (Mus musculus) 6480464 bisphenol A results in increased expression of EDNRA mRNA CTD PMID:26063408 and PMID:30951980 Ednra Rat bisphenol A decreases expression ISO Ednra (Mus musculus) 6480464 bisphenol A results in decreased expression of EDNRA mRNA CTD PMID:32156529 Ednra Rat bisphenol A multiple interactions ISO Ednra (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of EDNRA mRNA CTD PMID:30951980 Ednra Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of EDNRA mRNA CTD PMID:25181051 Ednra Rat bisphenol F increases expression ISO Ednra (Mus musculus) 6480464 bisphenol F results in increased expression of EDNRA mRNA CTD PMID:30951980 Ednra Rat bosentan multiple interactions ISO EDNRA (Homo sapiens) 6480464 bosentan binds to and results in decreased activity of EDNRA protein CTD PMID:16219361 Ednra Rat bosentan multiple interactions EXP 6480464 3 more ... CTD PMID:11093786 and PMID:15964565 Ednra Rat BQ 123 multiple interactions EXP 6480464 3 more ... CTD PMID:11093786 more ... Ednra Rat BQ 123 decreases activity ISO EDNRA (Homo sapiens) 6480464 cyclo(Trp-Asp-Pro-Val-Leu) results in decreased activity of EDNRA protein CTD PMID:18813882 Ednra Rat BQ 123 multiple interactions ISO Ednra (Mus musculus) 6480464 cyclo(Trp-Asp-Pro-Val-Leu) binds to and results in decreased activity of EDNRA protein CTD PMID:15072961 Ednra Rat BQ 123 multiple interactions ISO EDNRA (Homo sapiens) 6480464 cyclo(Trp-Asp-Pro-Val-Leu) binds to and results in decreased activity of EDNRA protein CTD PMID:11535565 Ednra Rat BQ 485 multiple interactions EXP 6480464 [BQ 485 binds to and results in decreased activity of EDNRA protein] which results in decreased expression of BCL2 protein CTD PMID:14736733 Ednra Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of EDNRA mRNA CTD PMID:33453195 Ednra Rat calcium atom affects activity EXP 6480464 Calcium affects the activity of EDNRA protein CTD PMID:12628492 Ednra Rat calcium(0) affects activity EXP 6480464 Calcium affects the activity of EDNRA protein CTD PMID:12628492 Ednra Rat cantharidin decreases expression ISO Ednra (Mus musculus) 6480464 Cantharidin results in decreased expression of EDNRA mRNA CTD PMID:36907384 Ednra Rat carbon nanotube increases expression ISO EDNRA (Homo sapiens) 6480464 Nanotubes and Carbon results in increased expression of EDNRA mRNA CTD PMID:25511174 Ednra Rat carbon nanotube decreases expression ISO Ednra (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of EDNRA mRNA CTD PMID:25620056 Ednra Rat carmustine affects response to substance ISO EDNRA (Homo sapiens) 6480464 EDNRA mRNA affects the susceptibility to Carmustine CTD PMID:16365179 Ednra Rat celecoxib multiple interactions EXP 6480464 Celecoxib inhibits the reaction [Cyclosporine results in increased expression of EDNRA protein] CTD PMID:25656942 Ednra Rat CGS-21680 multiple interactions ISO Ednra (Mus musculus) 6480464 2-(4-(2-carboxyethyl)phenethylamino)-5'-N-ethylcarboxamidoadenosine inhibits the reaction [[Phosphorus and Dietary co-treated with Cisplatin] results in increased expression of EDNRA protein] CTD PMID:39332792 Ednra Rat chromium(6+) affects expression ISO Ednra (Mus musculus) 6480464 chromium hexavalent ion affects the expression of EDNRA mRNA CTD PMID:28472532 Ednra Rat cisplatin affects response to substance ISO EDNRA (Homo sapiens) 6480464 EDNRA protein affects the susceptibility to Cisplatin CTD PMID:17032313 Ednra Rat cisplatin multiple interactions ISO Ednra (Mus musculus) 6480464 2-(4-(2-carboxyethyl)phenethylamino)-5'-N-ethylcarboxamidoadenosine inhibits the reaction [[Phosphorus more ... CTD PMID:39332792 Ednra Rat cocaine increases expression ISO EDNRA (Homo sapiens) 6480464 Cocaine results in increased expression of EDNRA protein CTD PMID:18813882 Ednra Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of EDNRA protein CTD PMID:17420087 Ednra Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of EDNRA mRNA CTD PMID:27523638 Ednra Rat cycloheximide multiple interactions EXP 6480464 [Dimethyl Sulfoxide co-treated with Cycloheximide] results in decreased expression of EDNRA mRNA more ... CTD PMID:20561571 Ednra Rat cyclosporin A multiple interactions EXP 6480464 celecoxib inhibits the reaction [Cyclosporine results in increased expression of EDNRA protein] CTD PMID:25656942 Ednra Rat cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of EDNRA protein CTD PMID:25656942 Ednra Rat D-glucose increases expression ISO EDNRA (Homo sapiens) 6480464 Glucose results in increased expression of EDNRA mRNA CTD PMID:31655124 Ednra Rat daunorubicin increases expression EXP 6480464 Daunorubicin results in increased expression of EDNRA protein CTD PMID:20888384 Ednra Rat daunorubicin multiple interactions EXP 6480464 telmisartan inhibits the reaction [Daunorubicin results in increased expression of EDNRA protein] CTD PMID:20888384 Ednra Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of EDNRA mRNA CTD PMID:23640034 Ednra Rat Deoxycorticosterone acetate multiple interactions EXP 6480464 [Desoxycorticosterone Acetate co-treated with Sodium Chloride] results in increased expression of EDNRA mRNA and [Ozone co-treated with Oxygen] inhibits the reaction [[Desoxycorticosterone Acetate co-treated with Sodium Chloride] results in increased expression of EDNRA mRNA] CTD PMID:26550192 Ednra Rat dexamethasone decreases expression ISO Ednra (Mus musculus) 6480464 Dexamethasone results in decreased expression of EDNRA mRNA CTD PMID:22733784 Ednra Rat dextran sulfate multiple interactions ISO Ednra (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of EDNRA mRNA CTD PMID:29950665 Ednra Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of EDNRA mRNA CTD PMID:21266533 Ednra Rat dibutyl phthalate increases expression ISO Ednra (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of EDNRA mRNA CTD PMID:17361019 Ednra Rat diethyl malate affects expression ISO Ednra (Mus musculus) 6480464 diethyl malate affects the expression of EDNRA mRNA CTD PMID:24814887 Ednra Rat dimethyl sulfoxide multiple interactions EXP 6480464 [Dimethyl Sulfoxide co-treated with Cycloheximide] results in decreased expression of EDNRA mRNA more ... CTD PMID:20561571 Ednra Rat dioxygen increases expression ISO Ednra (Mus musculus) 6480464 Oxygen deficiency results in increased expression of EDNRA mRNA more ... CTD PMID:21926265 and PMID:25203536 Ednra Rat dioxygen multiple interactions EXP 6480464 4-chlorobenzyltetrahydroberberine inhibits the reaction [Oxygen deficiency results in increased expression of EDNRA mRNA] more ... CTD PMID:23270704 more ... Ednra Rat dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of EDNRA mRNA and Oxygen deficiency results in increased expression of EDNRA protein CTD PMID:23270704 more ... Ednra Rat dioxygen multiple interactions ISO Ednra (Mus musculus) 6480464 rosiglitazone inhibits the reaction [Oxygen deficiency results in increased expression of EDNRA mRNA] and rosiglitazone inhibits the reaction [Oxygen deficiency results in increased expression of EDNRA protein] CTD PMID:21926265 Ednra Rat disodium selenite multiple interactions ISO Ednra (Mus musculus) 6480464 [ptaquiloside co-treated with Sodium Selenite] results in decreased expression of EDNRA mRNA CTD PMID:23274088 Ednra Rat dorsomorphin multiple interactions ISO EDNRA (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ednra Rat doxorubicin multiple interactions EXP 6480464 [cyclo(Trp-Asp-Pro-Val-Leu) binds to and results in decreased activity of EDNRA protein] affects the reaction [Doxorubicin results in increased activity of CASP3 protein] CTD PMID:14736733 Ednra Rat doxorubicin decreases expression ISO EDNRA (Homo sapiens) 6480464 Doxorubicin results in decreased expression of EDNRA mRNA CTD PMID:28940058 and PMID:29803840 Ednra Rat elemental selenium multiple interactions ISO EDNRA (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of EDNRA mRNA CTD PMID:19244175 Ednra Rat elemental selenium decreases expression ISO EDNRA (Homo sapiens) 6480464 Selenium results in decreased expression of EDNRA mRNA CTD PMID:19244175 Ednra Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of EDNRA mRNA CTD PMID:29391264 Ednra Rat enrasentan multiple interactions ISO EDNRA (Homo sapiens) 6480464 enrasentan binds to and results in decreased activity of EDNRA protein CTD PMID:16219361 Ednra Rat ethanol increases expression ISO Ednra (Mus musculus) 6480464 Ethanol results in increased expression of EDNRA mRNA CTD PMID:30319688 Ednra Rat ethanol affects expression ISO Ednra (Mus musculus) 6480464 Ethanol affects the expression of EDNRA mRNA CTD PMID:30319688 Ednra Rat fenvalerate decreases expression EXP 6480464 fenvalerate results in decreased expression of EDNRA mRNA CTD PMID:30307764 Ednra Rat fluvastatin decreases expression EXP 6480464 fluvastatin results in decreased expression of EDNRA mRNA CTD PMID:28951255 Ednra Rat folic acid multiple interactions ISO Ednra (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of EDNRA mRNA CTD PMID:22206623 Ednra Rat fructose multiple interactions EXP 6480464 KLK1 protein inhibits the reaction [Fructose results in increased expression of EDNRA mRNA] CTD PMID:14568997 Ednra Rat fructose increases expression ISO EDNRA (Homo sapiens) 6480464 Fructose results in increased expression of EDNRA mRNA CTD PMID:31655124 Ednra Rat fructose increases expression EXP 6480464 Fructose results in increased expression of EDNRA mRNA CTD PMID:14568997 and PMID:9869011 Ednra Rat fulvestrant multiple interactions ISO EDNRA (Homo sapiens) 6480464 [fulvestrant co-treated with Tamoxifen co-treated with ZD4054] results in decreased expression of EDNRA mRNA CTD PMID:19943105 Ednra Rat fulvestrant increases methylation ISO EDNRA (Homo sapiens) 6480464 Fulvestrant results in increased methylation of EDNRA gene CTD PMID:31601247 Ednra Rat furan decreases expression EXP 6480464 furan results in decreased expression of EDNRA mRNA CTD PMID:25539665 Ednra Rat furan increases expression EXP 6480464 furan results in increased expression of EDNRA mRNA CTD PMID:27387713 Ednra Rat glucose increases expression ISO EDNRA (Homo sapiens) 6480464 Glucose results in increased expression of EDNRA mRNA CTD PMID:31655124 Ednra Rat hexadecanoic acid multiple interactions ISO EDNRA (Homo sapiens) 6480464 Agmatine inhibits the reaction [Palmitic Acid results in decreased expression of EDNRA protein] CTD PMID:35747990 Ednra Rat hexadecanoic acid decreases expression ISO EDNRA (Homo sapiens) 6480464 Palmitic Acid results in decreased expression of EDNRA protein CTD PMID:35747990 Ednra Rat hydrogen cyanide decreases expression ISO Ednra (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of EDNRA mRNA CTD PMID:33914522 Ednra Rat inulin multiple interactions ISO Ednra (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of EDNRA mRNA CTD PMID:36331819 Ednra Rat isoprenaline increases expression ISO Ednra (Mus musculus) 6480464 Isoproterenol results in increased expression of EDNRA mRNA CTD PMID:20003209 Ednra Rat isoprenaline multiple interactions EXP 6480464 CPU0213 inhibits the reaction [Isoproterenol results in increased expression of EDNRA mRNA] more ... CTD PMID:18594475 more ... Ednra Rat isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of EDNRA mRNA and Isoproterenol results in increased expression of EDNRA protein CTD PMID:18594475 more ... Ednra Rat isoquinoline-1,5-diol decreases expression EXP 6480464 1 and 5-dihydroxyisoquinoline results in decreased expression of EDNRA mRNA CTD PMID:12824290 Ednra Rat Licochalcone B decreases expression ISO EDNRA (Homo sapiens) 6480464 licochalcone B results in decreased expression of EDNRA mRNA CTD PMID:33647349 Ednra Rat lipopolysaccharide multiple interactions ISO EDNRA (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Ednra Rat lipopolysaccharide decreases expression ISO EDNRA (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of EDNRA mRNA CTD PMID:35811015 Ednra Rat losartan multiple interactions EXP 6480464 Atorvastatin promotes the reaction [Losartan results in decreased expression of EDNRA mRNA] and Losartan promotes the reaction [Atorvastatin results in decreased expression of EDNRA mRNA] CTD PMID:23091284 Ednra Rat losartan decreases expression EXP 6480464 Losartan results in decreased expression of EDNRA mRNA CTD PMID:23091284 Ednra Rat Magnolol multiple interactions EXP 6480464 magnolol inhibits the reaction [Monocrotaline results in increased expression of EDNRA protein] CTD PMID:30466619 Ednra Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of EDNRA mRNA CTD PMID:30047161 Ednra Rat methylmercury chloride decreases expression ISO EDNRA (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of EDNRA mRNA CTD PMID:28001369 Ednra Rat methylseleninic acid increases expression ISO EDNRA (Homo sapiens) 6480464 methylselenic acid results in increased expression of EDNRA mRNA CTD PMID:18548127 Ednra Rat mifepristone decreases expression EXP 6480464 Mifepristone results in decreased expression of EDNRA mRNA CTD PMID:25972201 Ednra Rat monocrotaline multiple interactions EXP 6480464 magnolol inhibits the reaction [Monocrotaline results in increased expression of EDNRA protein] and Simvastatin inhibits the reaction [Monocrotaline results in increased expression of EDNRA mRNA] CTD PMID:22022327 and PMID:30466619 Ednra Rat monocrotaline increases expression EXP 6480464 Monocrotaline results in increased expression of EDNRA mRNA and Monocrotaline results in increased expression of EDNRA protein CTD PMID:20967148 more ... Ednra Rat N(gamma)-nitro-L-arginine methyl ester multiple interactions EXP 6480464 Atrasentan inhibits the reaction [NG-Nitroarginine Methyl Ester results in increased expression of EDNRA mRNA] CTD PMID:34102242 Ednra Rat N(gamma)-nitro-L-arginine methyl ester increases expression EXP 6480464 NG-Nitroarginine Methyl Ester results in increased expression of EDNRA mRNA CTD PMID:34102242 Ednra Rat nicotine decreases expression ISO EDNRA (Homo sapiens) 6480464 Nicotine results in decreased expression of EDNRA mRNA CTD PMID:18247414 Ednra Rat nitrofen decreases expression ISO Ednra (Mus musculus) 6480464 nitrofen results in decreased expression of EDNRA mRNA CTD PMID:12407540 Ednra Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of EDNRA mRNA and nitrofen results in increased expression of EDNRA protein CTD PMID:10693666 more ... Ednra Rat Nutlin-3 multiple interactions ISO EDNRA (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of EDNRA mRNA CTD PMID:38460933 Ednra Rat ouabain increases expression EXP 6480464 Ouabain results in increased expression of EDNRA mRNA and Ouabain results in increased expression of EDNRA protein CTD PMID:15477225 and PMID:16982439 Ednra Rat oxybenzone decreases expression ISO Ednra (Mus musculus) 6480464 oxybenzone results in decreased expression of EDNRA mRNA CTD PMID:39343157 Ednra Rat ozone decreases expression EXP 6480464 Ozone results in decreased expression of EDNRA mRNA CTD PMID:16081523 Ednra Rat ozone multiple interactions ISO Ednra (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of EDNRA mRNA CTD PMID:34911549 Ednra Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Oxygen] inhibits the reaction [[Desoxycorticosterone Acetate co-treated with Sodium Chloride] results in increased expression of EDNRA mRNA] CTD PMID:26550192 Ednra Rat ozone multiple interactions ISO EDNRA (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of EDNRA mRNA more ... CTD PMID:32699268 Ednra Rat ozone increases expression EXP 6480464 Ozone results in increased expression of EDNRA mRNA CTD PMID:20980218 Ednra Rat panobinostat increases expression ISO EDNRA (Homo sapiens) 6480464 panobinostat results in increased expression of EDNRA mRNA CTD PMID:26272509 Ednra Rat panobinostat multiple interactions ISO EDNRA (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of EDNRA mRNA CTD PMID:27188386 Ednra Rat paracetamol increases expression ISO EDNRA (Homo sapiens) 6480464 Acetaminophen results in increased expression of EDNRA mRNA CTD PMID:29067470 Ednra Rat paraquat affects expression EXP 6480464 Paraquat affects the expression of EDNRA mRNA CTD PMID:16854511 Ednra Rat paraquat decreases expression ISO EDNRA (Homo sapiens) 6480464 Paraquat results in decreased expression of EDNRA mRNA CTD PMID:35182771 Ednra Rat perfluorohexanesulfonic acid increases expression ISO Ednra (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of EDNRA mRNA CTD PMID:37995155 Ednra Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ednra (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of EDNRA mRNA CTD PMID:36331819 Ednra Rat phenylephrine multiple interactions EXP 6480464 [cyclo(Trp-Asp-Pro-Val-Leu) binds to and results in decreased activity of EDNRA protein] which results in decreased susceptibility to Phenylephrine and phosphoramidon inhibits the reaction [Phenylephrine results in increased expression of EDNRA protein] CTD PMID:15007106 Ednra Rat phenylmercury acetate increases expression ISO EDNRA (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of EDNRA mRNA CTD PMID:26272509 Ednra Rat phenylmercury acetate multiple interactions ISO EDNRA (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of EDNRA mRNA CTD PMID:27188386 Ednra Rat phosphoramidon multiple interactions EXP 6480464 phosphoramidon inhibits the reaction [AGT protein results in increased expression of EDNRA protein] and phosphoramidon inhibits the reaction [Phenylephrine results in increased expression of EDNRA protein] CTD PMID:15007106 Ednra Rat pirinixic acid decreases expression ISO Ednra (Mus musculus) 6480464 pirinixic acid results in decreased expression of EDNRA mRNA CTD PMID:16985257 Ednra Rat potassium chloride multiple interactions ISO Ednra (Mus musculus) 6480464 [19-oxo-11-deoxycorticosterone acetate co-treated with Potassium Chloride co-treated with Sodium Chloride] affects the activity of EDNRA protein CTD PMID:18516094 Ednra Rat potassium cyanide decreases expression ISO Ednra (Mus musculus) 6480464 Potassium Cyanide results in decreased expression of EDNRA mRNA CTD PMID:33914522 Ednra Rat potassium dichromate increases expression ISO Ednra (Mus musculus) 6480464 Potassium Dichromate results in increased expression of EDNRA mRNA CTD PMID:23608068 Ednra Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of EDNRA mRNA CTD PMID:30047161 Ednra Rat progesterone decreases expression ISO EDNRA (Homo sapiens) 6480464 Progesterone results in decreased expression of EDNRA mRNA CTD PMID:21795739 Ednra Rat Ptaquiloside multiple interactions ISO Ednra (Mus musculus) 6480464 [ptaquiloside co-treated with Sodium Selenite] results in decreased expression of EDNRA mRNA CTD PMID:23274088 Ednra Rat quartz decreases expression ISO EDNRA (Homo sapiens) 6480464 Quartz results in decreased expression of EDNRA mRNA CTD PMID:27917503 Ednra Rat raloxifene multiple interactions ISO EDNRA (Homo sapiens) 6480464 [Raloxifene Hydrochloride co-treated with ESR1 protein] results in increased expression of EDNRA mRNA and [Raloxifene Hydrochloride co-treated with ESR2 protein] results in decreased expression of EDNRA mRNA CTD PMID:19059307 Ednra Rat reactive oxygen species multiple interactions EXP 6480464 [5-(dimethylamino)-N-(3 and 4-dimethyl-5-isoxazolyl)-1-naphthalenesulfonamide binds to and results in decreased activity of EDNRA protein] inhibits the reaction [Desoxycorticosterone results in increased chemical synthesis of Reactive Oxygen Species] CTD PMID:16271043 Ednra Rat rebaudioside A increases expression ISO EDNRA (Homo sapiens) 6480464 rebaudioside A results in increased expression of EDNRA mRNA CTD PMID:31655124 Ednra Rat resveratrol multiple interactions EXP 6480464 Resveratrol inhibits the reaction [Smoke results in increased expression of EDNRA protein] and Resveratrol inhibits the reaction [Tobacco Smoke Pollution results in increased expression of EDNRA protein] CTD PMID:36183783 Ednra Rat rotenone decreases expression ISO Ednra (Mus musculus) 6480464 Rotenone results in decreased expression of EDNRA mRNA CTD PMID:35919817 Ednra Rat rotenone increases expression ISO EDNRA (Homo sapiens) 6480464 Rotenone results in increased expression of EDNRA mRNA CTD PMID:37210002 Ednra Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO EDNRA (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Ednra Rat SB 203580 multiple interactions EXP 6480464 SB 203580 inhibits the reaction [Smoke results in increased expression of EDNRA protein] CTD PMID:36183783 Ednra Rat SB 431542 multiple interactions ISO EDNRA (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ednra Rat selenium atom multiple interactions ISO EDNRA (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of EDNRA mRNA CTD PMID:19244175 Ednra Rat selenium atom decreases expression ISO EDNRA (Homo sapiens) 6480464 Selenium results in decreased expression of EDNRA mRNA CTD PMID:19244175 Ednra Rat silicon dioxide decreases expression ISO EDNRA (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of EDNRA mRNA and Silicon Dioxide results in decreased expression of EDNRA mRNA CTD PMID:25351596 and PMID:25895662 Ednra Rat simvastatin multiple interactions EXP 6480464 Simvastatin inhibits the reaction [Cholesterol more ... CTD PMID:19505368 and PMID:22022327 Ednra Rat sodium arsenite multiple interactions ISO EDNRA (Homo sapiens) 6480464 EDNRA protein affects the reaction [sodium arsenite results in decreased expression of PLIN1 protein] and sodium arsenite results in decreased expression of and affects the splicing of EDNRA mRNA CTD PMID:23650128 and PMID:25879800 Ednra Rat sodium chloride multiple interactions ISO Ednra (Mus musculus) 6480464 [19-oxo-11-deoxycorticosterone acetate co-treated with Potassium Chloride co-treated with Sodium Chloride] affects the activity of EDNRA protein CTD PMID:18516094 Ednra Rat sodium chloride multiple interactions EXP 6480464 [Desoxycorticosterone Acetate co-treated with Sodium Chloride] results in increased expression of EDNRA mRNA more ... CTD PMID:22431579 and PMID:26550192 Ednra Rat steviol increases expression ISO EDNRA (Homo sapiens) 6480464 steviol results in increased expression of EDNRA mRNA CTD PMID:31655124 Ednra Rat stevioside increases expression ISO EDNRA (Homo sapiens) 6480464 stevioside results in increased expression of EDNRA mRNA CTD PMID:31655124 Ednra Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of EDNRA mRNA CTD PMID:30047161 Ednra Rat sulforaphane decreases expression ISO EDNRA (Homo sapiens) 6480464 sulforaphane results in decreased expression of EDNRA mRNA CTD PMID:31838189 Ednra Rat sunitinib decreases expression ISO EDNRA (Homo sapiens) 6480464 Sunitinib results in decreased expression of EDNRA mRNA CTD PMID:31533062 Ednra Rat superoxide affects abundance EXP 6480464 EDNRA protein affects the abundance of Superoxides CTD PMID:12600921 Ednra Rat tacrolimus hydrate increases activity EXP 6480464 Tacrolimus results in increased activity of EDNRA protein CTD PMID:15964565 Ednra Rat tacrolimus hydrate increases expression EXP 6480464 Tacrolimus results in increased expression of EDNRA mRNA CTD PMID:8587392 Ednra Rat tamoxifen multiple interactions ISO EDNRA (Homo sapiens) 6480464 [fulvestrant co-treated with Tamoxifen co-treated with ZD4054] results in decreased expression of EDNRA mRNA more ... CTD PMID:19059307 and PMID:19943105 Ednra Rat tamoxifen increases expression ISO EDNRA (Homo sapiens) 6480464 Tamoxifen results in increased expression of EDNRA mRNA CTD PMID:19943105 Ednra Rat Tanshinone I multiple interactions EXP 6480464 tanshinone inhibits the reaction [Oxygen deficiency results in increased expression of EDNRA protein] CTD PMID:28985491 Ednra Rat telmisartan multiple interactions EXP 6480464 telmisartan inhibits the reaction [Daunorubicin results in increased expression of EDNRA protein] CTD PMID:20888384 Ednra Rat temozolomide affects response to substance ISO EDNRA (Homo sapiens) 6480464 EDNRA mRNA affects the susceptibility to temozolomide CTD PMID:16365179 Ednra Rat temozolomide decreases expression ISO EDNRA (Homo sapiens) 6480464 Temozolomide results in decreased expression of EDNRA mRNA CTD PMID:31758290 Ednra Rat testosterone affects expression EXP 6480464 Testosterone affects the expression of EDNRA mRNA CTD PMID:12122504 and PMID:14616470 Ednra Rat testosterone enanthate affects expression ISO EDNRA (Homo sapiens) 6480464 testosterone enanthate affects the expression of EDNRA mRNA CTD PMID:17440010 Ednra Rat tetrachloromethane decreases expression ISO Ednra (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of EDNRA mRNA CTD PMID:17484886 Ednra Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of EDNRA mRNA CTD PMID:34492290 Ednra Rat titanium dioxide affects expression ISO Ednra (Mus musculus) 6480464 titanium dioxide affects the expression of EDNRA mRNA CTD PMID:23557971 Ednra Rat titanium dioxide multiple interactions ISO Ednra (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of EDNRA mRNA CTD PMID:29950665 Ednra Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of EDNRA gene CTD PMID:27618143 Ednra Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of EDNRA mRNA CTD PMID:33387578 Ednra Rat trichostatin A increases expression ISO EDNRA (Homo sapiens) 6480464 trichostatin A results in increased expression of EDNRA mRNA CTD PMID:24935251 and PMID:26272509 Ednra Rat trichostatin A multiple interactions ISO EDNRA (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of EDNRA mRNA CTD PMID:27188386 Ednra Rat triclosan decreases expression ISO EDNRA (Homo sapiens) 6480464 Triclosan results in decreased expression of EDNRA mRNA CTD PMID:30510588 Ednra Rat valproic acid decreases expression ISO EDNRA (Homo sapiens) 6480464 Valproic Acid results in decreased expression of EDNRA mRNA CTD PMID:23179753 and PMID:28001369 Ednra Rat valproic acid multiple interactions ISO EDNRA (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of EDNRA mRNA CTD PMID:27188386 Ednra Rat valproic acid increases expression ISO EDNRA (Homo sapiens) 6480464 Valproic Acid results in increased expression of EDNRA mRNA CTD PMID:23179753 more ... Ednra Rat valproic acid increases expression ISO Ednra (Mus musculus) 6480464 Valproic Acid results in increased expression of EDNRA mRNA CTD PMID:24896083 Ednra Rat valproic acid affects expression ISO EDNRA (Homo sapiens) 6480464 Valproic Acid affects the expression of EDNRA mRNA CTD PMID:25979313 Ednra Rat valsartan decreases expression EXP 6480464 Valsartan results in decreased expression of EDNRA mRNA CTD PMID:28951255 Ednra Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of EDNRA mRNA CTD PMID:20566332 Ednra Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of EDNRA mRNA CTD PMID:19015723 Ednra Rat vitamin E multiple interactions ISO EDNRA (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of EDNRA mRNA CTD PMID:19244175 Ednra Rat vitamin E decreases expression ISO EDNRA (Homo sapiens) 6480464 Vitamin E results in decreased expression of EDNRA mRNA CTD PMID:19244175 Ednra Rat vorinostat multiple interactions ISO EDNRA (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of EDNRA mRNA CTD PMID:27188386 Ednra Rat vorinostat increases expression ISO EDNRA (Homo sapiens) 6480464 vorinostat results in increased expression of EDNRA mRNA CTD PMID:26272509
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(R)-noradrenaline (EXP) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 11-deoxycorticosterone (EXP) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-naphthylamine (ISO) 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP) 4,4'-sulfonyldiphenol (ISO) 5-(dimethylamino)-N-(3,4-dimethyl-5-isoxazolyl)-1-naphthalenesulfonamide (EXP) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acadesine (EXP) acetamide (EXP) acrolein (EXP,ISO) acrylamide (ISO) actinomycin D (EXP,ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) agmatine (ISO) aldehydo-D-glucose (ISO) aldosterone (EXP) all-trans-retinoic acid (ISO) alpha-pinene (ISO) ambrisentan (ISO) aminoguanidine (EXP) amitrole (EXP) anthra[1,9-cd]pyrazol-6(2H)-one (EXP) antirheumatic drug (ISO) apocynin (EXP) arsane (ISO) arsenic atom (ISO) aspartame (ISO) atorvastatin calcium (EXP) atrasentan (EXP,ISO) atrazine (EXP) Azoxymethane (ISO) belinostat (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bosentan (EXP,ISO) BQ 123 (EXP,ISO) BQ 485 (EXP) cadmium dichloride (EXP) calcium atom (EXP) calcium(0) (EXP) cantharidin (ISO) carbon nanotube (ISO) carmustine (ISO) celecoxib (EXP) CGS-21680 (ISO) chromium(6+) (ISO) cisplatin (ISO) cocaine (EXP,ISO) Cuprizon (EXP) cycloheximide (EXP) cyclosporin A (EXP) D-glucose (ISO) daunorubicin (EXP) decabromodiphenyl ether (EXP) Deoxycorticosterone acetate (EXP) dexamethasone (ISO) dextran sulfate (ISO) dibutyl phthalate (EXP,ISO) diethyl malate (ISO) dimethyl sulfoxide (EXP) dioxygen (EXP,ISO) disodium selenite (ISO) dorsomorphin (ISO) doxorubicin (EXP,ISO) elemental selenium (ISO) endosulfan (EXP) enrasentan (ISO) ethanol (ISO) fenvalerate (EXP) fluvastatin (EXP) folic acid (ISO) fructose (EXP,ISO) fulvestrant (ISO) furan (EXP) glucose (ISO) hexadecanoic acid (ISO) hydrogen cyanide (ISO) inulin (ISO) isoprenaline (EXP,ISO) isoquinoline-1,5-diol (EXP) Licochalcone B (ISO) lipopolysaccharide (ISO) losartan (EXP) Magnolol (EXP) methimazole (EXP) methylmercury chloride (ISO) methylseleninic acid (ISO) mifepristone (EXP) monocrotaline (EXP) N(gamma)-nitro-L-arginine methyl ester (EXP) nicotine (ISO) nitrofen (EXP,ISO) Nutlin-3 (ISO) ouabain (EXP) oxybenzone (ISO) ozone (EXP,ISO) panobinostat (ISO) paracetamol (ISO) paraquat (EXP,ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) phenylephrine (EXP) phenylmercury acetate (ISO) phosphoramidon (EXP) pirinixic acid (ISO) potassium chloride (ISO) potassium cyanide (ISO) potassium dichromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) progesterone (ISO) Ptaquiloside (ISO) quartz (ISO) raloxifene (ISO) reactive oxygen species (EXP) rebaudioside A (ISO) resveratrol (EXP) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 203580 (EXP) SB 431542 (ISO) selenium atom (ISO) silicon dioxide (ISO) simvastatin (EXP) sodium arsenite (ISO) sodium chloride (EXP,ISO) steviol (ISO) stevioside (ISO) sulfadimethoxine (EXP) sulforaphane (ISO) sunitinib (ISO) superoxide (EXP) tacrolimus hydrate (EXP) tamoxifen (ISO) Tanshinone I (EXP) telmisartan (EXP) temozolomide (ISO) testosterone (EXP) testosterone enanthate (ISO) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) valproic acid (ISO) valsartan (EXP) vinclozolin (EXP) vitamin E (ISO) vorinostat (ISO)
Biological Process
adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway (IEA,ISO) angiogenesis (IEA,ISO) aorta development (IEA,ISO) artery smooth muscle contraction (IEA,ISO) atrial cardiac muscle tissue development (IEA,ISO) axon extension (IEA,ISO) axon guidance (IEA,ISO) axonogenesis involved in innervation (IEA,ISO) blood circulation (IEA) blood vessel remodeling (IEA,ISO) branching involved in blood vessel morphogenesis (IEA,ISO) calcium ion transmembrane transport (IEA,ISO) cAMP/PKA signal transduction (IEA,ISO) canonical Wnt signaling pathway (IEA,ISO) cardiac chamber formation (IEA,ISO) cardiac neural crest cell migration involved in outflow tract morphogenesis (IEA,ISO) cellular response to follicle-stimulating hormone stimulus (IEA,ISO) cellular response to human chorionic gonadotropin stimulus (IEA,ISO) cellular response to luteinizing hormone stimulus (IEA,ISO) cellular response to mechanical stimulus (IMP) cellular response to oxidative stress (IEA,ISO) cellular response to toxic substance (IEA,ISO) cranial skeletal system development (IEA,ISO) developmental pigmentation (IBA) embryonic heart tube development (IEA,ISO) embryonic skeletal system development (IEA,ISO) endothelin receptor signaling pathway (IBA,IEA,ISO) endothelin receptor signaling pathway involved in heart process (IEA,ISO) enteric nervous system development (IEA) establishment of endothelial barrier (IEA,ISO) face development (IEA,ISO) fibroblast proliferation (IMP) G protein-coupled receptor signaling pathway (IEA) gene expression (IEA,ISO) glomerular endothelium development (IEA,ISO) glomerular filtration (IEA,IMP,ISO) glomerulus development (IEA,ISO) head development (IEA,ISO) heart development (IEA,ISO) heart process (IEA,ISO) heparin proteoglycan metabolic process (IEA,ISO) histamine secretion (IMP) in utero embryonic development (IEA,ISO) intracellular calcium ion homeostasis (IEA,ISO) left ventricular cardiac muscle tissue morphogenesis (IEA,ISO) maternal process involved in parturition (IEP) meiotic cell cycle process involved in oocyte maturation (IEA,ISO) mesenchymal cell apoptotic process (IEA,ISO) middle ear morphogenesis (IEA,ISO) mitochondrion organization (IEA,ISO) mitotic cell cycle (IEA,ISO) negative regulation of apoptotic process (IMP) neural crest cell development (IEA,ISO) neural crest cell differentiation (IEA,ISO) neural crest cell fate commitment (IEA,ISO) neuromuscular process (IEA,ISO) neuron projection development (IEA,ISO) neuron remodeling (IEA,ISO) noradrenergic neuron differentiation (IEA,ISO) norepinephrine metabolic process (IEA,ISO) pharyngeal arch artery morphogenesis (IEA,ISO) phospholipase C-activating G protein-coupled receptor signaling pathway (IMP) podocyte apoptotic process (IEA,ISO) podocyte differentiation (IEA,ISO) positive regulation of calcium ion transport (IMP) positive regulation of canonical NF-kappaB signal transduction (IEA,ISO) positive regulation of cation channel activity (ISO) positive regulation of cell population proliferation (IMP) positive regulation of cytosolic calcium ion concentration (IDA) positive regulation of ERK1 and ERK2 cascade (IMP) positive regulation of kidney development (IMP) positive regulation of neutrophil chemotaxis (IMP) positive regulation of odontogenesis (IMP) positive regulation of protein phosphorylation (IMP) positive regulation of release of sequestered calcium ion into cytosol (IMP) protein phosphorylation (ISO) protein transmembrane transport (IEA,ISO) regulation of biological quality (IEA) regulation of blood pressure (IEA,ISO) regulation of D-glucose transmembrane transport (IEA,ISO) regulation of epithelial cell proliferation (IMP) regulation of heart rate (IEA,ISO) regulation of protein localization to cell leading edge (IEA,ISO) renal albumin absorption (IEA,ISO) renal sodium ion absorption (IEA,ISO) respiratory gaseous exchange by respiratory system (IEA,ISO) response to acetylcholine (IEA,ISO) response to amphetamine (IEA,ISO) response to hypoxia (IEA,ISO) response to lipopolysaccharide (IMP) response to wounding (IEA,ISO) Rho protein signal transduction (IMP) semaphorin-plexin signaling pathway involved in axon guidance (IEA,ISO) signal transduction (IEA) smooth muscle cell proliferation (IMP) sodium ion homeostasis (IEA,ISO) sympathetic nervous system development (IEA,ISO) sympathetic neuron axon guidance (IEA,ISO) thyroid gland development (IEA,ISO) vascular associated smooth muscle cell development (IEA,ISO) vasoconstriction (IBA,IEA,IMP,ISO)
1.
Developmental changes in the functional, biochemical and molecular properties of rat bladder endothelin receptors.
Afiatpour P, etal., Naunyn Schmiedebergs Arch Pharmacol. 2003 May;367(5):462-72. Epub 2003 Apr 17.
2.
Inhibition of endothelin-1 receptors improves impaired nitric oxide synthase-dependent dilation of cerebral arterioles in type-1 diabetic rats.
Arrick DM and Mayhan WG, Microcirculation. 2010 Aug;17(6):439-46.
3.
ETA receptor-mediated Ca2+ signaling in thin descending limbs of Henle's loop: impairment in genetic hypertension.
Bailey MA, etal., Kidney Int. 2003 Apr;63(4):1276-84.
4.
Major role for hypoxia inducible factor-1 and the endothelin system in promoting myocardial infarction and hypertension in an animal model of obstructive sleep apnea.
Belaidi E, etal., J Am Coll Cardiol. 2009 Apr 14;53(15):1309-17.
5.
Association of EDNRA, but not WNK4 or FKBP1B, polymorphisms with essential hypertension.
Benjafield AV, etal., Clin Genet. 2003 Nov;64(5):433-8.
6.
Endothelin-1 receptor subtypes expression and binding in a perfused rat model of myocardial infarction.
Bikhazi AB, etal., Comp Biochem Physiol C Toxicol Pharmacol. 2003 Jan;134(1):35-43.
7.
Functional endothelin receptors are present on nuclei in cardiac ventricular myocytes.
Boivin B, etal., J Biol Chem. 2003 Aug 1;278(31):29153-63. Epub 2003 May 19.
8.
Genetic polymorphisms in endothelin-receptor-subtype-a-gene as susceptibility factor for obstructive sleep apnea syndrome.
Buck D, etal., Sleep Med. 2010 Feb;11(2):213-7. Epub 2010 Jan 18.
9.
Murine and rat cavernosal responses to endothelin-1 and urotensin-II Vasoactive Peptide Symposium.
Carneiro FS, etal., J Am Soc Hypertens. 2008 Nov;2(6):439-447.
10.
ETA receptor-mediated Ca2+ mobilisation in H9c2 cardiac cells.
Ceccarelli F, etal., Biochem Pharmacol 2003 Mar 1;65(5):783-93.
11.
Effects of chronic cold exposure on the endothelin system.
Chen GF and Sun Z, J Appl Physiol. 2006 May;100(5):1719-26. Epub 2005 Dec 29.
12.
Endothelin-1 receptor antagonists prevent the development of pulmonary emphysema in rats.
Chen Y, etal., Eur Respir J. 2010 Apr;35(4):904-12. Epub 2009 Nov 6.
13.
Endothelins as pronociceptive mediators of the rat trigeminal system: role of ETA and ETB receptors.
Chichorro JG, etal., Brain Res. 2010 Jul 23;1345:73-83. Epub 2010 May 5.
14.
Endothelin-1 impairs alveolar epithelial function via endothelial ETB receptor.
Comellas AP, etal., Am J Respir Crit Care Med. 2009 Jan 15;179(2):113-22. Epub 2008 Oct 23.
15.
Increased ET-1 and reduced ET(B) receptor expression in uremic hypertensive rats.
D'Amours M, etal., Clin Exp Hypertens. 2010 Jan;32(1):61-9.
16.
EDNRA variants associate with smooth muscle mRNA levels, cell proliferation rates, and cystic fibrosis pulmonary disease severity.
Darrah R, etal., Physiol Genomics. 2010 Mar 3;41(1):71-7. Epub 2009 Dec 22.
17.
Increased endothelin-1 reactivity and endothelial dysfunction in carotid arteries from rats with hyperhomocysteinemia.
de Andrade CR, etal., Br J Pharmacol. 2009 Jun;157(4):568-80. Epub 2009 Apr 9.
18.
Age-related changes in endothelin-1 receptor subtypes in rat heart.
Del Ry S, etal., Exp Aging Res. 2008 Jul-Sep;34(3):251-66.
19.
Upregulation of endothelin receptors A and B in the nitrofen induced hypoplastic lung occurs early in gestation.
Dingemann J, etal., Pediatr Surg Int. 2010 Jan;26(1):65-9.
20.
Enhanced expression of renal endothelin-converting enzyme-1 and endothelin-A-receptor mRNA in rats with interstitial fibrosis following ureter ligation.
Feldman DL, etal., J Cardiovasc Pharmacol. 2000 Nov;36(5 Suppl 1):S255-9.
21.
Ambrisentan for the treatment of pulmonary arterial hypertension: results of the ambrisentan in pulmonary arterial hypertension, randomized, double-blind, placebo-controlled, multicenter, efficacy (ARIES) study 1 and 2.
Galie N, etal., Circulation. 2008 Jun 10;117(23):3010-9. Epub 2008 May 27.
22.
NAADP-induced Ca(2+ signaling in response to endothelin is via the receptor subtype B and requires the integrity of lipid rafts/caveolae.
Gambara G, etal., J Cell Physiol. 2008 Aug;216(2):396-404.
23.
Transgenic expression of the endothelin-B receptor prevents congenital intestinal aganglionosis in a rat model of Hirschsprung disease.
Gariepy CE, etal., J Clin Invest 1998 Sep 15;102(6):1092-101.
24.
Null mutation of endothelin receptor type B gene in spotting lethal rats causes aganglionic megacolon and white coat color.
Gariepy CE, etal., Proc Natl Acad Sci U S A 1996 Jan 23;93(2):867-72.
25.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
26.
Involvement of endothelin-1 and its receptors in PGF2alpha-induced luteolysis in the rat.
Girsh E and Dekel N, Mol Reprod Dev 2002 Sep;63(1):71-8.
27.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
28.
Polymorphisms in genes of the endothelin system and cerebral small-vessel disease.
Gormley K, etal., Stroke. 2005 Aug;36(8):1656-60. Epub 2005 Jul 7.
29.
Endothelin A and B receptors are down-regulated in the hearts of hypertensive rats.
Hayzer DJ, etal., Am J Med Sci 1994 Mar;307(3):222-7.
30.
A polymorphism in the endothelin-A receptor gene predicts survival in patients with idiopathic dilated cardiomyopathy.
Herrmann S, etal., Eur Heart J. 2001 Oct;22(20):1948-53.
31.
ETA receptor blockade induces tubular cell proliferation and cyst growth in rats with polycystic kidney disease.
Hocher B, etal., J Am Soc Nephrol. 2003 Feb;14(2):367-76.
32.
Regulation of endothelin-converting enzyme 1 in nephrotic syndrome in rats.
Ikebe M, etal., Nephron Exp Nephrol. 2003;94(4):e137-45.
33.
Dual constrictor and dilator actions of ET(B) receptors in the rat renal microcirculation: interactions with ET(A) receptors.
Just A, etal., Am J Physiol Renal Physiol. 2004 Apr;286(4):F660-8. Epub 2003 Dec 16.
34.
The role of ET(A) and ET(B) receptor antagonists in acute and allergic inflammation in mice.
Kassuya CA, etal., Peptides. 2008 Aug;29(8):1329-37. Epub 2008 Mar 16.
35.
Endothelin-1 induces organ-specific histamine liberation and neutrophil granulocyte accumulation in the rat.
Kaszaki J, etal., Inflamm Res. 2008 Aug;57(8):396-402.
36.
Peripheral mechanisms of erectile dysfunction in a rat model of chronic cocaine use.
Kendirci M, etal., Eur Urol. 2007 Aug;52(2):555-63. Epub 2007 Mar 20.
37.
Cloning and functional expression of a vascular smooth muscle endothelin 1 receptor.
Lin HY, etal., Proc Natl Acad Sci U S A 1991 Apr 15;88(8):3185-9.
38.
Constriction of rat extra-splenic veins to lipopolysaccharide involves endothelin-1.
Mansart A, etal., Naunyn Schmiedebergs Arch Pharmacol. 2010 Jun;381(6):555-62. Epub 2010 Apr 16.
39.
Involvement of NO and MEK/ERK pathway in enhancement of endothelin-1-induced mesenteric artery contraction in later-stage type 2 diabetic Goto-Kakizaki rat.
Matsumoto T, etal., Am J Physiol Heart Circ Physiol. 2009 May;296(5):H1388-97. Epub 2009 Mar 13.
40.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
41.
Endothelin-a receptor in rat skeletal muscle microvasculature.
Mitchell D, etal., Microvasc Res. 2002 Jul;64(1):179-85.
42.
Inhibitory effects of PPAR-gamma on endothelin-1-induced inflammatory pathways in vascular smooth muscle cells from normotensive and hypertensive rats.
Montezano AC, etal., J Am Soc Hypertens. 2007 Mar-Apr;1(2):150-60.
43.
Mechanical stretch induced interleukin-18 (IL-18) expression through Angiotensin subtype 1 receptor (AT1R) and endothelin-1 in cardiomyocytes.
Naka T, etal., Prep Biochem Biotechnol. 2008;38(2):201-12.
44.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
45.
Polymorphisms of the endothelin-A and -B receptor genes in relation to blood pressure and myocardial infarction: the Etude Cas-Temoins sur l'Infarctus du Myocarde (ECTIM) Study.
Nicaud V, etal., Am J Hypertens. 1999 Mar;12(3):304-10.
46.
Roles of endothelin ETA and ETB receptors in the pathogenesis of monocrotaline-induced pulmonary hypertension.
Nishida M, etal., J Cardiovasc Pharmacol. 2004 Aug;44(2):187-91.
47.
Thrombin-stimulated proliferation is mediated by endothelin-1 in cultured rat gingival fibroblasts.
Ohuchi N, etal., Fundam Clin Pharmacol. 2010 Aug;24(4):501-8. Epub 2009 Oct 30.
48.
Endothelin-1 (ET-1) is increased in rat retina after crushing optic nerve.
Oku H, etal., Curr Eye Res. 2008 Jul;33(7):611-20.
49.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
50.
ET(B) receptor-deficient rats exhibit reduced contraction to ET-1 despite an increase in ET(A) receptors.
Perry MG, etal., Am J Physiol Heart Circ Physiol 2001 Dec;281(6):H2680-6.
51.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
52.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
53.
ETA and ETB receptor function in pancreatitis-associated microcirculatory failure, inflammation, and parenchymal injury.
Plusczyk T, etal., Am J Physiol Gastrointest Liver Physiol. 2003 Jul;285(1):G145-53.
54.
Involvement of central endothelin receptors in neonatal morphine withdrawal.
Puppala BL, etal., Exp Biol Med (Maywood). 2006 Jun;231(6):1157-60.
55.
Role of endothelin (ETA) receptors in neonatal morphine withdrawal.
Puppala BL, etal., Peptides. 2006 Jun;27(6):1514-9. Epub 2005 Nov 15.
56.
Regulation of endothelin-A receptor sensitivity by cyclic adenosine monophosphate in rat hepatic stellate cells.
Reinehr R, etal., Hepatology 2002 Oct;36(4 Pt 1):861-73.
57.
GOA pipeline
RGD automated data pipeline
58.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
59.
Endothelin, PAF and thromboxane A2 in allergic pulmonary hyperreactivity in mice.
Richter M, etal., Prostaglandins Leukot Essent Fatty Acids. 2007 May;76(5):299-308. Epub 2007 Apr 19.
60.
Localization of functional endothelin receptor signaling complexes in cardiac transverse tubules.
Robu VG, etal., J Biol Chem. 2003 Nov 28;278(48):48154-61. Epub 2003 Sep 12.
61.
Tumor endothelin-1 enhances metastatic colonization of the lung in mouse xenograft models of bladder cancer.
Said N, etal., J Clin Invest. 2011 Jan 4;121(1):132-47. doi: 10.1172/JCI42912. Epub 2010 Dec 22.
62.
Endothelin receptor A-specific stimulation of glomerular inflammation and injury in a streptozotocin-induced rat model of diabetes.
Saleh MA, etal., Diabetologia. 2010 Dec 30.
63.
Endothelin-1 increases glomerular permeability and inflammation independent of blood pressure in the rat.
Saleh MA, etal., Hypertension. 2010 Nov;56(5):942-9. Epub 2010 Sep 7.
64.
Effects of endothelin ETA receptor antagonism on granulocyte and lymphocyte accumulation in LPS-induced inflammation.
Sampaio AL, etal., J Leukoc Biol. 2004 Jul;76(1):210-6. Epub 2004 Apr 23.
65.
Effect of YM598, a selective endothelin ETA receptor antagonist, on endothelin-1-induced bone formation.
Someya A, etal., Eur J Pharmacol. 2006 Aug 14;543(1-3):14-20. Epub 2006 Jun 27.
66.
Cooperative effect of angiotensin AT(1) and endothelin ET(A) receptor antagonism limits the brain damage after ischemic stroke in rat.
Stenman E, etal., Eur J Pharmacol. 2007 Sep 10;570(1-3):142-8. Epub 2007 Jun 9.
67.
BMPR2 mutation alters the lung macrophage endothelin-1 cascade in a mouse model and patients with heritable pulmonary artery hypertension.
Talati M, etal., Am J Physiol Lung Cell Mol Physiol. 2010 Sep;299(3):L363-73. Epub 2010 Jun 18.
68.
Role of endogenous endothelin-1 in post-ischemic cardiac dysfunction and norepinephrine overflow in rat hearts.
Tawa M, etal., Eur J Pharmacol. 2008 Sep 4;591(1-3):182-8. Epub 2008 Jun 14.
69.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
70.
Association between migraine and endothelin type A receptor (ETA -231 A/G) gene polymorphism.
Tzourio C, etal., Neurology 2001 May 22;56(10):1273-7.
71.
Early endothelin-A receptor blockade decreases blood pressure and ameliorates end-organ damage in homozygous Ren-2 rats.
Vaneckova I, etal., Hypertension. 2005 Oct;46(4):969-74. Epub 2005 Sep 12.
72.
Ischemic heart disease induces upregulation of endothelin receptor mRNA in human coronary arteries.
Wackenfors A, etal., Eur J Pharmacol. 2004 Jan 19;484(1):103-9.
73.
Endothelin-1 regulates proliferative responses, both alone and synergistically with PDGF, in rat tracheal smooth muscle cells.
Yahiaoui L, etal., Cell Physiol Biochem. 2006;17(1-2):37-46. Epub 2006 Feb 7.
74.
Inhibition of endothelin-1 and hypoxia-induced pulmonary pressor responses in the rat by a novel selective endothelin-A receptor antagonist, di-n-butylaminocarbamyl-L-leucyl-D-tryptophanyl-D-4-chloro-Phe.
Yan LD, etal., J Cardiovasc Pharmacol. 2010 Sep;56(3):246-54.
75.
Role of Endothelin-1/Endothelin-A receptor-mediated signaling pathway in the aortic arch patterning in mice.
Yanagisawa H, etal., J Clin Invest 1998 Jul 1;102(1):22-33.
76.
Endothelin A receptor blockade influences apoptosis and cellular proliferation in the developing rat kidney.
Yoo KH, etal., J Korean Med Sci. 2009 Feb;24(1):138-45. Epub 2009 Feb 28.
77.
Cholesterol dependence of vascular ERK1/2 activation and growth in response to stretch: role of endothelin-1.
Zeidan A, etal., Arterioscler Thromb Vasc Biol. 2003 Sep 1;23(9):1528-34. Epub 2003 Aug 7.
78.
[Effect and mechanism of salvianolic acid B in attenuating elevated portal pressure in a rat model of portal hypertension induced by endothelin-1].
Zhou Y, etal., Zhong Xi Yi Jie He Xue Bao. 2007 Jan;5(1):61-4.
Ednra Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 47,137,360 - 47,207,961 (+) NCBI GRCr8 mRatBN7.2 19 30,233,540 - 30,303,727 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 30,233,571 - 30,297,049 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 37,065,939 - 37,130,121 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 37,719,814 - 37,783,991 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 39,968,901 - 40,033,091 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 33,928,356 - 33,991,703 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 33,928,356 - 33,991,703 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 44,812,252 - 44,874,904 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 32,042,366 - 32,108,153 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 32,051,058 - 32,110,066 (+) NCBI Celera 19 29,719,589 - 29,778,843 (+) NCBI Celera Cytogenetic Map 19 q11 NCBI
EDNRA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 147,481,097 - 147,544,954 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 147,480,917 - 147,544,954 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 148,402,249 - 148,466,106 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 148,621,575 - 148,685,555 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 148,759,734 - 148,823,710 NCBI Celera 4 145,723,204 - 145,787,202 (+) NCBI Celera Cytogenetic Map 4 q31.22-q31.23 NCBI HuRef 4 144,129,326 - 144,193,179 (+) NCBI HuRef CHM1_1 4 148,380,418 - 148,444,465 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 150,805,228 - 150,869,037 (+) NCBI T2T-CHM13v2.0
Ednra Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 78,389,658 - 78,451,081 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 78,389,660 - 78,451,093 (-) Ensembl GRCm39 Ensembl GRCm38 8 77,663,029 - 77,724,452 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 77,663,031 - 77,724,464 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 80,186,928 - 80,248,351 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 80,559,140 - 80,620,420 (-) NCBI MGSCv36 mm8 Celera 8 81,946,457 - 82,007,225 (-) NCBI Celera Cytogenetic Map 8 C1 NCBI cM Map 8 36.63 NCBI
Ednra Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955428 3,062,303 - 3,114,761 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955428 3,062,303 - 3,114,761 (+) NCBI ChiLan1.0 ChiLan1.0
EDNRA Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 145,349,200 - 145,415,071 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 145,714,744 - 145,780,615 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 139,815,336 - 139,879,600 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 151,476,353 - 151,536,497 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 151,476,356 - 151,536,497 (+) Ensembl panpan1.1 panPan2
EDNRA Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 45,823,472 - 45,878,527 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 45,823,560 - 45,876,463 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 46,219,878 - 46,270,714 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 46,496,528 - 46,553,179 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 46,496,502 - 46,554,470 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 45,768,959 - 45,819,737 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 45,864,678 - 45,915,481 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 46,175,034 - 46,225,816 (+) NCBI UU_Cfam_GSD_1.0
Ednra Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405301 44,512,782 - 44,568,451 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936535 1,949,941 - 2,005,910 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936535 1,950,117 - 2,005,786 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
EDNRA Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 81,209,327 - 81,276,853 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 81,210,750 - 81,279,053 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 86,293,177 - 86,319,721 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
EDNRA Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 93,980,983 - 94,043,863 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 93,985,797 - 94,042,296 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 73,678,428 - 73,748,330 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ednra
.
Predicted Target Of
Count of predictions: 386 Count of miRNA genes: 211 Interacting mature miRNAs: 276 Transcripts: ENSRNOT00000058162 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
1549847 Bss8 Bone structure and strength QTL 8 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 19 1 31963836 Rat 61447 Tcas1 Tongue tumor susceptibility QTL 1 6.08 tongue integrity trait (VT:0010553) squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875) 19 2316121 47316121 Rat 9590298 Uminl5 Urine mineral level QTL 5 3.59 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 19 1 36824771 Rat 724546 Kidm3 Kidney mass QTL 3 3.1 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 19 29322490 57337602 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 2298478 Eau8 Experimental allergic uveoretinitis QTL 8 0.0163 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 19 17154433 57337602 Rat 61328 Eae8 Experimental allergic encephalomyelitis QTL 8 4 nervous system integrity trait (VT:0010566) percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047) 19 24816041 33061905 Rat 1578764 Stresp19 Stress response QTL 19 3.6 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 19 15630201 57337602 Rat 1558656 Prcs1 Prostate cancer susceptibility QTL 1 5 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 19 15114598 34521833 Rat 9590090 Insglur8 Insulin/glucose ratio QTL 8 10.81 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 19 1 36824771 Rat 1331788 Rf45 Renal function QTL 45 2.818 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 19 15605023 46559041 Rat 1549835 Tcas7 Tongue tumor susceptibility QTL 7 0.001 tongue integrity trait (VT:0010553) squamous cell carcinoma of the head and neck tumor number (CMO:0001876) 19 24817978 39654489 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat 1354633 Bw28 Body weight QTL 28 6.04 body mass (VT:0001259) body weight (CMO:0000012) 19 27530207 37947399 Rat 724565 Tcas5 Tongue tumor susceptibility QTL 5 10.04 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 19 9977753 39654489 Rat 61407 Scl12 Serum cholesterol level QTL 12 0.001 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 19 13926401 30303727 Rat 8552935 Pigfal10 Plasma insulin-like growth factor 1 level QTL 10 5.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 19 1 36824771 Rat 61350 Bp32 Blood pressure QTL 32 0.012 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 19 20483575 57337602 Rat 7411549 Bw130 Body weight QTL 130 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 15455860 57337602 Rat 724518 Uae19 Urinary albumin excretion QTL 19 5.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 7457249 42983518 Rat 8694186 Bw152 Body weight QTL 152 3.34 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 569374 45569374 Rat 61423 Cia14 Collagen induced arthritis QTL 14 3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 19 10827970 43544039 Rat 9590250 Scort11 Serum corticosterone level QTL 11 23.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 36824771 Rat 2317848 Alcrsp21 Alcohol response QTL 21 1.899999976158142 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 19 3204777 48204777 Rat 1354607 Gmadr1 Adrenal mass QTL 1 5.83 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 19 27530207 37947399 Rat 9589102 Slep13 Serum leptin concentration QTL 13 4.63 0.001 blood leptin amount (VT:0005667) plasma leptin level (CMO:0000781) 19 569374 45569374 Rat 7247442 Uae39 Urinary albumin excretion QTL 39 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 2187927 46708701 Rat 1354600 Salc2 Saline consumption QTL 2 9.91 0.001 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 19 27530207 37947399 Rat
D19Mco2
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 19 44,873,858 - 44,874,084 NCBI Rnor5.0 RGSC_v3.4 19 32,107,108 - 32,107,333 RGD RGSC3.4 RGSC_v3.1 19 32,111,934 - 32,112,159 RGD Cytogenetic Map 19 q11 UniSTS
RH127903
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 30,296,755 - 30,296,970 (+) MAPPER mRatBN7.2 Rnor_6.0 19 33,991,410 - 33,991,624 NCBI Rnor6.0 Rnor_5.0 19 44,874,611 - 44,874,825 UniSTS Rnor5.0 RGSC_v3.4 19 32,107,860 - 32,108,074 UniSTS RGSC3.4 Celera 19 29,778,550 - 29,778,764 UniSTS Cytogenetic Map 19 q11 UniSTS
RH141089
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 30,295,676 - 30,295,891 (+) MAPPER mRatBN7.2 Rnor_6.0 19 33,990,331 - 33,990,545 NCBI Rnor6.0 Rnor_5.0 19 44,873,532 - 44,873,746 UniSTS Rnor5.0 RGSC_v3.4 19 32,106,781 - 32,106,995 UniSTS RGSC3.4 Celera 19 29,777,471 - 29,777,685 UniSTS RH 3.4 Map 19 231.2 UniSTS Cytogenetic Map 19 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000058162 ⟹ ENSRNOP00000054967
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 30,233,692 - 30,297,049 (+) Ensembl Rnor_6.0 Ensembl 19 33,928,356 - 33,991,703 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000078395 ⟹ ENSRNOP00000072294
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 30,237,576 - 30,294,075 (+) Ensembl Rnor_6.0 Ensembl 19 33,932,532 - 33,988,729 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000078701 ⟹ ENSRNOP00000069839
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 30,237,576 - 30,294,075 (+) Ensembl Rnor_6.0 Ensembl 19 33,932,532 - 33,988,729 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000080095 ⟹ ENSRNOP00000071866
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 19 33,931,719 - 33,988,877 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000080317 ⟹ ENSRNOP00000071667
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 30,233,571 - 30,297,049 (+) Ensembl Rnor_6.0 Ensembl 19 33,932,558 - 33,988,196 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000091985 ⟹ ENSRNOP00000073963
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 30,237,576 - 30,294,075 (+) Ensembl Rnor_6.0 Ensembl 19 33,932,532 - 33,988,729 (+) Ensembl
RefSeq Acc Id:
NM_012550 ⟹ NP_036682
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 47,137,924 - 47,201,285 (+) NCBI mRatBN7.2 19 30,233,692 - 30,297,049 (+) NCBI Rnor_6.0 19 33,928,356 - 33,991,703 (+) NCBI Rnor_5.0 19 44,812,252 - 44,874,904 (+) NCBI RGSC_v3.4 19 32,042,366 - 32,108,153 (+) RGD Celera 19 29,719,589 - 29,778,843 (+) RGD
Sequence:
CTCTGGTCTGGCAGCTGTGTCTAAAGAGGTGGGGAGCCTCTCTCTGATCCAACGGACCATCGCAGGAGCTTGCAGGCTGAGCGAGATCTCCTCTAGAGAAGCCGGGCCGTCCTGGGAAGTTTCCTCCA
hide sequence
RefSeq Acc Id:
XM_039097468 ⟹ XP_038953396
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 47,137,360 - 47,201,285 (+) NCBI mRatBN7.2 19 30,233,540 - 30,293,865 (+) NCBI
RefSeq Acc Id:
XR_005496613
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 47,137,360 - 47,207,961 (+) NCBI mRatBN7.2 19 30,233,543 - 30,303,727 (+) NCBI
RefSeq Acc Id:
NP_036682 ⟸ NM_012550
- Peptide Label:
precursor
- UniProtKB:
P26684 (UniProtKB/Swiss-Prot), A0A0G2JSX5 (UniProtKB/TrEMBL)
- Sequence:
MGVLCFLASFWLALVGGAIADNAERYSANLSSHVEDFTPFPGTEFDFLGTTLRPPNLALPSNGSMHGYCPQQTKITTAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLI
hide sequence
Ensembl Acc Id:
ENSRNOP00000071667 ⟸ ENSRNOT00000080317
Ensembl Acc Id:
ENSRNOP00000071866 ⟸ ENSRNOT00000080095
Ensembl Acc Id:
ENSRNOP00000072294 ⟸ ENSRNOT00000078395
Ensembl Acc Id:
ENSRNOP00000054967 ⟸ ENSRNOT00000058162
Ensembl Acc Id:
ENSRNOP00000073963 ⟸ ENSRNOT00000091985
Ensembl Acc Id:
ENSRNOP00000069839 ⟸ ENSRNOT00000078701
RefSeq Acc Id:
XP_038953396 ⟸ XM_039097468
- Peptide Label:
isoform X1
- UniProtKB:
P26684 (UniProtKB/Swiss-Prot), A1Y2B8 (UniProtKB/TrEMBL)
BioCyc Gene G2FUF-5916 BioCyc
Ensembl Genes ENSRNOG00000012721 Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000058162 ENTREZGENE
ENSRNOT00000058162.4 UniProtKB/TrEMBL
ENSRNOT00000078395.2 UniProtKB/TrEMBL
ENSRNOT00000078701.2 UniProtKB/TrEMBL
ENSRNOT00000080317.2 UniProtKB/TrEMBL
ENSRNOT00000091985.2 UniProtKB/TrEMBL
Gene3D-CATH Rhodopsin 7-helix transmembrane proteins UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro Endthln_rcpt UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
ETA_rcpt UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
GPCR_endothelin_rcpt UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
GPCR_Rhodpsn UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
GPCR_Rhodpsn_7TM UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:24326 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene 24326 ENTREZGENE
PANTHER ENDOTHELIN-1 RECEPTOR UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
G_PROTEIN_RECEP_F1_2 DOMAIN-CONTAINING PROTEIN UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam 7tm_1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Ednra PhenoGen
PRINTS ENDOTHELINAR UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
ENDOTHELINR UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
GPCRRHODOPSN UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE G_PROTEIN_RECEP_F1_1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
G_PROTEIN_RECEP_F1_2 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx ENSRNOG00000012721 RatGTEx
Superfamily-SCOP Family A G protein-coupled receptor-like UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR TC215722
UniProt A0A0G2JSX5 ENTREZGENE, UniProtKB/TrEMBL
A0A0G2K118_RAT UniProtKB/TrEMBL
A1Y2B8 ENTREZGENE, UniProtKB/TrEMBL
A1Y2R7_RAT UniProtKB/TrEMBL
A1Y2R8_RAT UniProtKB/TrEMBL
A1Y2R9_RAT UniProtKB/TrEMBL
A6IYK2_RAT UniProtKB/TrEMBL
EDNRA_RAT UniProtKB/Swiss-Prot, ENTREZGENE
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-03-29
Ednra
endothelin receptor type A
LOC100366209
endothelin-1 receptor-like
Data merged from RGD:2324049
737654 PROVISIONAL
2013-03-29
Ednra
endothelin receptor type A
RGD1559432
RGD1559432
Data merged from RGD:1559432
737654 PROVISIONAL
2010-05-06
LOC100366209
endothelin-1 receptor-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2008-04-30
RGD1559432
RGD1559432
RGD1559432_predicted
RGD1559432 (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-07
RGD1559432_predicted
RGD1559432 (predicted)
LOC498937
LOC498937
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC498937
LOC498937
Symbol and Name status set to provisional
70820 PROVISIONAL
2002-06-10
Ednra
Endothelin receptor type A
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
expressed in vascular and nonvascular tissues
628459
gene_expression
expressed in vascular and nonvascular tissues
628515
gene_expression
expressed in vascular and nonvascular tissues
628516
gene_expression
not expressed in Spontaneously hypertensive rat hearts but was expressed in salt-hypertensive sensitive and resistant rats fed a high-salt diet
1358986
gene_product
member of the endothelian family
628516
