Symbol:
Hdac2
Name:
histone deacetylase 2
RGD ID:
619976
Description:
Enables several functions, including DNA-binding transcription factor binding activity; heat shock protein binding activity; and promoter-specific chromatin binding activity. Involved in several processes, including behavioral response to ethanol; positive regulation of cell differentiation; and regulation of macromolecule metabolic process. Located in chromatin. Used to study Peyronie's disease; alcohol use disorder; and anxiety disorder. Biomarker of anxiety disorder; bronchitis; chronic obstructive pulmonary disease (multiple); endometriosis; and fetal alcohol spectrum disorder. Human ortholog(s) of this gene implicated in stomach cancer. Orthologous to human HDAC2 (histone deacetylase 2); PARTICIPATES IN CHD family mediated chromatin remodeling pathway; Hedgehog signaling pathway; histone modification pathway; INTERACTS WITH (S)-nicotine; 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane; 1,2-dimethylhydrazine.
Type:
protein-coding
RefSeq Status:
VALIDATED
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
HDAC2 (histone deacetylase 2) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Hdac2 (histone deacetylase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Hdac2 (histone deacetylase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
HDAC2 (histone deacetylase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
HDAC2 (histone deacetylase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Hdac2 (histone deacetylase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
HDAC2 (histone deacetylase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
HDAC2 (histone deacetylase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Hdac2 (histone deacetylase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PIP4K2A (phosphatidylinositol-5-phosphate 4-kinase type 2 alpha) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
HDAC2 (histone deacetylase 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Hdac2 (histone deacetylase 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
hda-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
HDAC1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RPD3
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
hda-3
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
hdac2
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 42,101,815 - 42,126,486 (+) NCBI GRCr8 mRatBN7.2 20 40,548,244 - 40,571,609 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 40,548,250 - 40,571,609 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 42,287,370 - 42,310,647 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 41,946,582 - 41,969,860 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 42,695,816 - 42,719,094 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 43,084,870 - 43,108,198 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 43,084,870 - 43,108,198 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 44,811,967 - 44,835,337 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 41,162,093 - 41,186,492 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 41,204,917 - 41,209,275 (+) NCBI Celera 20 41,298,790 - 41,322,159 (+) NCBI Celera Cytogenetic Map 20 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hdac2 Rat (1->4)-beta-D-glucan multiple interactions ISO Hdac2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of HDAC2 mRNA CTD PMID:36331819 Hdac2 Rat (20S)-ginsenoside Rh2 decreases expression ISO HDAC2 (Homo sapiens) 6480464 ginsenoside Rh2 results in decreased expression of HDAC2 protein CTD PMID:26482938 Hdac2 Rat (S)-nicotine increases expression EXP 6480464 Nicotine results in increased expression of HDAC2 mRNA and Nicotine results in increased expression of HDAC2 protein CTD PMID:24709674 more ... Hdac2 Rat (S)-nicotine multiple interactions EXP 6480464 SNAI1 protein affects the reaction [Nicotine results in increased expression of HDAC2 mRNA] and SNAI1 protein affects the reaction [Nicotine results in increased expression of HDAC2 protein] CTD PMID:34245815 Hdac2 Rat (S)-nicotine decreases expression ISO Hdac2 (Mus musculus) 6480464 Nicotine results in decreased expression of HDAC2 protein CTD PMID:31507073 Hdac2 Rat (S)-nicotine increases expression ISO HDAC2 (Homo sapiens) 6480464 Nicotine results in increased expression of HDAC2 mRNA CTD PMID:24709674 Hdac2 Rat 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane multiple interactions EXP 6480464 2 more ... CTD PMID:19414516 Hdac2 Rat 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of HDAC2 mRNA CTD PMID:32387197 Hdac2 Rat 15-deoxy-Delta(12,14)-prostaglandin J2 decreases expression ISO HDAC2 (Homo sapiens) 6480464 15-deoxy-delta(12 and 14)-prostaglandin J2 results in decreased expression of HDAC2 mRNA CTD PMID:21957481 Hdac2 Rat 17alpha-ethynylestradiol affects expression ISO Hdac2 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of HDAC2 mRNA CTD PMID:17555576 Hdac2 Rat 17alpha-ethynylestradiol increases expression ISO Hdac2 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of HDAC2 mRNA CTD PMID:17942748 Hdac2 Rat 17alpha-ethynylestradiol multiple interactions ISO Hdac2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HDAC2 mRNA CTD PMID:17942748 Hdac2 Rat 17beta-estradiol affects expression ISO HDAC2 (Homo sapiens) 6480464 Estradiol affects the expression of HDAC2 mRNA CTD PMID:22952798 Hdac2 Rat 17beta-estradiol multiple interactions ISO HDAC2 (Homo sapiens) 6480464 Estradiol inhibits the reaction [sodium arsenite results in increased expression of HDAC2 mRNA] CTD PMID:22952798 Hdac2 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Hdac2 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Hdac2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Hdac2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of HDAC2 mRNA CTD PMID:19770486 and PMID:24058054 Hdac2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of HDAC2 mRNA CTD PMID:33387578 Hdac2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Hdac2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of HDAC2 mRNA CTD PMID:21570461 Hdac2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Hdac2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of HDAC2 mRNA CTD PMID:17942748 Hdac2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Hdac2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HDAC2 mRNA CTD PMID:17942748 Hdac2 Rat 3',5'-cyclic AMP multiple interactions EXP 6480464 2 more ... CTD PMID:19414516 Hdac2 Rat 3,3'-diindolylmethane decreases expression ISO HDAC2 (Homo sapiens) 6480464 3 and 3'-diindolylmethane results in decreased expression of HDAC2 protein CTD PMID:22800507 Hdac2 Rat 3,3'-diindolylmethane multiple interactions ISO Hdac2 (Mus musculus) 6480464 3 more ... CTD PMID:24200994 Hdac2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Hdac2 (Mus musculus) 6480464 [INS1 protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine] inhibits the reaction [TGFB1 protein results in increased expression of HDAC2 protein] CTD PMID:27396813 Hdac2 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of HDAC2 mRNA CTD PMID:19162173 Hdac2 Rat 4,4'-sulfonyldiphenol increases expression ISO Hdac2 (Mus musculus) 6480464 bisphenol S results in increased expression of HDAC2 mRNA CTD PMID:39298647 Hdac2 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of HDAC2 mRNA CTD PMID:36041667 Hdac2 Rat 5-aza-2'-deoxycytidine decreases expression ISO HDAC2 (Homo sapiens) 6480464 Decitabine results in decreased expression of HDAC2 mRNA CTD PMID:17908484 Hdac2 Rat 5-fluorouracil multiple interactions ISO Hdac2 (Mus musculus) 6480464 [HDAC1 protein co-treated with HDAC2 protein] promotes the reaction [TCF7L2 protein inhibits the reaction [Fluorouracil results in decreased expression of MBP mRNA]] more ... CTD PMID:25178657 Hdac2 Rat 5-fluorouracil increases response to substance ISO HDAC2 (Homo sapiens) 6480464 HDAC2 protein results in increased susceptibility to Fluorouracil CTD PMID:35608750 Hdac2 Rat acetic acid increases expression ISO HDAC2 (Homo sapiens) 6480464 Acetic Acid results in increased expression of HDAC2 mRNA CTD PMID:35750087 Hdac2 Rat aconitine decreases expression EXP 6480464 Aconitine results in decreased expression of HDAC2 protein CTD PMID:33236894 Hdac2 Rat acrolein affects binding ISO HDAC2 (Homo sapiens) 6480464 Acrolein binds to HDAC2 protein CTD PMID:26481333 Hdac2 Rat adenine decreases expression EXP 6480464 Adenine results in decreased expression of HDAC2 protein CTD PMID:35753429 Hdac2 Rat aflatoxin B1 decreases expression ISO Hdac2 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of HDAC2 mRNA CTD PMID:19770486 Hdac2 Rat all-trans-retinoic acid decreases expression ISO HDAC2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of HDAC2 mRNA CTD PMID:33167477 Hdac2 Rat ammonium chloride increases expression EXP 6480464 Ammonium Chloride results in increased expression of HDAC2 protein CTD PMID:16483693 Hdac2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of HDAC2 mRNA CTD PMID:16483693 Hdac2 Rat antimycin A decreases expression ISO HDAC2 (Homo sapiens) 6480464 Antimycin A results in decreased expression of HDAC2 mRNA CTD PMID:33512557 Hdac2 Rat aristolochic acid A decreases expression ISO HDAC2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of HDAC2 mRNA CTD PMID:33212167 Hdac2 Rat Aroclor 1254 decreases expression ISO Hdac2 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of HDAC2 mRNA CTD PMID:23650126 Hdac2 Rat arsenite(3-) multiple interactions ISO Hdac2 (Mus musculus) 6480464 [arsenite co-treated with Benzo(a)pyrene] results in decreased expression of HDAC2 mRNA CTD PMID:15894712 Hdac2 Rat arsenite(3-) decreases expression ISO Hdac2 (Mus musculus) 6480464 arsenite results in decreased expression of HDAC2 mRNA CTD PMID:15894712 Hdac2 Rat arsenous acid affects expression ISO HDAC2 (Homo sapiens) 6480464 Arsenic Trioxide affects the expression of HDAC2 mRNA CTD PMID:25574600 Hdac2 Rat arsenous acid increases methylation ISO HDAC2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased methylation of HDAC2 promoter CTD PMID:26046465 Hdac2 Rat azoxystrobin decreases expression ISO HDAC2 (Homo sapiens) 6480464 azoxystrobin results in decreased expression of HDAC2 mRNA CTD PMID:33512557 Hdac2 Rat benzo[a]pyrene decreases expression ISO Hdac2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of HDAC2 mRNA CTD PMID:15894712 Hdac2 Rat benzo[a]pyrene affects methylation ISO HDAC2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of HDAC2 3' UTR CTD PMID:27901495 Hdac2 Rat benzo[a]pyrene increases expression ISO HDAC2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of HDAC2 mRNA CTD PMID:33411230 Hdac2 Rat benzo[a]pyrene increases expression ISO Hdac2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of HDAC2 mRNA CTD PMID:22228805 Hdac2 Rat benzo[a]pyrene multiple interactions ISO Hdac2 (Mus musculus) 6480464 [arsenite co-treated with Benzo(a)pyrene] results in decreased expression of HDAC2 mRNA CTD PMID:15894712 Hdac2 Rat berberine decreases expression ISO HDAC2 (Homo sapiens) 6480464 Berberine results in decreased expression of HDAC2 mRNA CTD PMID:27311644 Hdac2 Rat biphenyl-4-amine decreases expression ISO HDAC2 (Homo sapiens) 6480464 4-biphenylamine results in decreased expression of HDAC2 mRNA CTD PMID:32905825 Hdac2 Rat biphenyl-4-amine multiple interactions ISO HDAC2 (Homo sapiens) 6480464 TP53 protein inhibits the reaction [4-biphenylamine results in decreased expression of HDAC2 mRNA] CTD PMID:32905825 Hdac2 Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of HDAC2 protein CTD PMID:25280772 Hdac2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of HDAC2 mRNA more ... CTD PMID:23440186 more ... Hdac2 Rat bisphenol A decreases expression ISO HDAC2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of HDAC2 protein CTD PMID:37567409 Hdac2 Rat bisphenol A decreases expression ISO Hdac2 (Mus musculus) 6480464 bisphenol A results in decreased expression of HDAC2 mRNA CTD PMID:33221593 Hdac2 Rat bisphenol A affects expression ISO HDAC2 (Homo sapiens) 6480464 bisphenol A affects the expression of HDAC2 mRNA CTD PMID:33670352 Hdac2 Rat bisphenol A multiple interactions ISO Hdac2 (Mus musculus) 6480464 HDAC2 protein affects the reaction [bisphenol A results in decreased expression of CCND1 mRNA] more ... CTD PMID:34655688 and PMID:37372067 Hdac2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of HDAC2 mRNA and bisphenol A results in increased expression of HDAC2 protein CTD PMID:30816183 and PMID:34838597 Hdac2 Rat bisphenol A affects methylation ISO Hdac2 (Mus musculus) 6480464 bisphenol A affects the methylation of HDAC2 promoter CTD PMID:27334623 Hdac2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of HDAC2 mRNA CTD PMID:25181051 Hdac2 Rat bisphenol A increases expression ISO Hdac2 (Mus musculus) 6480464 bisphenol A results in increased expression of HDAC2 mRNA and bisphenol A results in increased expression of HDAC2 protein CTD PMID:24333847 more ... Hdac2 Rat Bisphenol B increases expression ISO HDAC2 (Homo sapiens) 6480464 bisphenol B results in increased expression of HDAC2 protein CTD PMID:34186270 Hdac2 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of HDAC2 mRNA CTD PMID:36041667 Hdac2 Rat bisphenol F increases expression ISO HDAC2 (Homo sapiens) 6480464 bisphenol F results in increased expression of HDAC2 protein CTD PMID:34186270 Hdac2 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of HDAC2 protein CTD PMID:28903499 Hdac2 Rat butanal decreases expression ISO HDAC2 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of HDAC2 mRNA CTD PMID:26079696 Hdac2 Rat butyric acid multiple interactions EXP 6480464 Butyric Acid inhibits the reaction [[Ethylene Glycol co-treated with Calcium Oxalate] results in increased expression of HDAC2 mRNA] CTD PMID:37414240 Hdac2 Rat butyric acid multiple interactions ISO HDAC2 (Homo sapiens) 6480464 Butyric Acid inhibits the reaction [Oxalic Acid results in increased expression of HDAC2 mRNA] CTD PMID:37414240 Hdac2 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of HDAC2 mRNA CTD PMID:19167457 Hdac2 Rat cadmium dichloride increases expression ISO HDAC2 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of HDAC2 mRNA CTD PMID:38382870 Hdac2 Rat caffeine increases expression EXP 6480464 Caffeine results in increased expression of HDAC2 mRNA CTD PMID:24717552 Hdac2 Rat calcium oxalate multiple interactions EXP 6480464 [Ethylene Glycol co-treated with Calcium Oxalate] results in increased expression of HDAC2 mRNA and Butyric Acid inhibits the reaction [[Ethylene Glycol co-treated with Calcium Oxalate] results in increased expression of HDAC2 mRNA] CTD PMID:37414240 Hdac2 Rat capsaicin increases expression EXP 6480464 Capsaicin results in increased expression of HDAC2 mRNA CTD PMID:16278290 Hdac2 Rat CGP 52608 multiple interactions ISO HDAC2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to HDAC2 gene] CTD PMID:28238834 Hdac2 Rat chlorpyrifos decreases expression ISO Hdac2 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of HDAC2 mRNA CTD PMID:37019170 Hdac2 Rat choline multiple interactions ISO Hdac2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of HDAC2 gene CTD PMID:20938992 Hdac2 Rat coumarin increases phosphorylation ISO HDAC2 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of HDAC2 protein CTD PMID:35688186 Hdac2 Rat curcumin multiple interactions ISO HDAC2 (Homo sapiens) 6480464 Curcumin inhibits the reaction [Hydrogen Peroxide results in decreased activity of HDAC2 protein] more ... CTD PMID:18421014 Hdac2 Rat curcumin decreases expression ISO HDAC2 (Homo sapiens) 6480464 Curcumin analog results in decreased expression of HDAC2 mRNA CTD PMID:26409325 Hdac2 Rat cyclosporin A decreases expression ISO Hdac2 (Mus musculus) 6480464 Cyclosporine results in decreased expression of HDAC2 mRNA CTD PMID:19770486 Hdac2 Rat deoxynivalenol affects phosphorylation ISO Hdac2 (Mus musculus) 6480464 deoxynivalenol affects the phosphorylation of HDAC2 protein CTD PMID:23352502 Hdac2 Rat dexamethasone multiple interactions ISO Hdac2 (Mus musculus) 6480464 [HDAC1 protein co-treated with HDAC2 protein] affects the reaction [Dexamethasone results in decreased expression of CDON mRNA] more ... CTD PMID:27396813 and PMID:27645313 Hdac2 Rat dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of HDAC2 mRNA and Dexamethasone results in increased expression of HDAC2 protein CTD PMID:31518422 and PMID:32791177 Hdac2 Rat dexamethasone multiple interactions EXP 6480464 Dexamethasone promotes the reaction [HDAC2 protein binds to BDNF promoter] more ... CTD PMID:31518422 and PMID:32791177 Hdac2 Rat diarsenic trioxide increases methylation ISO HDAC2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased methylation of HDAC2 promoter CTD PMID:26046465 Hdac2 Rat diarsenic trioxide affects expression ISO HDAC2 (Homo sapiens) 6480464 Arsenic Trioxide affects the expression of HDAC2 mRNA CTD PMID:25574600 Hdac2 Rat Dibutyl phosphate affects expression ISO HDAC2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of HDAC2 mRNA CTD PMID:37042841 Hdac2 Rat dicrotophos decreases expression ISO HDAC2 (Homo sapiens) 6480464 dicrotophos results in decreased expression of HDAC2 mRNA CTD PMID:28302478 Hdac2 Rat diethylstilbestrol increases expression ISO Hdac2 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of HDAC2 mRNA CTD PMID:24316720 Hdac2 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of HDAC2 mRNA CTD PMID:21551480 Hdac2 Rat doxorubicin multiple interactions ISO HDAC2 (Homo sapiens) 6480464 Doxorubicin inhibits the reaction [HDAC2 protein binds to CCNE1 promoter] more ... CTD PMID:25124555 Hdac2 Rat doxorubicin decreases expression ISO HDAC2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of HDAC2 mRNA CTD PMID:29803840 Hdac2 Rat doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of HDAC2 protein CTD PMID:31545955 Hdac2 Rat endosulfan decreases expression ISO HDAC2 (Homo sapiens) 6480464 Endosulfan results in decreased expression of HDAC2 mRNA CTD PMID:30090376 Hdac2 Rat enzyme inhibitor multiple interactions ISO HDAC2 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of HDAC2 protein CTD PMID:23301498 Hdac2 Rat ethanol multiple interactions ISO Hdac2 (Mus musculus) 6480464 sodium propionate inhibits the reaction [Ethanol results in increased expression of HDAC2 mRNA] and sodium propionate inhibits the reaction [Ethanol results in increased expression of HDAC2 protein] CTD PMID:35639301 Hdac2 Rat ethanol increases expression ISO Hdac2 (Mus musculus) 6480464 Ethanol results in increased expression of HDAC2 mRNA and Ethanol results in increased expression of HDAC2 protein CTD PMID:35639301 Hdac2 Rat ethylene glycol multiple interactions EXP 6480464 [Ethylene Glycol co-treated with Calcium Oxalate] results in increased expression of HDAC2 mRNA and Butyric Acid inhibits the reaction [[Ethylene Glycol co-treated with Calcium Oxalate] results in increased expression of HDAC2 mRNA] CTD PMID:37414240 Hdac2 Rat fenpyroximate decreases expression ISO HDAC2 (Homo sapiens) 6480464 fenpyroximate results in decreased expression of HDAC2 mRNA CTD PMID:33512557 Hdac2 Rat fenthion decreases expression ISO Hdac2 (Mus musculus) 6480464 Fenthion results in decreased expression of HDAC2 mRNA CTD PMID:34813904 Hdac2 Rat fluoxetine increases expression EXP 6480464 Fluoxetine results in increased expression of HDAC2 mRNA and Fluoxetine results in increased expression of HDAC2 protein CTD PMID:16670375 Hdac2 Rat fluoxetine multiple interactions ISO Hdac2 (Mus musculus) 6480464 Fluoxetine affects the reaction [sodium arsenate affects the expression of HDAC2 protein] CTD PMID:24952232 Hdac2 Rat folic acid multiple interactions ISO Hdac2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of HDAC2 gene CTD PMID:20938992 Hdac2 Rat FR900359 affects phosphorylation ISO HDAC2 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of HDAC2 protein CTD PMID:37730182 Hdac2 Rat fumaraldehyde affects expression ISO HDAC2 (Homo sapiens) 6480464 malealdehyde affects the expression of HDAC2 mRNA CTD PMID:35750087 Hdac2 Rat furan increases methylation EXP 6480464 furan results in increased methylation of HDAC2 gene CTD PMID:22079235 Hdac2 Rat genistein multiple interactions ISO HDAC2 (Homo sapiens) 6480464 [Genistein co-treated with sulforaphane] results in decreased expression of HDAC2 mRNA CTD PMID:29899271 Hdac2 Rat genistein decreases expression ISO HDAC2 (Homo sapiens) 6480464 Genistein results in decreased expression of HDAC2 mRNA CTD PMID:29899271 Hdac2 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of HDAC2 mRNA CTD PMID:24136188 Hdac2 Rat Honokiol multiple interactions ISO HDAC2 (Homo sapiens) 6480464 honokiol binds to and results in decreased activity of HDAC2 protein CTD PMID:34973135 Hdac2 Rat hydrogen peroxide multiple interactions ISO HDAC2 (Homo sapiens) 6480464 Curcumin inhibits the reaction [Hydrogen Peroxide results in decreased activity of HDAC2 protein] CTD PMID:18421014 Hdac2 Rat hydrogen peroxide decreases activity ISO HDAC2 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased activity of HDAC2 protein CTD PMID:18421014 Hdac2 Rat hydroquinone increases expression ISO HDAC2 (Homo sapiens) 6480464 hydroquinone results in increased expression of HDAC2 mRNA and hydroquinone results in increased expression of HDAC2 protein CTD PMID:27220438 and PMID:30448557 Hdac2 Rat hydroquinone multiple interactions ISO HDAC2 (Homo sapiens) 6480464 trichostatin A inhibits the reaction [hydroquinone results in increased expression of HDAC2 mRNA] CTD PMID:27220438 Hdac2 Rat hydroxamic acid multiple interactions ISO HDAC2 (Homo sapiens) 6480464 Hydroxamic Acids analog binds to and results in decreased activity of HDAC2 protein CTD PMID:19084294 Hdac2 Rat hydroxyurea multiple interactions ISO HDAC2 (Homo sapiens) 6480464 Hydroxyurea promotes the reaction [Valproic Acid results in decreased expression of HDAC2 protein] CTD PMID:17653085 Hdac2 Rat indole-3-methanol multiple interactions ISO Hdac2 (Mus musculus) 6480464 indole-3-carbinol inhibits the reaction [enterotoxin B and staphylococcal results in increased expression of HDAC2 mRNA] CTD PMID:24200994 Hdac2 Rat isoprenaline multiple interactions ISO Hdac2 (Mus musculus) 6480464 plantamajoside inhibits the reaction [Isoproterenol results in increased phosphorylation of HDAC2 protein] and Valsartan inhibits the reaction [Isoproterenol results in increased phosphorylation of HDAC2 protein] CTD PMID:31009642 Hdac2 Rat isoprenaline increases phosphorylation EXP 6480464 Isoproterenol results in increased phosphorylation of HDAC2 protein CTD PMID:31009642 Hdac2 Rat isoprenaline multiple interactions EXP 6480464 plantamajoside inhibits the reaction [Isoproterenol results in increased phosphorylation of HDAC2 protein] and Valsartan inhibits the reaction [Isoproterenol results in increased phosphorylation of HDAC2 protein] CTD PMID:31009642 Hdac2 Rat isoprenaline increases phosphorylation ISO Hdac2 (Mus musculus) 6480464 Isoproterenol results in increased phosphorylation of HDAC2 protein CTD PMID:31009642 Hdac2 Rat ivermectin decreases expression ISO HDAC2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of HDAC2 protein CTD PMID:32959892 Hdac2 Rat L-methionine multiple interactions ISO Hdac2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of HDAC2 gene CTD PMID:20938992 Hdac2 Rat lead diacetate increases expression ISO Hdac2 (Mus musculus) 6480464 lead acetate results in increased expression of HDAC2 protein CTD PMID:37797690 Hdac2 Rat lead diacetate multiple interactions ISO Hdac2 (Mus musculus) 6480464 HDAC2 protein promotes the reaction [lead acetate results in decreased expression of CKM mRNA] more ... CTD PMID:37797690 Hdac2 Rat lead(0) increases expression EXP 6480464 Lead results in increased expression of HDAC2 mRNA and Lead results in increased expression of HDAC2 protein CTD PMID:29301062 Hdac2 Rat lead(0) multiple interactions EXP 6480464 [HDAC1 protein co-treated with HDAC2 protein] inhibits the reaction [Lead results in decreased expression of NOTCH2 protein] more ... CTD PMID:29301062 Hdac2 Rat lead(0) affects expression ISO HDAC2 (Homo sapiens) 6480464 Lead affects the expression of HDAC2 mRNA CTD PMID:28903495 Hdac2 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of HDAC2 mRNA CTD PMID:29155171 Hdac2 Rat mechlorethamine multiple interactions EXP 6480464 Valproic Acid inhibits the reaction [Mechlorethamine results in increased expression of HDAC2 protein] CTD PMID:28184907 Hdac2 Rat mechlorethamine increases expression EXP 6480464 Mechlorethamine results in increased expression of HDAC2 protein CTD PMID:28184907 and PMID:33971176 Hdac2 Rat menadione affects expression ISO HDAC2 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of HDAC2 mRNA CTD PMID:20044591 Hdac2 Rat methoxyacetic acid decreases activity ISO HDAC2 (Homo sapiens) 6480464 methoxyacetic acid results in decreased activity of HDAC2 protein CTD PMID:15103026 Hdac2 Rat mifepristone increases expression ISO HDAC2 (Homo sapiens) 6480464 Mifepristone results in increased expression of HDAC2 mRNA CTD PMID:17584828 Hdac2 Rat mifepristone multiple interactions EXP 6480464 Mifepristone inhibits the reaction [Dexamethasone results in decreased expression of HDAC2 protein] more ... CTD PMID:31518422 and PMID:32791177 Hdac2 Rat mocetinostat decreases expression ISO HDAC2 (Homo sapiens) 6480464 mocetinostat results in decreased expression of HDAC2 protein CTD PMID:26378038 Hdac2 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO HDAC2 (Homo sapiens) 6480464 [SOD2 protein co-treated with benzyloxycarbonylleucyl-leucyl-leucine aldehyde] results in decreased expression of HDAC2 protein more ... CTD PMID:18421014 and PMID:24973648 Hdac2 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases ubiquitination ISO HDAC2 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased ubiquitination of HDAC2 protein CTD PMID:18421014 Hdac2 Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of HDAC2 mRNA CTD PMID:24136188 Hdac2 Rat nickel subsulfide increases expression EXP 6480464 nickel subsulfide results in increased expression of HDAC2 mRNA CTD PMID:21086188 Hdac2 Rat nicotine increases expression EXP 6480464 Nicotine results in increased expression of HDAC2 mRNA and Nicotine results in increased expression of HDAC2 protein CTD PMID:24709674 more ... Hdac2 Rat nicotine multiple interactions EXP 6480464 SNAI1 protein affects the reaction [Nicotine results in increased expression of HDAC2 mRNA] and SNAI1 protein affects the reaction [Nicotine results in increased expression of HDAC2 protein] CTD PMID:34245815 Hdac2 Rat nicotine decreases expression ISO Hdac2 (Mus musculus) 6480464 Nicotine results in decreased expression of HDAC2 protein CTD PMID:31507073 Hdac2 Rat nicotine increases expression ISO HDAC2 (Homo sapiens) 6480464 Nicotine results in increased expression of HDAC2 mRNA CTD PMID:24709674 Hdac2 Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of HDAC2 mRNA CTD PMID:24136188 Hdac2 Rat Nonylphenol multiple interactions ISO HDAC2 (Homo sapiens) 6480464 AHR protein affects the reaction [nonylphenol results in increased expression of HDAC2 mRNA] more ... CTD PMID:34974051 Hdac2 Rat Nonylphenol increases expression ISO HDAC2 (Homo sapiens) 6480464 nonylphenol results in increased expression of HDAC2 mRNA and nonylphenol results in increased expression of HDAC2 protein CTD PMID:34974051 Hdac2 Rat oxalic acid increases expression ISO HDAC2 (Homo sapiens) 6480464 Oxalic Acid results in increased expression of HDAC2 mRNA CTD PMID:37414240 Hdac2 Rat oxalic acid multiple interactions ISO HDAC2 (Homo sapiens) 6480464 Butyric Acid inhibits the reaction [Oxalic Acid results in increased expression of HDAC2 mRNA] CTD PMID:37414240 Hdac2 Rat oxybenzone increases expression EXP 6480464 oxybenzone results in increased expression of HDAC2 protein CTD PMID:31368502 Hdac2 Rat ozone increases expression ISO Hdac2 (Mus musculus) 6480464 [Ozone results in increased expression of HIF1A] which results in increased expression of HDAC2 CTD PMID:24040961 Hdac2 Rat ozone decreases expression EXP 6480464 Ozone results in decreased expression of HDAC2 mRNA CTD PMID:35737395 Hdac2 Rat ozone multiple interactions ISO Hdac2 (Mus musculus) 6480464 [Ovalbumin co-treated with Ozone] results in decreased expression of HDAC2 protein more ... CTD PMID:24040961 and PMID:34760922 Hdac2 Rat pelargonidin decreases expression ISO Hdac2 (Mus musculus) 6480464 pelargonidin results in decreased expression of HDAC2 protein CTD PMID:31181187 Hdac2 Rat perfluorohexanesulfonic acid increases expression ISO Hdac2 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of HDAC2 mRNA CTD PMID:37995155 Hdac2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Hdac2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of HDAC2 mRNA CTD PMID:36331819 Hdac2 Rat perfluorooctanoic acid decreases expression ISO HDAC2 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of HDAC2 protein CTD PMID:26879310 Hdac2 Rat picoxystrobin decreases expression ISO HDAC2 (Homo sapiens) 6480464 picoxystrobin results in decreased expression of HDAC2 mRNA CTD PMID:33512557 Hdac2 Rat Plantamajoside multiple interactions EXP 6480464 plantamajoside inhibits the reaction [Isoproterenol results in increased phosphorylation of HDAC2 protein] CTD PMID:31009642 Hdac2 Rat Plantamajoside multiple interactions ISO Hdac2 (Mus musculus) 6480464 plantamajoside inhibits the reaction [Isoproterenol results in increased phosphorylation of HDAC2 protein] CTD PMID:31009642 Hdac2 Rat resveratrol increases metabolic processing ISO HDAC2 (Homo sapiens) 6480464 resveratrol results in increased metabolism of HDAC2 protein CTD PMID:23463510 Hdac2 Rat resveratrol multiple interactions ISO HDAC2 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of HDAC2 mRNA CTD PMID:23557933 Hdac2 Rat resveratrol decreases expression EXP 6480464 resveratrol results in decreased expression of HDAC2 mRNA CTD PMID:25905778 Hdac2 Rat romidepsin multiple interactions EXP 6480464 romidepsin inhibits the reaction [Dexamethasone results in decreased expression of HDAC2 protein] CTD PMID:31518422 Hdac2 Rat rotenone decreases expression ISO HDAC2 (Homo sapiens) 6480464 Rotenone results in decreased expression of HDAC2 mRNA CTD PMID:29955902 and PMID:33512557 Hdac2 Rat sevoflurane multiple interactions EXP 6480464 Vorinostat inhibits the reaction [Sevoflurane results in increased expression of HDAC2 mRNA] and Vorinostat inhibits the reaction [Sevoflurane results in increased expression of HDAC2 protein] CTD PMID:30842370 Hdac2 Rat sevoflurane increases expression EXP 6480464 Sevoflurane results in increased expression of HDAC2 mRNA and Sevoflurane results in increased expression of HDAC2 protein CTD PMID:30842370 Hdac2 Rat sodium arsenate multiple interactions ISO Hdac2 (Mus musculus) 6480464 Fluoxetine affects the reaction [sodium arsenate affects the expression of HDAC2 protein] CTD PMID:24952232 Hdac2 Rat sodium arsenate increases expression ISO Hdac2 (Mus musculus) 6480464 sodium arsenate results in increased expression of HDAC2 mRNA and sodium arsenate results in increased expression of HDAC2 protein CTD PMID:21795629 and PMID:26193056 Hdac2 Rat sodium arsenate decreases expression ISO Hdac2 (Mus musculus) 6480464 sodium arsenate results in decreased expression of HDAC2 mRNA CTD PMID:21795629 Hdac2 Rat sodium arsenate affects expression ISO Hdac2 (Mus musculus) 6480464 sodium arsenate affects the expression of HDAC2 protein CTD PMID:24952232 Hdac2 Rat sodium arsenite multiple interactions ISO HDAC2 (Homo sapiens) 6480464 Estradiol inhibits the reaction [sodium arsenite results in increased expression of HDAC2 mRNA] CTD PMID:22952798 Hdac2 Rat sodium arsenite decreases expression ISO HDAC2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of HDAC2 mRNA CTD PMID:38568856 Hdac2 Rat sodium arsenite increases expression ISO Hdac2 (Mus musculus) 6480464 sodium arsenite results in increased expression of HDAC2 mRNA CTD PMID:19822182 Hdac2 Rat sodium arsenite increases expression ISO HDAC2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of HDAC2 mRNA CTD PMID:22952798 Hdac2 Rat sodium propionate multiple interactions ISO Hdac2 (Mus musculus) 6480464 sodium propionate inhibits the reaction [Ethanol results in increased expression of HDAC2 mRNA] and sodium propionate inhibits the reaction [Ethanol results in increased expression of HDAC2 protein] CTD PMID:35639301 Hdac2 Rat sulforaphane decreases expression ISO HDAC2 (Homo sapiens) 6480464 sulforaphane results in decreased expression of HDAC2 mRNA CTD PMID:29899271 and PMID:30684530 Hdac2 Rat sulforaphane multiple interactions ISO HDAC2 (Homo sapiens) 6480464 [Genistein co-treated with sulforaphane] results in decreased expression of HDAC2 mRNA CTD PMID:29899271 Hdac2 Rat tamoxifen affects expression ISO Hdac2 (Mus musculus) 6480464 Tamoxifen affects the expression of HDAC2 mRNA CTD PMID:17555576 Hdac2 Rat tamoxifen multiple interactions ISO HDAC2 (Homo sapiens) 6480464 Tamoxifen promotes the reaction [HDAC2 protein binds to FOXM1 promoter] CTD PMID:20208560 Hdac2 Rat tangeretin decreases expression ISO Hdac2 (Mus musculus) 6480464 tangeretin metabolite results in decreased expression of HDAC2 protein and tangeretin results in decreased expression of HDAC2 protein CTD PMID:37517432 Hdac2 Rat tebufenpyrad decreases expression ISO HDAC2 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of HDAC2 mRNA CTD PMID:33512557 Hdac2 Rat tetrachloromethane multiple interactions ISO Hdac2 (Mus musculus) 6480464 Carbon Tetrachloride deficiency inhibits the reaction [Carbon Tetrachloride results in increased expression of HDAC2 mRNA] and Carbon Tetrachloride deficiency inhibits the reaction [Carbon Tetrachloride results in increased expression of HDAC2 protein] CTD PMID:27396813 Hdac2 Rat tetrachloromethane increases expression ISO Hdac2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of HDAC2 mRNA and Carbon Tetrachloride results in increased expression of HDAC2 protein CTD PMID:27396813 and PMID:31919559 Hdac2 Rat theophylline increases expression ISO HDAC2 (Homo sapiens) 6480464 Theophylline results in increased expression of HDAC2 protein CTD PMID:15337792 Hdac2 Rat titanium dioxide decreases methylation ISO Hdac2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of HDAC2 gene and titanium dioxide results in decreased methylation of HDAC2 promoter CTD PMID:35295148 Hdac2 Rat trichostatin A decreases activity ISO HDAC2 (Homo sapiens) 6480464 trichostatin A results in decreased activity of HDAC2 protein CTD PMID:15103026 more ... Hdac2 Rat trichostatin A multiple interactions ISO HDAC2 (Homo sapiens) 6480464 trichostatin A inhibits the reaction [hydroquinone results in increased expression of HDAC2 mRNA] CTD PMID:27220438 Hdac2 Rat trichostatin A multiple interactions EXP 6480464 trichostatin A inhibits the reaction [bisphenol A results in increased expression of HDAC2 protein] CTD PMID:34838597 Hdac2 Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of HDAC2 protein CTD PMID:32519852 Hdac2 Rat triptonide decreases expression ISO Hdac2 (Mus musculus) 6480464 triptonide results in decreased expression of HDAC2 mRNA CTD PMID:33045310 Hdac2 Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of HDAC2 mRNA CTD PMID:24136188 Hdac2 Rat valproic acid multiple interactions ISO HDAC2 (Homo sapiens) 6480464 Hydroxyurea promotes the reaction [Valproic Acid results in decreased expression of HDAC2 protein] CTD PMID:17653085 Hdac2 Rat valproic acid multiple interactions EXP 6480464 Valproic Acid inhibits the reaction [Mechlorethamine results in increased expression of HDAC2 protein] CTD PMID:28184907 Hdac2 Rat valproic acid decreases activity ISO HDAC2 (Homo sapiens) 6480464 Valproic Acid results in decreased activity of HDAC2 protein CTD PMID:15103026 Hdac2 Rat valproic acid increases degradation ISO HDAC2 (Homo sapiens) 6480464 Valproic Acid results in increased degradation of HDAC2 protein CTD PMID:16294345 Hdac2 Rat valproic acid decreases expression ISO HDAC2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of HDAC2 mRNA and Valproic Acid results in decreased expression of HDAC2 protein CTD PMID:17653085 and PMID:24200999 Hdac2 Rat valsartan multiple interactions ISO Hdac2 (Mus musculus) 6480464 Valsartan inhibits the reaction [Isoproterenol results in increased phosphorylation of HDAC2 protein] CTD PMID:31009642 Hdac2 Rat valsartan multiple interactions EXP 6480464 Valsartan inhibits the reaction [Isoproterenol results in increased phosphorylation of HDAC2 protein] CTD PMID:31009642 Hdac2 Rat vorinostat multiple interactions ISO HDAC2 (Homo sapiens) 6480464 [vorinostat co-treated with monomethylarsonous acid] results in decreased expression of HDAC2 mRNA and vorinostat binds to and results in decreased activity of HDAC2 protein CTD PMID:19084294 and PMID:23891734 Hdac2 Rat vorinostat decreases expression ISO HDAC2 (Homo sapiens) 6480464 vorinostat results in decreased expression of HDAC2 protein CTD PMID:18850582 Hdac2 Rat vorinostat multiple interactions EXP 6480464 Vorinostat inhibits the reaction [Sevoflurane results in increased expression of HDAC2 mRNA] and Vorinostat inhibits the reaction [Sevoflurane results in increased expression of HDAC2 protein] CTD PMID:30842370
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) (20S)-ginsenoside Rh2 (ISO) (S)-nicotine (EXP,ISO) 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP) 1,2-dimethylhydrazine (EXP) 15-deoxy-Delta(12,14)-prostaglandin J2 (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3',5'-cyclic AMP (EXP) 3,3'-diindolylmethane (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) acetic acid (ISO) aconitine (EXP) acrolein (ISO) adenine (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) antimycin A (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsenite(3-) (ISO) arsenous acid (ISO) azoxystrobin (ISO) benzo[a]pyrene (ISO) berberine (ISO) biphenyl-4-amine (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) Brodifacoum (EXP) butanal (ISO) butyric acid (EXP,ISO) C60 fullerene (EXP) cadmium dichloride (ISO) caffeine (EXP) calcium oxalate (EXP) capsaicin (EXP) CGP 52608 (ISO) chlorpyrifos (ISO) choline (ISO) coumarin (ISO) curcumin (ISO) cyclosporin A (ISO) deoxynivalenol (ISO) dexamethasone (EXP,ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) diethylstilbestrol (ISO) diuron (EXP) doxorubicin (EXP,ISO) endosulfan (ISO) enzyme inhibitor (ISO) ethanol (ISO) ethylene glycol (EXP) fenpyroximate (ISO) fenthion (ISO) fluoxetine (EXP,ISO) folic acid (ISO) FR900359 (ISO) fumaraldehyde (ISO) furan (EXP) genistein (ISO) glafenine (EXP) Honokiol (ISO) hydrogen peroxide (ISO) hydroquinone (ISO) hydroxamic acid (ISO) hydroxyurea (ISO) indole-3-methanol (ISO) isoprenaline (EXP,ISO) ivermectin (ISO) L-methionine (ISO) lead diacetate (ISO) lead(0) (EXP,ISO) manganese(II) chloride (EXP) mechlorethamine (EXP) menadione (ISO) methoxyacetic acid (ISO) mifepristone (EXP,ISO) mocetinostat (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) nefazodone (EXP) nickel subsulfide (EXP) nicotine (EXP,ISO) nimesulide (EXP) Nonylphenol (ISO) oxalic acid (ISO) oxybenzone (EXP) ozone (EXP,ISO) pelargonidin (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) picoxystrobin (ISO) Plantamajoside (EXP,ISO) resveratrol (EXP,ISO) romidepsin (EXP) rotenone (ISO) sevoflurane (EXP) sodium arsenate (ISO) sodium arsenite (ISO) sodium propionate (ISO) sulforaphane (ISO) tamoxifen (ISO) tangeretin (ISO) tebufenpyrad (ISO) tetrachloromethane (ISO) theophylline (ISO) titanium dioxide (ISO) trichostatin A (EXP,ISO) Triptolide (EXP) triptonide (ISO) valdecoxib (EXP) valproic acid (EXP,ISO) valsartan (EXP,ISO) vorinostat (EXP,ISO)
Biological Process
behavioral response to ethanol (IEP) cardiac muscle cell development (ISO) cardiac muscle cell proliferation (ISO) cardiac muscle hypertrophy (IEP) cellular response to dopamine (IEP) cellular response to heat (IEP) cellular response to hydrogen peroxide (IDA) cellular response to retinoic acid (IEP) cellular response to transforming growth factor beta stimulus (IEP) cellular response to trichostatin A (ISO) chromatin organization (IEA) chromatin remodeling (IEA,ISO) circadian regulation of gene expression (ISO) dendrite development (ISO) embryonic digit morphogenesis (ISO) epidermal cell differentiation (ISO) eyelid development in camera-type eye (ISO) fungiform papilla formation (ISO) hair follicle placode formation (ISO) heterochromatin formation (IBA,IEA,ISO) hippocampus development (ISO) negative regulation of apoptotic process (ISO) negative regulation of canonical Wnt signaling pathway (ISO) negative regulation of cardiac muscle cell proliferation (ISO) negative regulation of dendritic spine development (IMP) negative regulation of DNA binding (IMP) negative regulation of DNA-templated transcription (IMP,ISO) negative regulation of intrinsic apoptotic signaling pathway (ISO) negative regulation of miRNA transcription (ISO) negative regulation of neuron projection development (IMP,ISO) negative regulation of peptidyl-lysine acetylation (IMP) negative regulation of transcription by competitive promoter binding (IEA,ISO) negative regulation of transcription by RNA polymerase II (IEA,ISO) neuron differentiation (ISO) odontogenesis of dentin-containing tooth (ISO) oligodendrocyte differentiation (ISO) positive regulation of cell population proliferation (IEA,IMP,ISO) positive regulation of DNA-binding transcription factor activity (ISO) positive regulation of epithelial to mesenchymal transition (IMP) positive regulation of interleukin-1 production (IMP) positive regulation of intracellular estrogen receptor signaling pathway (IEA,ISO) positive regulation of male mating behavior (IMP) positive regulation of oligodendrocyte differentiation (IMP,ISO) positive regulation of protein modification process (IMP) positive regulation of proteolysis (IEA,ISO) positive regulation of transcription by RNA polymerase II (IEA,ISO) positive regulation of tumor necrosis factor production (IMP) progesterone receptor signaling pathway (IEA,ISO) protein deacetylation (ISO) protein modification process (IMP) regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (ISO) regulation of protein deacetylation (ISO) regulation of sarcomere organization (ISO) response to alcohol (IEP) response to amphetamine (IEP) response to amyloid-beta (IEP) response to caffeine (IEP) response to cocaine (IEP) response to hyperoxia (IEP) response to lipopolysaccharide (IEP) response to nicotine (IEP) response to xenobiotic stimulus (IEP)
Cellular Component
chromatin (IDA,ISO) chromosome, telomeric region (IEA,ISO) cytoplasm (IEA,ISO) ESC/E(Z) complex (IEA,ISO) heterochromatin (ISO) histone deacetylase complex (IEA,ISO) nucleoplasm (IEA,ISO) nucleus (IEA,ISO) NuRD complex (IBA,IEA,ISO) protein-containing complex (IEA,ISO) replication fork (ISO) RNA polymerase II transcription repressor complex (ISO) Sin3-type complex (IEA,ISO) transcription regulator complex (ISO) transcription repressor complex (ISO)
Molecular Function
chromatin binding (ISO) chromatin DNA binding (ISO) deacetylase activity (IDA) DNA-binding transcription factor binding (IPI,ISO) enzyme binding (IEA,IPI,ISO) heat shock protein binding (IDA) histone binding (IEA,ISO) histone deacetylase activity (IBA,IEA,ISO) histone deacetylase activity, hydrolytic mechanism (IEA) histone deacetylase binding (IEA,ISO) histone decrotonylase activity (IEA,ISO) histone H4K16 deacetylase activity, hydrolytic mechanism (ISO) hydrolase activity (IEA) Krueppel-associated box domain binding (ISO) metal ion binding (IEA) NF-kappaB binding (IEA,ISO) promoter-specific chromatin binding (IDA) protein binding (IPI,ISO) protein de-2-hydroxyisobutyrylase activity (IEA,ISO) protein lysine deacetylase activity (IEA,ISO) protein lysine delactylase activity (IEA,ISO) RNA polymerase II cis-regulatory region sequence-specific DNA binding (ISO) RNA polymerase II-specific DNA-binding transcription factor binding (IEA,ISO) transcription coregulator binding (ISO) transcription corepressor binding (ISO) transcription factor binding (IPI)
1.
Upregulation of class II histone deacetylases mRNA during neural differentiation of cultured rat hippocampal progenitor cells.
Ajamian F, etal., Neurosci Lett 2003 Jul 31;346(1-2):57-60.
2.
Repression of 15-hydroxyprostaglandin dehydrogenase involves histone deacetylase 2 and snail in colorectal cancer.
Backlund MG, etal., Cancer Res. 2008 Nov 15;68(22):9331-7. doi: 10.1158/0008-5472.CAN-08-2893.
3.
DNA methyltransferase 3b regulates nerve growth factor-induced differentiation of PC12 cells by recruiting histone deacetylase 2.
Bai S, etal., Mol Cell Biol. 2005 Jan;25(2):751-66.
4.
Regulation of neuronal traits by a novel transcriptional complex.
Ballas N, etal., Neuron. 2001 Aug 16;31(3):353-65.
5.
The nucleosome remodeling and deacetylase complex in development and disease.
Basta J and Rauchman M, Transl Res. 2014 May 10. pii: S1931-5244(14)00166-2. doi: 10.1016/j.trsl.2014.05.003.
6.
Epigenetic suppression of neuroligin 1 underlies amyloid-induced memory deficiency.
Bie B, etal., Nat Neurosci. 2014 Feb;17(2):223-31. doi: 10.1038/nn.3618. Epub 2014 Jan 19.
7.
Fluoxetine and cocaine induce the epigenetic factors MeCP2 and MBD1 in adult rat brain.
Cassel S, etal., Mol Pharmacol. 2006 Aug;70(2):487-92. Epub 2006 May 2.
8.
Regulation of acetylation of histone deacetylase 2 by p300/CBP-associated factor/histone deacetylase 5 in the development of cardiac hypertrophy.
Eom GH, etal., Circ Res. 2014 Mar 28;114(7):1133-43. doi: 10.1161/CIRCRESAHA.114.303429. Epub 2014 Feb 13.
9.
Inhibition of HDAC2 protects the retina from ischemic injury.
Fan J, etal., Invest Ophthalmol Vis Sci. 2013 Jun 12;54(6):4072-80. doi: 10.1167/iovs.12-11529.
10.
Fetal Alcohol Exposure Reduces Dopamine Receptor D2 and Increases Pituitary Weight and Prolactin Production via Epigenetic Mechanisms.
Gangisetty O, etal., PLoS One. 2015 Oct 28;10(10):e0140699. doi: 10.1371/journal.pone.0140699. eCollection 2015.
11.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
12.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
13.
An epigenetic blockade of cognitive functions in the neurodegenerating brain.
Graff J, etal., Nature. 2012 Feb 29;483(7388):222-6. doi: 10.1038/nature10849.
14.
The expression of histone deacetylase 4 is associated with prednisone poor-response in childhood acute lymphoblastic leukemia.
Gruhn B, etal., Leuk Res. 2013 Oct;37(10):1200-7. doi: 10.1016/j.leukres.2013.07.016. Epub 2013 Aug 12.
15.
alpha2-Adrenoceptor agonist dexmedetomidine protects septic acute kidney injury through increasing BMP-7 and inhibiting HDAC2 and HDAC5.
Hsing CH, etal., Am J Physiol Renal Physiol. 2012 Nov 15;303(10):F1443-53. doi: 10.1152/ajprenal.00143.2012. Epub 2012 Aug 29.
16.
Increased expression of histone deacetylases 2 in temporal lobe epilepsy: a study of epileptic patients and rat models.
Huang Y, etal., Synapse. 2012 Feb;66(2):151-9. doi: 10.1002/syn.20995. Epub 2011 Nov 3.
17.
Histone deacetylase expression in white matter oligodendrocytes after stroke.
Kassis H, etal., Neurochem Int. 2014 Nov;77:17-23. doi: 10.1016/j.neuint.2014.03.006. Epub 2014 Mar 19.
18.
Activation of histone deacetylase 2 by inducible heat shock protein 70 in cardiac hypertrophy.
Kee HJ, etal., Circ Res. 2008 Nov 21;103(11):1259-69. Epub 2008 Oct 10.
19.
HDAC inhibition suppresses cardiac hypertrophy and fibrosis in DOCA-salt hypertensive rats via regulation of HDAC6/HDAC8 enzyme activity.
Kee HJ, etal., Kidney Blood Press Res. 2013;37(4-5):229-39. doi: 10.1159/000350148. Epub 2013 Jul 8.
20.
Drug-induced inactivation or gene silencing of class I histone deacetylases suppresses ovarian cancer cell growth: implications for therapy.
Khabele D, etal., Cancer Biol Ther. 2007 May;6(5):795-801. Epub 2007 Feb 14.
21.
Clinically relevant concentrations of valproic acid modulate melatonin MT(1) receptor, HDAC and MeCP2 mRNA expression in C6 glioma cells.
Kim B, etal., Eur J Pharmacol. 2008 Jul 28;589(1-3):45-8. Epub 2008 May 7.
22.
Targeted inactivation of HDAC2 restores p16INK4a activity and exerts antitumor effects on human gastric cancer.
Kim JK, etal., Mol Cancer Res. 2013 Jan;11(1):62-73. doi: 10.1158/1541-7786.MCR-12-0332. Epub 2012 Nov 21.
23.
Silencing histone deacetylase 2 using small hairpin RNA induces regression of fibrotic plaque in a rat model of Peyronie's disease.
Kwon KD, etal., BJU Int. 2014 May 19. doi: 10.1111/bju.12812.
24.
Effect of Quanzhenyiqitang on apoptosis of alveolar macrophages and expression of histone deacetylase 2 in rats with chronic obstructive pulmonary disease.
Li DZ, etal., Exp Ther Med. 2014 May;7(5):1327-1331. Epub 2014 Feb 25.
25.
Intravenous antagomiR-494 lessens brain-infiltrating neutrophils by increasing HDAC2-mediated repression of multiple MMPs in experimental stroke.
Li F, etal., FASEB J. 2020 May;34(5):6934-6949. doi: 10.1096/fj.201903127R. Epub 2020 Apr 2.
26.
Inhibition of histone deacetylase 2 expression by elevated glucocorticoid receptor beta in steroid-resistant asthma.
Li LB, etal., Am J Respir Crit Care Med. 2010 Oct 1;182(7):877-83. doi: 10.1164/rccm.201001-0015OC. Epub 2010 Jun 10.
27.
Combination of proteasome and HDAC inhibitors for uterine cervical cancer treatment.
Lin Z, etal., Clin Cancer Res. 2009 Jan 15;15(2):570-7.
28.
Epigenetic mechanisms in the dopamine D2 receptor-dependent inhibition of the prolactin gene.
Liu JC, etal., Mol Endocrinol. 2005 Jul;19(7):1904-17. Epub 2005 Feb 24.
29.
Angiotensin II induces cardiomyocyte hypertrophy probably through histone deacetylases.
Lu Y and Yang S, Tohoku J Exp Med. 2009 Sep;219(1):17-23.
30.
Histone deacetylases 1 and 3 but not 2 mediate cytokine-induced beta cell apoptosis in INS-1 cells and dispersed primary islets from rats and are differentially regulated in the islets of type 1 diabetic children.
Lundh M, etal., Diabetologia. 2012 Sep;55(9):2421-31. doi: 10.1007/s00125-012-2615-0. Epub 2012 Jul 7.
31.
Methamphetamine causes differential alterations in gene expression and patterns of histone acetylation/hypoacetylation in the rat nucleus accumbens.
Martin TA, etal., PLoS One. 2012;7(3):e34236. doi: 10.1371/journal.pone.0034236. Epub 2012 Mar 28.
32.
Histone deacetylation during brain development is essential for permanent masculinization of sexual behavior.
Matsuda KI, etal., Endocrinology. 2011 Jul;152(7):2760-7. doi: 10.1210/en.2011-0193. Epub 2011 May 17.
33.
All-trans retinoic acid increases KLF4 acetylation by inducing HDAC2 phosphorylation and its dissociation from KLF4 in vascular smooth muscle cells.
Meng F, etal., Biochem Biophys Res Commun. 2009 Sep 11;387(1):13-8. doi: 10.1016/j.bbrc.2009.05.112. Epub 2009 May 30.
34.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
35.
Aberrant histone deacetylase2-mediated histone modifications and synaptic plasticity in the amygdala predisposes to anxiety and alcoholism.
Moonat S, etal., Biol Psychiatry. 2013 Apr 15;73(8):763-73. doi: 10.1016/j.biopsych.2013.01.012. Epub 2013 Feb 26.
36.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
37.
Lipopolysaccharide induces up-regulation of TGF-alpha through HDAC2 in a rat model of bronchopulmonary dysplasia.
Ni W, etal., PLoS One. 2014 Mar 4;9(3):e91083. doi: 10.1371/journal.pone.0091083. eCollection 2014.
38.
Characteristic comparison of three rat models induced by cigarette smoke or combined with LPS: to establish a suitable model for study of airway mucus hypersecretion in chronic obstructive pulmonary disease.
Nie YC, etal., Pulm Pharmacol Ther. 2012 Oct;25(5):349-56. doi: 10.1016/j.pupt.2012.06.004. Epub 2012 Jun 23.
39.
Histone deacetylase-2 is a key regulator of diabetes- and transforming growth factor-beta1-induced renal injury.
Noh H, etal., Am J Physiol Renal Physiol. 2009 Sep;297(3):F729-39. doi: 10.1152/ajprenal.00086.2009. Epub 2009 Jun 24.
40.
HDAC2 provides a critical support to malignant progression of hepatocellular carcinoma through feedback control of mTORC1 and AKT.
Noh JH, etal., Cancer Res. 2014 Mar 15;74(6):1728-38. doi: 10.1158/0008-5472.CAN-13-2109. Epub 2014 Jan 21.
41.
S-Nitrosylation of histone deacetylase 2 induces chromatin remodelling in neurons.
Nott A, etal., Nature. 2008 Sep 18;455(7211):411-5. Epub 2008 Aug 27.
42.
Potential role of adolescent alcohol exposure-induced amygdaloid histone modifications in anxiety and alcohol intake during adulthood.
Pandey SC, etal., Neurobiol Dis. 2015 Oct;82:607-619. doi: 10.1016/j.nbd.2015.03.019. Epub 2015 Mar 24.
43.
Histone deacetylase 1/2 mediates proliferation of renal interstitial fibroblasts and expression of cell cycle proteins.
Pang M, etal., J Cell Biochem. 2011 Aug;112(8):2138-48. doi: 10.1002/jcb.23135.
44.
Physical and functional HAT/HDAC interplay regulates protein acetylation balance.
Peserico A and Simone C, J Biomed Biotechnol. 2011;2011:371832. doi: 10.1155/2011/371832. Epub 2010 Dec 5.
45.
Prenatal caffeine ingestion induces aberrant DNA methylation and histone acetylation of steroidogenic factor 1 and inhibits fetal adrenal steroidogenesis.
Ping J, etal., Toxicology. 2014 Jul 3;321:53-61. doi: 10.1016/j.tox.2014.03.011. Epub 2014 Apr 6.
46.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
47.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
48.
Chemopreventive effects of an HDAC2-selective inhibitor on rat colon carcinogenesis and APCmin/+ mouse intestinal tumorigenesis.
Ravillah D, etal., J Pharmacol Exp Ther. 2014 Jan;348(1):59-68. doi: 10.1124/jpet.113.208645. Epub 2013 Nov 11.
49.
GOA pipeline
RGD automated data pipeline
50.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
51.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
52.
A truncating mutation of HDAC2 in human cancers confers resistance to histone deacetylase inhibition.
Ropero S, etal., Nat Genet. 2006 May;38(5):566-9. Epub 2006 Apr 16.
53.
Increased expression of histone deacetylase 2 is found in human gastric cancer.
Song J, etal., APMIS. 2005 Apr;113(4):264-8.
54.
HDAC up-regulation in early colon field carcinogenesis is involved in cell tumorigenicity through regulation of chromatin structure.
Stypula-Cyrus Y, etal., PLoS One. 2013 May 28;8(5):e64600. doi: 10.1371/journal.pone.0064600. Print 2013.
55.
Low-dose theophylline restores corticosteroid responsiveness in rats with smoke-induced airway inflammation.
Sun X, etal., Can J Physiol Pharmacol. 2012 Jul;90(7):895-902. doi: 10.1139/y2012-079. Epub 2012 Jun 18.
56.
Histone deacetylase 4 selectively contributes to podocyte injury in diabetic nephropathy.
Wang X, etal., Kidney Int. 2014 Oct;86(4):712-25. doi: 10.1038/ki.2014.111. Epub 2014 Apr 9.
57.
Histone deacetylases 1, 2 and 3 are highly expressed in prostate cancer and HDAC2 expression is associated with shorter PSA relapse time after radical prostatectomy.
Weichert W, etal., Br J Cancer. 2008 Feb 12;98(3):604-10. Epub 2008 Jan 22.
58.
Expression of class I histone deacetylases indicates poor prognosis in endometrioid subtypes of ovarian and endometrial carcinomas.
Weichert W, etal., Neoplasia. 2008 Sep;10(9):1021-7.
59.
A comprehensive analysis of oxidative stress in the ozone-induced lung inflammation mouse model.
Wiegman CH, etal., Clin Sci (Lond). 2014 Mar;126(6):425-40. doi: 10.1042/CS20130039.
60.
Differential modulation of the oligodendrocyte transcriptome by sonic hedgehog and bone morphogenetic protein 4 via opposing effects on histone acetylation.
Wu M, etal., J Neurosci. 2012 May 9;32(19):6651-64. doi: 10.1523/JNEUROSCI.4876-11.2012.
61.
Prenatal nicotinic exposure suppresses fetal adrenal steroidogenesis via steroidogenic factor 1 (SF-1) deacetylation.
Yan YE, etal., Toxicol Appl Pharmacol. 2014 Jun 15;277(3):231-41. doi: 10.1016/j.taap.2014.03.019. Epub 2014 Apr 5.
62.
Fenretinide causes emphysema, which is prevented by sphingosine 1-phoshate.
Yasuo M, etal., PLoS One. 2013;8(1):e53927. doi: 10.1371/journal.pone.0053927. Epub 2013 Jan 11.
63.
DeltaNp73 modulates nerve growth factor-mediated neuronal differentiation through repression of TrkA.
Zhang J and Chen X, Mol Cell Biol. 2007 May;27(10):3868-80. Epub 2007 Mar 12.
64.
Quantitation of HDAC1 mRNA expression in invasive carcinoma of the breast*.
Zhang Z, etal., Breast Cancer Res Treat. 2005 Nov;94(1):11-6.
65.
Silencing of microRNA-494 inhibits the neurotoxic Th1 shift via regulating HDAC2-STAT4 cascade in ischaemic stroke.
Zhao H, etal., Br J Pharmacol. 2020 Jan;177(1):128-144. doi: 10.1111/bph.14852. Epub 2019 Nov 8.
66.
Histone deacetylation inhibition in pulmonary hypertension: therapeutic potential of valproic acid and suberoylanilide hydroxamic acid.
Zhao L, etal., Circulation. 2012 Jul 24;126(4):455-67. doi: 10.1161/CIRCULATIONAHA.112.103176. Epub 2012 Jun 18.
67.
Abnormal epigenetic modifications in peripheral blood mononuclear cells from patients with alopecia areata.
Zhao M, etal., Br J Dermatol. 2012 Feb;166(2):226-73. doi: 10.1111/j.1365-2133.2011.10646.x. Epub 2012 Jan 9.
68.
Levo-tetrahydropalmatine retards the growth of ectopic endometrial implants and alleviates generalized hyperalgesia in experimentally induced endometriosis in rats.
Zhao T, etal., Reprod Sci. 2011 Jan;18(1):28-45. doi: 10.1177/1933719110381928. Epub 2010 Sep 30.
69.
HDAC2 phosphorylation-dependent Klf5 deacetylation and RARalpha acetylation induced by RAR agonist switch the transcription regulatory programs of p21 in VSMCs.
Zheng B, etal., Cell Res. 2011 Oct;21(10):1487-508. doi: 10.1038/cr.2011.34. Epub 2011 Mar 8.
70.
Hyperoxia arrests alveolar development through suppression of histone deacetylases in neonatal rats.
Zhu L, etal., Pediatr Pulmonol. 2012 Mar;47(3):264-74. doi: 10.1002/ppul.21540. Epub 2011 Sep 8.
Hdac2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 42,101,815 - 42,126,486 (+) NCBI GRCr8 mRatBN7.2 20 40,548,244 - 40,571,609 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 40,548,250 - 40,571,609 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 42,287,370 - 42,310,647 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 41,946,582 - 41,969,860 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 42,695,816 - 42,719,094 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 43,084,870 - 43,108,198 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 43,084,870 - 43,108,198 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 44,811,967 - 44,835,337 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 41,162,093 - 41,186,492 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 41,204,917 - 41,209,275 (+) NCBI Celera 20 41,298,790 - 41,322,159 (+) NCBI Celera Cytogenetic Map 20 q12 NCBI
HDAC2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 113,933,028 - 113,971,148 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 113,933,028 - 114,011,308 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 114,254,192 - 114,292,312 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 114,364,019 - 114,399,047 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 114,368,619 - 114,398,967 NCBI Celera 6 114,998,693 - 115,033,733 (-) NCBI Celera Cytogenetic Map 6 q21 NCBI HuRef 6 111,834,121 - 111,869,161 (-) NCBI HuRef CHM1_1 6 114,520,179 - 114,555,225 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 115,116,117 - 115,154,233 (-) NCBI T2T-CHM13v2.0
Hdac2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 36,850,293 - 36,877,885 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 36,850,540 - 36,877,885 (+) Ensembl GRCm39 Ensembl GRCm38 10 36,974,297 - 37,001,889 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 36,974,544 - 37,001,889 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 36,694,350 - 36,721,694 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 36,663,960 - 36,691,304 (+) NCBI MGSCv36 mm8 Celera 10 37,867,952 - 37,895,247 (+) NCBI Celera Cytogenetic Map 10 B1 NCBI cM Map 10 19.44 NCBI
Hdac2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955526 2,728,377 - 2,759,707 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955526 2,739,099 - 2,759,640 (+) NCBI ChiLan1.0 ChiLan1.0
HDAC2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 133,936,717 - 133,967,655 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 131,832,186 - 131,863,124 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 111,731,139 - 111,761,826 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 115,802,367 - 115,833,004 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 115,802,367 - 115,833,004 (-) Ensembl panpan1.1 panPan2
HDAC2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 70,053,822 - 70,083,491 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 70,053,297 - 70,103,578 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 69,799,259 - 69,828,714 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 70,933,049 - 70,962,557 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 70,932,535 - 70,961,523 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 70,285,352 - 70,314,769 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 70,123,758 - 70,153,135 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 70,454,633 - 70,484,021 (-) NCBI UU_Cfam_GSD_1.0
Hdac2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 105,216,548 - 105,242,461 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936679 2,448,390 - 2,474,641 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936679 2,448,676 - 2,474,641 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HDAC2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 79,863,094 - 79,901,585 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 79,867,713 - 79,901,597 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 89,929,206 - 89,962,996 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HDAC2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 13 59,873,248 - 59,904,542 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 13 59,873,767 - 59,905,742 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 32,233,290 - 32,264,328 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hdac2
.
Predicted Target Of
Count of predictions: 382 Count of miRNA genes: 232 Interacting mature miRNAs: 261 Transcripts: ENSRNOT00000000742 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4889610 Pancm3 Pancreatic morphology QTL 3 3.75 0.001 pancreas mass (VT:0010144) pancreas wet weight (CMO:0000626) 20 17617832 47606836 Rat 2303587 Bw93 Body weight QTL 93 13 body mass (VT:0001259) body weight (CMO:0000012) 20 25106722 54435887 Rat 1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 2303626 Vencon10 Ventilatory control QTL 10 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 20 19190721 54435887 Rat 1598869 Memor6 Memory QTL 6 3.1 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 20 29244388 54435887 Rat 70158 Bp60 Blood pressure QTL 60 3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 20 31614284 44396023 Rat 7411652 Foco24 Food consumption QTL 24 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 11757515 54435887 Rat 1331747 Hrtrt16 Heart rate QTL 16 3.163 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 20 25209734 54435887 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 2303578 Gluco50 Glucose level QTL 50 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 20 25106722 54435887 Rat 2317880 Alcrsp25 Alcohol response QTL 25 2.3 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 17697550 54435887 Rat 9590092 Insglur9 Insulin/glucose ratio QTL 9 18.38 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 20 11757515 54435887 Rat 2300188 Bmd68 Bone mineral density QTL 68 6.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 20 25106722 54435887 Rat
RH127658
Rat Assembly Chr Position (strand) Source JBrowse RH 3.4 Map 4 649.61 UniSTS Cytogenetic Map 20 q12 UniSTS
RH136178
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 40,571,152 - 40,571,386 (-) MAPPER mRatBN7.2 Rnor_6.0 20 43,085,093 - 43,085,326 NCBI Rnor6.0 Rnor_5.0 20 44,812,190 - 44,812,423 UniSTS Rnor5.0 Cytogenetic Map 20 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000000742 ⟹ ENSRNOP00000000742
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 40,548,250 - 40,571,609 (+) Ensembl Rnor_6.0 Ensembl 20 43,084,870 - 43,108,198 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100766 ⟹ ENSRNOP00000094992
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 40,548,250 - 40,568,854 (+) Ensembl
RefSeq Acc Id:
NM_053447 ⟹ NP_445899
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 42,103,127 - 42,126,486 (+) NCBI mRatBN7.2 20 40,548,244 - 40,571,609 (+) NCBI Rnor_6.0 20 43,084,870 - 43,108,198 (-) NCBI Rnor_5.0 20 44,811,967 - 44,835,337 (-) NCBI RGSC_v3.4 20 41,162,093 - 41,186,492 (+) RGD Celera 20 41,298,790 - 41,322,159 (+) RGD
Sequence:
CGCGCGTCGGCGCCGCTGCCAACCCCGCTCTGCGATCTCGGGCCCTCCCGGCACCCGCTCGCCGTCCCGCTCCGGGCTGTCCTTGCTGCGAGGGCCGCCGCGCCCGCCGTCTCCCTCAGCCCTCTTGT
hide sequence
RefSeq Acc Id:
XM_063279578 ⟹ XP_063135648
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 42,101,815 - 42,126,312 (+) NCBI
RefSeq Acc Id:
XM_063279579 ⟹ XP_063135649
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 42,106,303 - 42,126,312 (+) NCBI
RefSeq Acc Id:
NP_445899 ⟸ NM_053447
- UniProtKB:
F7ENH8 (UniProtKB/TrEMBL), A6KID6 (UniProtKB/TrEMBL), A0A8I6AP99 (UniProtKB/TrEMBL)
- Sequence:
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000000742 ⟸ ENSRNOT00000000742
Ensembl Acc Id:
ENSRNOP00000094992 ⟸ ENSRNOT00000100766
RefSeq Acc Id:
XP_063135648 ⟸ XM_063279578
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AP99 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063135649 ⟸ XM_063279579
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6AP99 (UniProtKB/TrEMBL)
RGD ID: 13701645 Promoter ID: EPDNEW_R12169 Type: multiple initiation site Name: Hdac2_1 Description: histone deacetylase 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 43,108,204 - 43,108,264 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-08-07
Hdac2
histone deacetylase 2
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
expressed in embryonic rat hippocampal progenitors
704464
