Symbol:
Timp3
Name:
TIMP metallopeptidase inhibitor 3
RGD ID:
3865
Description:
Predicted to enable metalloendopeptidase inhibitor activity and zinc ion binding activity. Involved in several processes, including cellular response to peptide; mesenchymal cell differentiation involved in bone development; and negative regulation of vascular associated smooth muscle cell proliferation. Predicted to be located in basement membrane. Predicted to be active in extracellular matrix and extracellular space. Biomarker of sciatic neuropathy and type 2 diabetes mellitus. Human ortholog(s) of this gene implicated in Sorsby's fundus dystrophy; breast carcinoma; and urinary bladder cancer. Orthologous to human TIMP3 (TIMP metallopeptidase inhibitor 3); PARTICIPATES IN angiotensin II signaling pathway via AT2 receptor; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
metalloproteinase inhibitor 3; TIMP-3; tissue inhibitor of metalloproteinase 3; tissue inhibitor of metalloproteinase 3 (Sorsby fundus dystrophy, pseudoinflammatory); tissue inhibitor of metalloproteinases 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TIMP3 (TIMP metallopeptidase inhibitor 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Timp3 (tissue inhibitor of metalloproteinase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Timp3 (TIMP metallopeptidase inhibitor 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TIMP3 (TIMP metallopeptidase inhibitor 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TIMP3 (TIMP metallopeptidase inhibitor 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Timp3 (TIMP metallopeptidase inhibitor 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TIMP3 (TIMP metallopeptidase inhibitor 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TIMP3 (TIMP metallopeptidase inhibitor 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Timp3 (TIMP metallopeptidase inhibitor 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ABHD2 (abhydrolase domain containing 2, acylglycerol lipase) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Timp3 (tissue inhibitor of metalloproteinase 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
TIMP3 (TIMP metallopeptidase inhibitor 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
cri-2
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
Timp
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
timp3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 19,408,539 - 19,459,558 (-) NCBI GRCr8 mRatBN7.2 7 17,520,827 - 17,571,850 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 17,521,919 - 17,571,839 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 19,480,687 - 19,531,680 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 21,639,451 - 21,690,578 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 21,420,352 - 21,471,347 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 23,543,125 - 23,594,170 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 23,544,215 - 23,594,133 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 23,693,364 - 23,744,404 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 19,677,144 - 19,727,072 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 19,686,693 - 19,737,062 (-) NCBI Celera 7 14,761,240 - 14,810,915 (-) NCBI Celera Cytogenetic Map 7 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Timp3 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [Sulindac co-treated with epigallocatechin gallate] results in decreased expression of TIMP3 mRNA CTD PMID:12628509 Timp3 Rat (S)-nicotine multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [Nicotine co-treated with lipopolysaccharide and E. coli O26-B6] affects the expression of TIMP3 mRNA CTD PMID:18986645 Timp3 Rat (S)-nicotine multiple interactions ISO Timp3 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Timp3 Rat (S)-nicotine affects expression ISO TIMP3 (Homo sapiens) 6480464 Nicotine affects the expression of TIMP3 mRNA CTD PMID:18986645 Timp3 Rat 1,1-dichloroethene decreases expression ISO Timp3 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of TIMP3 mRNA CTD PMID:26682919 Timp3 Rat 1-chloro-2,4-dinitrobenzene increases expression ISO TIMP3 (Homo sapiens) 6480464 Dinitrochlorobenzene results in increased expression of TIMP3 mRNA CTD PMID:16314067 Timp3 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases expression ISO Timp3 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Timp3 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Timp3 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Timp3 Rat 17alpha-ethynylestradiol affects expression ISO Timp3 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of TIMP3 mRNA CTD PMID:17555576 Timp3 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of TIMP3 mRNA CTD PMID:15866537 and PMID:17351261 Timp3 Rat 17alpha-ethynylestradiol multiple interactions ISO Timp3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TIMP3 mRNA CTD PMID:17942748 Timp3 Rat 17alpha-ethynylestradiol increases expression ISO Timp3 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of TIMP3 mRNA CTD PMID:17942748 Timp3 Rat 17beta-estradiol multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [Estradiol binds to ESR2 protein] which results in increased expression of TIMP3 mRNA more ... CTD PMID:19619570 more ... Timp3 Rat 17beta-estradiol decreases expression ISO Timp3 (Mus musculus) 6480464 Estradiol results in decreased expression of TIMP3 mRNA CTD PMID:39298647 Timp3 Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of TIMP3 mRNA CTD PMID:32145629 Timp3 Rat 17beta-estradiol decreases expression ISO TIMP3 (Homo sapiens) 6480464 Estradiol results in decreased expression of TIMP3 mRNA CTD PMID:16474171 more ... Timp3 Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Timp3 (Mus musculus) 6480464 [Flame Retardants results in increased abundance of 2 more ... CTD PMID:38995820 Timp3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of TIMP3 mRNA CTD PMID:19619570 Timp3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of TIMP3 mRNA CTD PMID:34747641 Timp3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Timp3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TIMP3 mRNA CTD PMID:15034205 more ... Timp3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TIMP3 mRNA CTD PMID:20959002 more ... Timp3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Timp3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TIMP3 mRNA CTD PMID:19465110 and PMID:21570461 Timp3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO TIMP3 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of TIMP3 mRNA CTD PMID:12377990 and PMID:16697128 Timp3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Timp3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of TIMP3 mRNA CTD PMID:18172886 and PMID:18796159 Timp3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Timp3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of TIMP3 mRNA more ... CTD PMID:15034205 more ... Timp3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO TIMP3 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TIMP3 mRNA CTD PMID:19619570 Timp3 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Timp3 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Timp3 Rat 2-amino-2-deoxy-D-glucopyranose multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [Glucosamine co-treated with Chondroitin Sulfates co-treated with IL1B protein] results in increased expression of TIMP3 mRNA CTD PMID:17605605 Timp3 Rat 2-amino-2-deoxy-D-glucopyranose increases expression EXP 6480464 Glucosamine results in increased expression of TIMP3 mRNA CTD PMID:17109745 Timp3 Rat 2-amino-2-deoxy-D-glucopyranose multiple interactions EXP 6480464 Glucosamine inhibits the reaction [IL1B results in decreased expression of TIMP3 mRNA] and IL1B affects the reaction [Glucosamine results in increased expression of TIMP3 mRNA] CTD PMID:17109745 Timp3 Rat 2-butoxyethanol increases expression ISO Timp3 (Mus musculus) 6480464 n-butoxyethanol results in increased expression of TIMP3 mRNA CTD PMID:19812364 Timp3 Rat 2-hydroxypropanoic acid decreases expression ISO TIMP3 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of TIMP3 mRNA CTD PMID:30851411 Timp3 Rat 2-methoxyethanol increases expression EXP 6480464 methyl cellosolve results in increased expression of TIMP3 mRNA CTD PMID:21061450 Timp3 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Timp3 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO TIMP3 (Homo sapiens) 6480464 3 more ... CTD PMID:35618242 Timp3 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Timp3 (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of TIMP3 mRNA CTD PMID:16054899 Timp3 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of TIMP3 mRNA CTD PMID:28628672 Timp3 Rat 3-methylcholanthrene multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Methylcholanthrene] results in decreased expression of TIMP3 protein and [Diethylnitrosamine co-treated with Methylcholanthrene] results in increased methylation of TIMP3 gene CTD PMID:21163286 Timp3 Rat 4,4'-sulfonyldiphenol increases expression ISO Timp3 (Mus musculus) 6480464 bisphenol S results in increased expression of TIMP3 mRNA CTD PMID:30951980 Timp3 Rat 4,4'-sulfonyldiphenol affects expression ISO Timp3 (Mus musculus) 6480464 bisphenol S affects the expression of TIMP3 mRNA CTD PMID:39298647 Timp3 Rat 5-aza-2'-deoxycytidine increases expression ISO Timp3 (Mus musculus) 6480464 Decitabine results in increased expression of TIMP3 mRNA CTD PMID:27915011 Timp3 Rat 5-aza-2'-deoxycytidine affects methylation ISO TIMP3 (Homo sapiens) 6480464 Decitabine affects the methylation of TIMP3 promoter CTD PMID:17671114 Timp3 Rat 5-aza-2'-deoxycytidine multiple interactions ISO Timp3 (Mus musculus) 6480464 [[Decitabine co-treated with trichostatin A] affects the methylation of TIMP3 promoter] which affects the expression of TIMP3 mRNA CTD PMID:18836996 Timp3 Rat 5-aza-2'-deoxycytidine increases expression ISO TIMP3 (Homo sapiens) 6480464 Decitabine results in increased expression of TIMP3 mRNA CTD PMID:16367923 and PMID:19215824 Timp3 Rat 5-fluorouracil increases expression ISO TIMP3 (Homo sapiens) 6480464 Fluorouracil results in increased expression of TIMP3 mRNA CTD PMID:24737281 Timp3 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of TIMP3 mRNA CTD PMID:31881176 Timp3 Rat acrolein decreases expression ISO Timp3 (Mus musculus) 6480464 Acrolein results in decreased expression of TIMP3 mRNA CTD PMID:18006877 Timp3 Rat acrolein decreases expression ISO TIMP3 (Homo sapiens) 6480464 Acrolein results in decreased expression of TIMP3 mRNA CTD PMID:15531749 and PMID:21742783 Timp3 Rat acrolein multiple interactions ISO TIMP3 (Homo sapiens) 6480464 TIMP3 protein inhibits the reaction [Acrolein results in increased expression of MUC5AC mRNA] CTD PMID:15531749 Timp3 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of TIMP3 mRNA CTD PMID:28959563 Timp3 Rat aldehydo-D-glucosamine multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [Glucosamine co-treated with Chondroitin Sulfates co-treated with IL1B protein] results in increased expression of TIMP3 mRNA CTD PMID:17605605 Timp3 Rat aldehydo-D-glucosamine increases expression EXP 6480464 Glucosamine results in increased expression of TIMP3 mRNA CTD PMID:17109745 Timp3 Rat aldehydo-D-glucosamine multiple interactions EXP 6480464 Glucosamine inhibits the reaction [IL1B results in decreased expression of TIMP3 mRNA] and IL1B affects the reaction [Glucosamine results in increased expression of TIMP3 mRNA] CTD PMID:17109745 Timp3 Rat all-trans-retinoic acid increases expression ISO TIMP3 (Homo sapiens) 6480464 Tretinoin results in increased expression of TIMP3 mRNA CTD PMID:21934132 Timp3 Rat all-trans-retinoic acid multiple interactions ISO Timp3 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of TIMP3 mRNA CTD PMID:30951980 Timp3 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of TIMP3 mRNA CTD PMID:35163327 Timp3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of TIMP3 mRNA CTD PMID:16483693 Timp3 Rat amosite asbestos decreases expression ISO Timp3 (Mus musculus) 6480464 Asbestos and Amosite results in decreased expression of TIMP3 mRNA CTD PMID:23917077 Timp3 Rat ancitabine affects response to substance ISO TIMP3 (Homo sapiens) 6480464 TIMP3 protein affects the susceptibility to Ancitabine CTD PMID:18202788 Timp3 Rat aniline increases expression ISO Timp3 (Mus musculus) 6480464 aniline results in increased expression of TIMP3 mRNA CTD PMID:22016648 Timp3 Rat antirheumatic drug decreases expression ISO TIMP3 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of TIMP3 mRNA CTD PMID:24449571 Timp3 Rat arsane increases response to substance ISO TIMP3 (Homo sapiens) 6480464 TIMP3 promoter SNP results in increased susceptibility to Arsenic CTD PMID:36499314 Timp3 Rat arsenic atom increases response to substance ISO TIMP3 (Homo sapiens) 6480464 TIMP3 promoter SNP results in increased susceptibility to Arsenic CTD PMID:36499314 Timp3 Rat arsenous acid multiple interactions ISO Timp3 (Mus musculus) 6480464 Metformin inhibits the reaction [Arsenic Trioxide results in decreased expression of TIMP3 mRNA] CTD PMID:29095437 Timp3 Rat arsenous acid increases expression ISO TIMP3 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of TIMP3 mRNA CTD PMID:17530438 Timp3 Rat arsenous acid decreases expression ISO Timp3 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of TIMP3 mRNA CTD PMID:29095437 Timp3 Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of TIMP3 mRNA CTD PMID:36841081 Timp3 Rat Azoxymethane multiple interactions ISO Timp3 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of TIMP3 mRNA CTD PMID:29950665 Timp3 Rat belinostat decreases expression ISO TIMP3 (Homo sapiens) 6480464 belinostat results in decreased expression of TIMP3 mRNA CTD PMID:26272509 Timp3 Rat benzo[a]pyrene increases expression ISO Timp3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of TIMP3 mRNA CTD PMID:21569818 more ... Timp3 Rat benzo[a]pyrene increases methylation ISO Timp3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of TIMP3 intron CTD PMID:27901495 Timp3 Rat benzo[a]pyrene decreases expression ISO TIMP3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of TIMP3 mRNA CTD PMID:26238291 Timp3 Rat benzo[a]pyrene decreases expression ISO Timp3 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of TIMP3 mRNA CTD PMID:15034205 Timp3 Rat benzo[a]pyrene multiple interactions ISO Timp3 (Mus musculus) 6480464 AHR protein promotes the reaction [Benzo(a)pyrene results in decreased expression of TIMP3 mRNA] CTD PMID:15034205 Timp3 Rat benzo[a]pyrene diol epoxide I increases expression ISO TIMP3 (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Timp3 Rat benzo[e]pyrene increases methylation ISO TIMP3 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of TIMP3 intron CTD PMID:30157460 Timp3 Rat Benzo[k]fluoranthene increases expression ISO Timp3 (Mus musculus) 6480464 benzo(k)fluoranthene results in increased expression of TIMP3 mRNA CTD PMID:26377693 Timp3 Rat beta-D-glucosamine multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [Glucosamine co-treated with Chondroitin Sulfates co-treated with IL1B protein] results in increased expression of TIMP3 mRNA CTD PMID:17605605 Timp3 Rat beta-D-glucosamine increases expression EXP 6480464 Glucosamine results in increased expression of TIMP3 mRNA CTD PMID:17109745 Timp3 Rat beta-D-glucosamine multiple interactions EXP 6480464 Glucosamine inhibits the reaction [IL1B results in decreased expression of TIMP3 mRNA] and IL1B affects the reaction [Glucosamine results in increased expression of TIMP3 mRNA] CTD PMID:17109745 Timp3 Rat bis(2-ethylhexyl) phthalate increases expression ISO TIMP3 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of TIMP3 mRNA CTD PMID:31163220 Timp3 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Timp3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of TIMP3 mRNA CTD PMID:34319233 Timp3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TIMP3 mRNA CTD PMID:15866537 more ... Timp3 Rat bisphenol A increases methylation ISO TIMP3 (Homo sapiens) 6480464 bisphenol A results in increased methylation of TIMP3 gene and bisphenol A results in increased methylation of TIMP3 promoter CTD PMID:31610501 and PMID:32466334 Timp3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TIMP3 mRNA CTD PMID:34884472 Timp3 Rat bisphenol A multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of TIMP3 mRNA CTD PMID:28628672 Timp3 Rat bisphenol A increases expression ISO Timp3 (Mus musculus) 6480464 bisphenol A results in increased expression of TIMP3 mRNA CTD PMID:25594700 and PMID:35598803 Timp3 Rat bisphenol A decreases expression ISO TIMP3 (Homo sapiens) 6480464 bisphenol A results in decreased expression of TIMP3 mRNA CTD PMID:16474171 more ... Timp3 Rat bisphenol AF increases expression ISO TIMP3 (Homo sapiens) 6480464 bisphenol AF results in increased expression of TIMP3 protein CTD PMID:34186270 Timp3 Rat bisphenol F increases expression ISO Timp3 (Mus musculus) 6480464 bisphenol F results in increased expression of TIMP3 mRNA CTD PMID:30951980 Timp3 Rat bisphenol F multiple interactions ISO Timp3 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of TIMP3 mRNA CTD PMID:30951980 Timp3 Rat cadmium atom increases expression ISO TIMP3 (Homo sapiens) 6480464 Cadmium results in increased expression of TIMP3 mRNA CTD PMID:24376830 Timp3 Rat cadmium atom multiple interactions EXP 6480464 [[Cadmium Chloride results in increased abundance of Cadmium] which co-treated with hydroquinone] results in decreased expression of TIMP3 mRNA more ... CTD PMID:33188856 Timp3 Rat cadmium atom multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of TIMP3 mRNA CTD PMID:29741670 Timp3 Rat cadmium dichloride increases expression ISO TIMP3 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of TIMP3 mRNA CTD PMID:12160620 Timp3 Rat cadmium dichloride multiple interactions EXP 6480464 [[Cadmium Chloride results in increased abundance of Cadmium] which co-treated with hydroquinone] results in decreased expression of TIMP3 mRNA more ... CTD PMID:33188856 Timp3 Rat cadmium dichloride decreases expression ISO TIMP3 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of TIMP3 mRNA CTD PMID:38568856 Timp3 Rat cadmium dichloride multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of TIMP3 mRNA CTD PMID:29741670 Timp3 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of TIMP3 mRNA CTD PMID:25993096 Timp3 Rat calcitriol decreases expression ISO TIMP3 (Homo sapiens) 6480464 Calcitriol results in decreased expression of TIMP3 mRNA CTD PMID:16002434 Timp3 Rat calcitriol increases expression ISO TIMP3 (Homo sapiens) 6480464 Calcitriol results in increased expression of TIMP3 mRNA CTD PMID:26485663 Timp3 Rat candesartan decreases expression EXP 6480464 candesartan results in decreased expression of TIMP3 mRNA CTD PMID:19047581 Timp3 Rat capsaicin increases expression ISO TIMP3 (Homo sapiens) 6480464 Capsaicin results in increased expression of TIMP3 mRNA CTD PMID:21310942 Timp3 Rat capsaicin multiple interactions EXP 6480464 [Naproxen co-treated with Sumatriptan] inhibits the reaction [Capsaicin results in increased expression of TIMP3 protein] more ... CTD PMID:22150557 Timp3 Rat capsaicin increases expression EXP 6480464 Capsaicin results in increased expression of TIMP3 protein CTD PMID:22150557 Timp3 Rat carbon nanotube affects expression ISO Timp3 (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of TIMP3 mRNA CTD PMID:25554681 Timp3 Rat carbon nanotube increases expression ISO Timp3 (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of TIMP3 mRNA CTD PMID:25554681 Timp3 Rat CGP 52608 multiple interactions ISO TIMP3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TIMP3 gene] CTD PMID:28238834 Timp3 Rat chlorpyrifos increases expression ISO Timp3 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of TIMP3 mRNA CTD PMID:20350560 Timp3 Rat cholesterol multiple interactions ISO TIMP3 (Homo sapiens) 6480464 CLEC4E protein inhibits the reaction [Cholesterol results in increased expression of TIMP3 mRNA] CTD PMID:26296894 Timp3 Rat cholesterol increases expression ISO TIMP3 (Homo sapiens) 6480464 Cholesterol results in increased expression of TIMP3 mRNA CTD PMID:26296894 Timp3 Rat chondroitin sulfate multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [Glucosamine co-treated with Chondroitin Sulfates co-treated with IL1B protein] results in increased expression of TIMP3 mRNA CTD PMID:17605605 Timp3 Rat chromium atom increases expression ISO TIMP3 (Homo sapiens) 6480464 Chromium results in increased expression of TIMP3 mRNA CTD PMID:21437242 Timp3 Rat ciglitazone multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [ciglitazone binds to PPARG protein alternative form] which results in increased expression of TIMP3 mRNA CTD PMID:16197558 Timp3 Rat ciguatoxin CTX1B affects expression ISO Timp3 (Mus musculus) 6480464 Ciguatoxins affects the expression of TIMP3 mRNA CTD PMID:18353800 Timp3 Rat cisplatin affects expression ISO Timp3 (Mus musculus) 6480464 Cisplatin affects the expression of TIMP3 mRNA CTD PMID:21151649 Timp3 Rat copper atom multiple interactions ISO Timp3 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of TIMP3 mRNA CTD PMID:15467011 Timp3 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of TIMP3 mRNA CTD PMID:30556269 Timp3 Rat copper(0) multiple interactions ISO Timp3 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of TIMP3 mRNA CTD PMID:15467011 Timp3 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of TIMP3 mRNA CTD PMID:30556269 Timp3 Rat copper(II) chloride decreases expression ISO TIMP3 (Homo sapiens) 6480464 cupric chloride results in decreased expression of TIMP3 mRNA CTD PMID:38568856 Timp3 Rat copper(II) sulfate decreases expression ISO TIMP3 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of TIMP3 mRNA CTD PMID:19549813 Timp3 Rat corosolic acid increases expression ISO TIMP3 (Homo sapiens) 6480464 corosolic acid results in increased expression of TIMP3 mRNA CTD PMID:37939859 Timp3 Rat coumestrol decreases expression ISO TIMP3 (Homo sapiens) 6480464 Coumestrol results in decreased expression of TIMP3 mRNA CTD PMID:19167446 Timp3 Rat coumestrol multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in decreased expression of TIMP3 mRNA CTD PMID:19167446 Timp3 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of TIMP3 mRNA CTD PMID:26577399 Timp3 Rat cyclosporin A decreases expression ISO TIMP3 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of TIMP3 mRNA CTD PMID:20106945 and PMID:25562108 Timp3 Rat cyclosporin A increases expression ISO TIMP3 (Homo sapiens) 6480464 Cyclosporine results in increased expression of TIMP3 mRNA CTD PMID:27989131 Timp3 Rat cytarabine affects response to substance ISO TIMP3 (Homo sapiens) 6480464 TIMP3 protein affects the susceptibility to Cytarabine CTD PMID:18202788 Timp3 Rat cytarabine decreases response to substance ISO TIMP3 (Homo sapiens) 6480464 TIMP3 gene modified form results in decreased susceptibility to Cytarabine CTD PMID:18202788 Timp3 Rat DDE decreases expression ISO TIMP3 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of TIMP3 mRNA CTD PMID:38568856 Timp3 Rat decabromodiphenyl ether decreases expression ISO Timp3 (Mus musculus) 6480464 decabromobiphenyl ether results in decreased expression of TIMP3 mRNA CTD PMID:38097007 Timp3 Rat deoxynivalenol decreases expression ISO TIMP3 (Homo sapiens) 6480464 deoxynivalenol results in decreased expression of TIMP3 mRNA CTD PMID:31863870 Timp3 Rat dexamethasone multiple interactions EXP 6480464 Dexamethasone inhibits the reaction [sephadex results in decreased expression of TIMP3 mRNA] CTD PMID:25878373 Timp3 Rat dexamethasone multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of TIMP3 mRNA CTD PMID:28628672 Timp3 Rat dexamethasone decreases expression ISO Timp3 (Mus musculus) 6480464 Dexamethasone results in decreased expression of TIMP3 mRNA CTD PMID:22733784 Timp3 Rat dexamethasone multiple interactions ISO Timp3 (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of TIMP3 mRNA CTD PMID:16054899 Timp3 Rat dextran sulfate multiple interactions ISO Timp3 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of TIMP3 mRNA more ... CTD PMID:24548422 and PMID:29950665 Timp3 Rat dextran sulfate decreases expression ISO Timp3 (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of TIMP3 mRNA CTD PMID:24548422 Timp3 Rat diarsenic trioxide multiple interactions ISO Timp3 (Mus musculus) 6480464 Metformin inhibits the reaction [Arsenic Trioxide results in decreased expression of TIMP3 mRNA] CTD PMID:29095437 Timp3 Rat diarsenic trioxide decreases expression ISO Timp3 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of TIMP3 mRNA CTD PMID:29095437 Timp3 Rat diarsenic trioxide increases expression ISO TIMP3 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of TIMP3 mRNA CTD PMID:17530438 Timp3 Rat dibutyl phthalate increases expression ISO Timp3 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of TIMP3 mRNA CTD PMID:21266533 Timp3 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of TIMP3 mRNA CTD PMID:21266533 Timp3 Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of TIMP3 mRNA CTD PMID:22546817 Timp3 Rat dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of TIMP3 mRNA CTD PMID:16980344 Timp3 Rat dioxygen increases expression ISO TIMP3 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of TIMP3 mRNA CTD PMID:26516004 Timp3 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of TIMP3 mRNA CTD PMID:25152437 Timp3 Rat dorsomorphin multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Timp3 Rat doxorubicin increases expression ISO Timp3 (Mus musculus) 6480464 Doxorubicin results in increased expression of TIMP3 mRNA CTD PMID:22016648 Timp3 Rat doxorubicin decreases expression ISO TIMP3 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of TIMP3 mRNA CTD PMID:29803840 Timp3 Rat elemental selenium increases expression ISO TIMP3 (Homo sapiens) 6480464 Selenium results in increased expression of TIMP3 mRNA CTD PMID:19244175 Timp3 Rat elemental selenium decreases expression ISO TIMP3 (Homo sapiens) 6480464 Selenium results in decreased expression of TIMP3 mRNA CTD PMID:17390030 Timp3 Rat endosulfan affects expression EXP 6480464 Endosulfan affects the expression of TIMP3 mRNA CTD PMID:29391264 Timp3 Rat endosulfan decreases expression ISO TIMP3 (Homo sapiens) 6480464 Endosulfan results in decreased expression of TIMP3 mRNA and Endosulfan results in decreased expression of TIMP3 protein CTD PMID:34856488 Timp3 Rat entinostat increases expression ISO TIMP3 (Homo sapiens) 6480464 entinostat results in increased expression of TIMP3 mRNA CTD PMID:27188386 Timp3 Rat epoxiconazole decreases expression ISO Timp3 (Mus musculus) 6480464 epoxiconazole results in decreased expression of TIMP3 mRNA CTD PMID:35436446 Timp3 Rat ethanol multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [Ethanol co-treated with Folic Acid] results in increased expression of TIMP3 mRNA CTD PMID:23378141 Timp3 Rat ethanol increases expression ISO Timp3 (Mus musculus) 6480464 Ethanol results in increased expression of TIMP3 mRNA CTD PMID:30319688 Timp3 Rat fenamidone increases expression ISO Timp3 (Mus musculus) 6480464 fenamidone results in increased expression of TIMP3 mRNA CTD PMID:27029645 Timp3 Rat fenhexamid increases expression ISO TIMP3 (Homo sapiens) 6480464 N-(2 and 3-dichloro-4-hydroxyphenyl)-1-methylcyclohexanecarboxamide results in increased expression of TIMP3 mRNA CTD PMID:25461557 Timp3 Rat floxuridine affects response to substance ISO TIMP3 (Homo sapiens) 6480464 TIMP3 protein affects the susceptibility to Floxuridine CTD PMID:18202788 Timp3 Rat floxuridine decreases response to substance ISO TIMP3 (Homo sapiens) 6480464 TIMP3 gene modified form results in decreased susceptibility to Floxuridine CTD PMID:18202788 Timp3 Rat folic acid multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [Ethanol co-treated with Folic Acid] results in increased expression of TIMP3 mRNA CTD PMID:23378141 Timp3 Rat folic acid multiple interactions ISO Timp3 (Mus musculus) 6480464 Folic Acid inhibits the reaction [AGT protein results in decreased expression of TIMP3 protein] CTD PMID:24386282 Timp3 Rat formaldehyde decreases expression EXP 6480464 Formaldehyde results in decreased expression of TIMP3 mRNA CTD PMID:17285311 Timp3 Rat gallic acid multiple interactions EXP 6480464 Gallic Acid inhibits the reaction [ALB modified form results in decreased expression of TIMP3 mRNA] CTD PMID:24309158 Timp3 Rat genistein decreases expression ISO TIMP3 (Homo sapiens) 6480464 Genistein results in decreased expression of TIMP3 mRNA CTD PMID:15754008 and PMID:16474171 Timp3 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of TIMP3 mRNA CTD PMID:33387578 Timp3 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of TIMP3 mRNA CTD PMID:24136188 Timp3 Rat glyphosate increases expression ISO TIMP3 (Homo sapiens) 6480464 Glyphosate results in increased expression of TIMP3 mRNA CTD PMID:17984146 Timp3 Rat graphite increases expression EXP 6480464 Graphite results in increased expression of TIMP3 mRNA CTD PMID:29933104 Timp3 Rat heparan sulfate multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [N6L peptide binds to Heparitin Sulfate] which results in increased secretion of TIMP3 protein CTD PMID:23109338 Timp3 Rat hydrogen cyanide increases expression ISO Timp3 (Mus musculus) 6480464 Hydrogen Cyanide results in increased expression of TIMP3 mRNA CTD PMID:33914522 Timp3 Rat hydroquinone multiple interactions EXP 6480464 [[Cadmium Chloride results in increased abundance of Cadmium] which co-treated with hydroquinone] results in decreased expression of TIMP3 mRNA more ... CTD PMID:33188856 Timp3 Rat hydroquinone decreases expression EXP 6480464 hydroquinone results in decreased expression of TIMP3 mRNA CTD PMID:33188856 Timp3 Rat imidacloprid affects methylation ISO Timp3 (Mus musculus) 6480464 imidacloprid affects the methylation of TIMP3 promoter CTD PMID:33865946 Timp3 Rat imidacloprid multiple interactions ISO Timp3 (Mus musculus) 6480464 LIF protein affects the reaction [imidacloprid affects the methylation of TIMP3 promoter] CTD PMID:33865946 Timp3 Rat indometacin multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of TIMP3 mRNA CTD PMID:28628672 Timp3 Rat indometacin increases expression ISO TIMP3 (Homo sapiens) 6480464 Indomethacin results in increased expression of TIMP3 mRNA CTD PMID:24737281 Timp3 Rat inulin multiple interactions ISO Timp3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of TIMP3 mRNA CTD PMID:36331819 Timp3 Rat isoprenaline increases expression ISO TIMP3 (Homo sapiens) 6480464 Isoproterenol results in increased expression of TIMP3 protein CTD PMID:24286936 Timp3 Rat isoprenaline multiple interactions EXP 6480464 natakalim inhibits the reaction [Isoproterenol results in decreased expression of TIMP3 protein] CTD PMID:27890915 Timp3 Rat isoprenaline decreases expression EXP 6480464 Isoproterenol results in decreased expression of TIMP3 protein CTD PMID:27890915 Timp3 Rat isotretinoin increases expression ISO TIMP3 (Homo sapiens) 6480464 Isotretinoin results in increased expression of TIMP3 mRNA CTD PMID:20436886 Timp3 Rat ivermectin decreases expression ISO TIMP3 (Homo sapiens) 6480464 Ivermectin results in decreased expression of TIMP3 protein CTD PMID:32959892 Timp3 Rat leflunomide increases expression ISO TIMP3 (Homo sapiens) 6480464 leflunomide results in increased expression of TIMP3 mRNA CTD PMID:28988120 Timp3 Rat linuron affects expression EXP 6480464 Linuron affects the expression of TIMP3 mRNA CTD PMID:12730624 Timp3 Rat malathion decreases expression EXP 6480464 Malathion results in decreased expression of TIMP3 mRNA CTD PMID:19784758 Timp3 Rat medroxyprogesterone acetate decreases expression ISO TIMP3 (Homo sapiens) 6480464 Medroxyprogesterone Acetate results in decreased expression of TIMP3 mRNA CTD PMID:20843944 Timp3 Rat metformin multiple interactions ISO Timp3 (Mus musculus) 6480464 Metformin inhibits the reaction [Arsenic Trioxide results in decreased expression of TIMP3 mRNA] CTD PMID:29095437 Timp3 Rat methapyrilene increases methylation ISO TIMP3 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of TIMP3 intron CTD PMID:30157460 Timp3 Rat methotrexate increases expression ISO TIMP3 (Homo sapiens) 6480464 Methotrexate results in increased expression of TIMP3 mRNA CTD PMID:21678067 Timp3 Rat methylmercury chloride increases expression ISO TIMP3 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of TIMP3 mRNA CTD PMID:28001369 Timp3 Rat methylparaben decreases expression ISO TIMP3 (Homo sapiens) 6480464 methylparaben results in decreased expression of TIMP3 mRNA CTD PMID:38568856 Timp3 Rat methylphenidate increases expression EXP 6480464 Methylphenidate results in increased expression of TIMP3 mRNA CTD PMID:17105903 Timp3 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine increases expression ISO TIMP3 (Homo sapiens) 6480464 N more ... CTD PMID:18778698 Timp3 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine multiple interactions ISO TIMP3 (Homo sapiens) 6480464 TP53 mutant form inhibits the reaction [N more ... CTD PMID:18778698 Timp3 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [[[Cadmium Chloride results in increased abundance of Cadmium] which co-treated with hydroquinone] results in decreased expression of TIMP3 mRNA] more ... CTD PMID:33188856 Timp3 Rat N-acetyl-L-cysteine increases expression EXP 6480464 Acetylcysteine results in increased expression of TIMP3 mRNA CTD PMID:33188856 Timp3 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Methylcholanthrene] results in decreased expression of TIMP3 protein and [Diethylnitrosamine co-treated with Methylcholanthrene] results in increased methylation of TIMP3 gene CTD PMID:21163286 Timp3 Rat naphthalene increases expression ISO Timp3 (Mus musculus) 6480464 naphthalene results in increased expression of TIMP3 mRNA CTD PMID:18978301 Timp3 Rat naproxen multiple interactions EXP 6480464 [Naproxen co-treated with Sumatriptan] inhibits the reaction [Capsaicin results in increased expression of TIMP3 protein] and Naproxen inhibits the reaction [Capsaicin results in increased expression of TIMP3 protein] CTD PMID:22150557 Timp3 Rat nickel atom decreases expression ISO TIMP3 (Homo sapiens) 6480464 Nickel results in decreased expression of TIMP3 mRNA CTD PMID:24768652 and PMID:25583101 Timp3 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of TIMP3 mRNA CTD PMID:22546817 Timp3 Rat nickel sulfate increases expression ISO TIMP3 (Homo sapiens) 6480464 nickel sulfate results in increased expression of TIMP3 mRNA CTD PMID:16314067 Timp3 Rat nickel sulfate decreases expression ISO TIMP3 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of TIMP3 mRNA CTD PMID:22714537 Timp3 Rat nicotine affects expression ISO TIMP3 (Homo sapiens) 6480464 Nicotine affects the expression of TIMP3 mRNA CTD PMID:18986645 Timp3 Rat nicotine multiple interactions ISO Timp3 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Timp3 Rat nicotine multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [Nicotine co-treated with lipopolysaccharide and E. coli O26-B6] affects the expression of TIMP3 mRNA CTD PMID:18986645 Timp3 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of TIMP3 mRNA CTD PMID:20638522 Timp3 Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of TIMP3 mRNA CTD PMID:18417182 Timp3 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of TIMP3 mRNA CTD PMID:25729387 Timp3 Rat paracetamol affects expression ISO Timp3 (Mus musculus) 6480464 Acetaminophen affects the expression of TIMP3 mRNA CTD PMID:17562736 Timp3 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of TIMP3 mRNA CTD PMID:33387578 Timp3 Rat paracetamol decreases expression ISO TIMP3 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of TIMP3 mRNA CTD PMID:27761495 Timp3 Rat paracetamol increases expression ISO TIMP3 (Homo sapiens) 6480464 Acetaminophen results in increased expression of TIMP3 mRNA CTD PMID:21420995 and PMID:27761495 Timp3 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of TIMP3 mRNA CTD PMID:16854511 Timp3 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of TIMP3 mRNA CTD PMID:32680482 Timp3 Rat parathion-methyl increases expression EXP 6480464 Methyl Parathion results in increased expression of TIMP3 mRNA CTD PMID:19784758 Timp3 Rat parathion-methyl affects expression EXP 6480464 Methyl Parathion affects the expression of TIMP3 mRNA CTD PMID:19784758 Timp3 Rat perfluorobutyric acid decreases expression ISO TIMP3 (Homo sapiens) 6480464 perfluorobutyric acid results in decreased expression of TIMP3 mRNA CTD PMID:36251517 Timp3 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Timp3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of TIMP3 mRNA CTD PMID:36331819 Timp3 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of TIMP3 mRNA CTD PMID:35163327 Timp3 Rat perfluorooctanoic acid affects expression ISO TIMP3 (Homo sapiens) 6480464 perfluorooctanoic acid affects the expression of TIMP3 mRNA CTD PMID:36251517 Timp3 Rat Phenelzine increases expression ISO Timp3 (Mus musculus) 6480464 Phenelzine results in increased expression of TIMP3 mRNA CTD PMID:31249575 Timp3 Rat phenylmercury acetate increases expression ISO TIMP3 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of TIMP3 mRNA CTD PMID:26272509 Timp3 Rat phenylmercury acetate multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TIMP3 mRNA CTD PMID:27188386 Timp3 Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of TIMP3 mRNA CTD PMID:15215175 Timp3 Rat pirinixic acid increases expression ISO Timp3 (Mus musculus) 6480464 pirinixic acid results in increased expression of TIMP3 mRNA CTD PMID:18445702 Timp3 Rat potassium chromate increases expression ISO TIMP3 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of TIMP3 mRNA CTD PMID:22714537 Timp3 Rat potassium cyanide increases expression ISO Timp3 (Mus musculus) 6480464 Potassium Cyanide results in increased expression of TIMP3 mRNA CTD PMID:33914522 Timp3 Rat pregnenolone 16alpha-carbonitrile increases expression ISO Timp3 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of TIMP3 mRNA CTD PMID:28903501 Timp3 Rat progesterone multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of TIMP3 mRNA and [Progesterone co-treated with Estradiol] results in decreased expression of TIMP3 mRNA CTD PMID:20226447 and PMID:20660070 Timp3 Rat progesterone decreases expression ISO TIMP3 (Homo sapiens) 6480464 Progesterone results in decreased expression of TIMP3 mRNA CTD PMID:26604029 Timp3 Rat progesterone increases expression ISO TIMP3 (Homo sapiens) 6480464 Progesterone results in increased expression of TIMP3 mRNA CTD PMID:20864642 Timp3 Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of TIMP3 mRNA CTD PMID:20726854 Timp3 Rat prostaglandin F2alpha decreases expression EXP 6480464 Dinoprost results in decreased expression of TIMP3 mRNA CTD PMID:11517196 Timp3 Rat rac-lactic acid decreases expression ISO TIMP3 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of TIMP3 mRNA CTD PMID:30851411 Timp3 Rat raloxifene increases expression ISO TIMP3 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in increased expression of TIMP3 mRNA and Raloxifene Hydrochloride results in increased expression of TIMP3 protein CTD PMID:21935668 Timp3 Rat resveratrol multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [Coumestrol co-treated with Resveratrol] results in decreased expression of TIMP3 mRNA and [Plant Extracts co-treated with Resveratrol] results in decreased expression of TIMP3 mRNA CTD PMID:19167446 and PMID:23557933 Timp3 Rat resveratrol multiple interactions ISO Timp3 (Mus musculus) 6480464 resveratrol inhibits the reaction [Dextran Sulfate results in decreased expression of TIMP3 mRNA] CTD PMID:24548422 Timp3 Rat resveratrol decreases expression ISO Timp3 (Mus musculus) 6480464 resveratrol results in decreased expression of TIMP3 mRNA CTD PMID:25394648 Timp3 Rat retinyl acetate increases expression ISO Timp3 (Mus musculus) 6480464 retinol acetate results in increased expression of TIMP3 mRNA CTD PMID:16772331 Timp3 Rat rofecoxib decreases expression ISO TIMP3 (Homo sapiens) 6480464 rofecoxib results in decreased expression of TIMP3 mRNA CTD PMID:16580899 Timp3 Rat rotenone increases expression ISO Timp3 (Mus musculus) 6480464 Rotenone results in increased expression of TIMP3 mRNA CTD PMID:22016648 Timp3 Rat Salinomycin decreases expression ISO TIMP3 (Homo sapiens) 6480464 salinomycin results in decreased expression of TIMP3 mRNA CTD PMID:19682730 Timp3 Rat SB 431542 multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Timp3 Rat selenium atom increases expression ISO TIMP3 (Homo sapiens) 6480464 Selenium results in increased expression of TIMP3 mRNA CTD PMID:19244175 Timp3 Rat selenium atom decreases expression ISO TIMP3 (Homo sapiens) 6480464 Selenium results in decreased expression of TIMP3 mRNA CTD PMID:17390030 Timp3 Rat serpentine asbestos increases expression ISO TIMP3 (Homo sapiens) 6480464 Asbestos and Serpentine results in increased expression of TIMP3 mRNA CTD PMID:24160326 Timp3 Rat serpentine asbestos decreases expression ISO TIMP3 (Homo sapiens) 6480464 Asbestos and Serpentine results in decreased expression of TIMP3 mRNA CTD PMID:24160326 Timp3 Rat silicon dioxide decreases expression ISO TIMP3 (Homo sapiens) 6480464 Silicon Dioxide results in decreased expression of TIMP3 mRNA CTD PMID:25351596 Timp3 Rat silver atom increases expression ISO TIMP3 (Homo sapiens) 6480464 Silver results in increased expression of TIMP3 mRNA CTD PMID:28959546 Timp3 Rat silver atom decreases expression ISO Timp3 (Mus musculus) 6480464 Silver results in decreased expression of TIMP3 mRNA CTD PMID:27131904 Timp3 Rat silver(0) increases expression ISO TIMP3 (Homo sapiens) 6480464 Silver results in increased expression of TIMP3 mRNA CTD PMID:28959546 Timp3 Rat silver(0) decreases expression ISO Timp3 (Mus musculus) 6480464 Silver results in decreased expression of TIMP3 mRNA CTD PMID:27131904 Timp3 Rat sirolimus decreases expression ISO TIMP3 (Homo sapiens) 6480464 Sirolimus results in decreased expression of TIMP3 mRNA and Sirolimus results in decreased expression of TIMP3 protein CTD PMID:21742783 Timp3 Rat sodium arsenate increases expression ISO Timp3 (Mus musculus) 6480464 sodium arsenate results in increased expression of TIMP3 mRNA CTD PMID:21795629 Timp3 Rat sodium arsenite decreases expression ISO TIMP3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TIMP3 mRNA CTD PMID:22714537 more ... Timp3 Rat sodium arsenite affects methylation ISO TIMP3 (Homo sapiens) 6480464 sodium arsenite affects the methylation of TIMP3 gene CTD PMID:28589171 Timp3 Rat sodium arsenite increases expression ISO TIMP3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of TIMP3 mRNA CTD PMID:12634122 and PMID:30191986 Timp3 Rat sorafenib decreases expression ISO Timp3 (Mus musculus) 6480464 sorafenib results in decreased expression of TIMP3 mRNA CTD PMID:21360571 Timp3 Rat succimer multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of TIMP3 mRNA CTD PMID:26378955 Timp3 Rat sulfasalazine increases expression ISO Timp3 (Mus musculus) 6480464 Sulfasalazine results in increased expression of TIMP3 mRNA CTD PMID:22016648 Timp3 Rat sulindac multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [Sulindac co-treated with epigallocatechin gallate] results in decreased expression of TIMP3 mRNA CTD PMID:12628509 Timp3 Rat sumatriptan multiple interactions EXP 6480464 [Naproxen co-treated with Sumatriptan] inhibits the reaction [Capsaicin results in increased expression of TIMP3 protein] and Sumatriptan inhibits the reaction [Capsaicin results in increased expression of TIMP3 protein] CTD PMID:22150557 Timp3 Rat T-2 toxin decreases expression ISO TIMP3 (Homo sapiens) 6480464 T-2 Toxin results in decreased expression of TIMP3 mRNA CTD PMID:31863870 Timp3 Rat tamoxifen affects expression ISO Timp3 (Mus musculus) 6480464 Tamoxifen affects the expression of TIMP3 mRNA CTD PMID:17555576 Timp3 Rat tanespimycin increases expression ISO TIMP3 (Homo sapiens) 6480464 tanespimycin results in increased expression of TIMP3 mRNA CTD PMID:19514085 Timp3 Rat tert-butyl hydroperoxide increases expression ISO TIMP3 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of TIMP3 mRNA CTD PMID:15336504 Timp3 Rat testosterone increases expression ISO Timp3 (Mus musculus) 6480464 Testosterone results in increased expression of TIMP3 mRNA CTD PMID:15788153 Timp3 Rat testosterone enanthate affects expression ISO TIMP3 (Homo sapiens) 6480464 testosterone enanthate affects the expression of TIMP3 mRNA CTD PMID:17440010 Timp3 Rat tetrachloroethene decreases expression ISO Timp3 (Mus musculus) 6480464 Tetrachloroethylene results in decreased expression of TIMP3 mRNA CTD PMID:28973375 Timp3 Rat tetrachloromethane affects expression ISO Timp3 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of TIMP3 mRNA CTD PMID:17484886 Timp3 Rat tetrachloromethane increases expression ISO Timp3 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of TIMP3 mRNA CTD PMID:25827057 Timp3 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of TIMP3 mRNA CTD PMID:19784758 Timp3 Rat thapsigargin increases expression ISO TIMP3 (Homo sapiens) 6480464 Thapsigargin results in increased expression of TIMP3 mRNA CTD PMID:29453283 Timp3 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of TIMP3 mRNA CTD PMID:34492290 Timp3 Rat thiram increases expression ISO TIMP3 (Homo sapiens) 6480464 Thiram results in increased expression of TIMP3 mRNA CTD PMID:38568856 Timp3 Rat titanium dioxide increases expression ISO Timp3 (Mus musculus) 6480464 titanium dioxide results in increased expression of TIMP3 mRNA CTD PMID:27760801 Timp3 Rat titanium dioxide decreases methylation ISO Timp3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of TIMP3 promoter CTD PMID:35295148 Timp3 Rat titanium dioxide multiple interactions ISO Timp3 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of TIMP3 mRNA CTD PMID:29950665 Timp3 Rat titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of TIMP3 mRNA CTD PMID:30012374 Timp3 Rat titanium dioxide decreases expression ISO Timp3 (Mus musculus) 6480464 titanium dioxide results in decreased expression of TIMP3 mRNA CTD PMID:23557971 Timp3 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of TIMP3 mRNA CTD PMID:25729387 Timp3 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of TIMP3 mRNA CTD PMID:33387578 Timp3 Rat trichostatin A multiple interactions ISO Timp3 (Mus musculus) 6480464 [[decitabine co-treated with trichostatin A] affects the methylation of TIMP3 promoter] which affects the expression of TIMP3 mRNA CTD PMID:18836996 Timp3 Rat trichostatin A multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of TIMP3 mRNA CTD PMID:27188386 Timp3 Rat trichostatin A decreases expression ISO TIMP3 (Homo sapiens) 6480464 trichostatin A results in decreased expression of TIMP3 mRNA CTD PMID:24935251 and PMID:26272509 Timp3 Rat trichostatin A increases expression ISO TIMP3 (Homo sapiens) 6480464 trichostatin A results in increased expression of TIMP3 mRNA CTD PMID:24935251 Timp3 Rat triclosan decreases expression ISO TIMP3 (Homo sapiens) 6480464 Triclosan results in decreased expression of TIMP3 mRNA CTD PMID:26604029 and PMID:30510588 Timp3 Rat valproic acid affects expression ISO TIMP3 (Homo sapiens) 6480464 Valproic Acid affects the expression of TIMP3 mRNA CTD PMID:25979313 Timp3 Rat valproic acid increases expression ISO TIMP3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of TIMP3 mRNA CTD PMID:23179753 more ... Timp3 Rat valproic acid increases expression ISO Timp3 (Mus musculus) 6480464 Valproic Acid results in increased expression of TIMP3 mRNA CTD PMID:21427059 and PMID:24896083 Timp3 Rat valproic acid decreases expression ISO TIMP3 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of TIMP3 mRNA CTD PMID:24935251 Timp3 Rat valproic acid decreases methylation ISO TIMP3 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of TIMP3 gene CTD PMID:29154799 Timp3 Rat vancomycin increases expression ISO Timp3 (Mus musculus) 6480464 Vancomycin results in increased expression of TIMP3 mRNA CTD PMID:18930951 Timp3 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of TIMP3 mRNA CTD PMID:19015723 Timp3 Rat vitamin E increases expression ISO TIMP3 (Homo sapiens) 6480464 Vitamin E results in increased expression of TIMP3 mRNA CTD PMID:19244175 Timp3 Rat vorinostat multiple interactions ISO TIMP3 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of TIMP3 mRNA CTD PMID:27188386 Timp3 Rat vorinostat decreases expression ISO TIMP3 (Homo sapiens) 6480464 vorinostat results in decreased expression of TIMP3 mRNA CTD PMID:26272509 Timp3 Rat zinc atom increases expression EXP 6480464 Zinc results in increased expression of TIMP3 mRNA CTD PMID:17074742 Timp3 Rat zinc sulfate increases expression EXP 6480464 Zinc Sulfate results in increased expression of TIMP3 mRNA CTD PMID:17074742 Timp3 Rat zinc(0) increases expression EXP 6480464 Zinc results in increased expression of TIMP3 mRNA CTD PMID:17074742
(-)-epigallocatechin 3-gallate (ISO) (S)-nicotine (ISO) 1,1-dichloroethene (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-amino-2-deoxy-D-glucopyranose (EXP,ISO) 2-butoxyethanol (ISO) 2-hydroxypropanoic acid (ISO) 2-methoxyethanol (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP,ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methylcholanthrene (EXP) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) acetamide (EXP) acrolein (ISO) acrylamide (EXP) aldehydo-D-glucosamine (EXP,ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) amosite asbestos (ISO) ancitabine (ISO) aniline (ISO) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atrazine (EXP) Azoxymethane (ISO) belinostat (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[e]pyrene (ISO) Benzo[k]fluoranthene (ISO) beta-D-glucosamine (EXP,ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) cadmium atom (EXP,ISO) cadmium dichloride (EXP,ISO) calcitriol (ISO) candesartan (EXP) capsaicin (EXP,ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) cholesterol (ISO) chondroitin sulfate (ISO) chromium atom (ISO) ciglitazone (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) corosolic acid (ISO) coumestrol (ISO) Cuprizon (EXP) cyclosporin A (ISO) cytarabine (ISO) DDE (ISO) decabromodiphenyl ether (ISO) deoxynivalenol (ISO) dexamethasone (EXP,ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP,ISO) dieldrin (EXP) dioxygen (EXP,ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) endosulfan (EXP,ISO) entinostat (ISO) epoxiconazole (ISO) ethanol (ISO) fenamidone (ISO) fenhexamid (ISO) floxuridine (ISO) folic acid (ISO) formaldehyde (EXP) gallic acid (EXP) genistein (ISO) gentamycin (EXP) glafenine (EXP) glyphosate (ISO) graphite (EXP) heparan sulfate (ISO) hydrogen cyanide (ISO) hydroquinone (EXP) imidacloprid (ISO) indometacin (ISO) inulin (ISO) isoprenaline (EXP,ISO) isotretinoin (ISO) ivermectin (ISO) leflunomide (ISO) linuron (EXP) malathion (EXP) medroxyprogesterone acetate (ISO) metformin (ISO) methapyrilene (ISO) methotrexate (ISO) methylmercury chloride (ISO) methylparaben (ISO) methylphenidate (EXP) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO) N-acetyl-L-cysteine (EXP) N-nitrosodiethylamine (EXP) naphthalene (ISO) naproxen (EXP) nickel atom (ISO) nickel dichloride (EXP) nickel sulfate (ISO) nicotine (ISO) nitrofen (EXP) ochratoxin A (EXP) oxaliplatin (EXP) paracetamol (EXP,ISO) paraquat (EXP) parathion-methyl (EXP) perfluorobutyric acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) Phenelzine (ISO) phenylmercury acetate (ISO) PhIP (EXP) pirinixic acid (ISO) potassium chromate (ISO) potassium cyanide (ISO) pregnenolone 16alpha-carbonitrile (ISO) progesterone (EXP,ISO) prostaglandin F2alpha (EXP) rac-lactic acid (ISO) raloxifene (ISO) resveratrol (ISO) retinyl acetate (ISO) rofecoxib (ISO) rotenone (ISO) Salinomycin (ISO) SB 431542 (ISO) selenium atom (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sirolimus (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sorafenib (ISO) succimer (ISO) sulfasalazine (ISO) sulindac (ISO) sumatriptan (EXP) T-2 toxin (ISO) tamoxifen (ISO) tanespimycin (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) testosterone enanthate (ISO) tetrachloroethene (ISO) tetrachloromethane (EXP,ISO) thapsigargin (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (EXP,ISO) topotecan (EXP) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP) vitamin E (ISO) vorinostat (ISO) zinc atom (EXP) zinc sulfate (EXP) zinc(0) (EXP)
1.
Tissue inhibitor of metalloproteinase-3 induces a Fas-associated death domain-dependent type II apoptotic pathway.
Bond M, etal., J Biol Chem 2002 Apr 19;277(16):13787-95.
2.
Cellular localization of tissue inhibitors of metalloproteinases in the rat ovary throughout pseudopregnancy.
Curry TE Jr and Wheeler SE, Biol Reprod 2002 Dec;67(6):1943-51.
3.
Promoter hypermethylation profile of kidney cancer.
Dulaimi E, etal., Clin Cancer Res. 2004 Jun 15;10(12 Pt 1):3972-9.
4.
Exercise training and return to a well-balanced diet activate the neuregulin 1/ErbB pathway in skeletal muscle of obese rats.
Ennequin G, etal., J Physiol. 2015 Jun 15;593(12):2665-77. doi: 10.1113/JP270026. Epub 2015 May 14.
5.
Inhibition of diabetic nephropathy by a GH antagonist: a molecular analysis.
Esposito C, etal., Kidney Int. 1996 Aug;50(2):506-14.
6.
Differential spatial distribution and temporal regulation of tissue inhibitor of metalloproteinase mRNA expression during rat central nervous system development.
Fager N and Jaworski DM, Mech Dev. 2000 Nov;98(1-2):105-9.
7.
Sorsby fundus dystrophy: reevaluation of variable expressivity in patients carrying a TIMP3 founder mutation.
Felbor U, etal., Arch Ophthalmol. 1997 Dec;115(12):1569-71.
8.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.
Thyroid hormone induces myocardial matrix degradation by activating matrix metalloproteinase-1.
Ghose Roy S, etal., Matrix Biol. 2007 May;26(4):269-79. Epub 2006 Dec 29.
10.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
11.
Evidence for a role of the Simian Virus 40 in human breast carcinomas.
Hachana M, etal., Breast Cancer Res Treat. 2008 Jan 18;.
12.
mRNA expression of matrix metalloproteases and their inhibitors differs in subtypes of renal cell carcinomas.
Hagemann T, etal., Eur J Cancer. 2001 Oct;37(15):1839-46.
13.
Tissue inhibitor of metalloproteinases-3 promoter methylation is an independent prognostic factor for bladder cancer.
Hoque MO, etal., J Urol. 2008 Feb;179(2):743-7. Epub 2007 Dec 20.
14.
Expression of matrix metalloproteinases and endogenous inhibitors within ascending aortic aneurysms of patients with Marfan syndrome.
Ikonomidis JS, etal., Circulation. 2006 Jul 4;114(1 Suppl):I365-70.
15.
Inhibition of microRNA-222 up-regulates TIMP3 to promotes osteogenic differentiation of MSCs from fracture rats with type 2 diabetes mellitus.
Jiang C, etal., J Cell Mol Med. 2020 Jan;24(1):686-694. doi: 10.1111/jcmm.14777. Epub 2019 Nov 6.
16.
Zhonghua wai ke za zhi [Chinese journal of surgery]
Jiang X, etal., Zhonghua Wai Ke Za Zhi. 2000 Apr;38(4):291-3, 19.
17.
RNA constitution and estrogen-responsive gene expression in the ovariectomized rat uterus.
Kamata R, etal., Anal Biochem. 2005 Jun 1;341(1):131-40.
18.
Prognostic relevance of uPAR-del4/5 and TIMP-3 mRNA expression levels in breast cancer.
Kotzsch M, etal., Eur J Cancer. 2005 Nov;41(17):2760-8. Epub 2005 Oct 26.
19.
Intracerebroventricular administration of an endothelin ETB receptor agonist increases expression of tissue inhibitor of matrix metalloproteinase-1 and -3 in rat brain.
Koyama Y, etal., Neuroscience. 2007 Jul 13;147(3):620-30. Epub 2007 Jun 6.
20.
Negative correlation of cytoplasm TIMP3 with miR-222 indicates a good prognosis for NSCLC.
Lei Y, etal., Onco Targets Ther. 2018 Sep 6;11:5551-5557. doi: 10.2147/OTT.S172522. eCollection 2018.
21.
Moderately high folic acid supplementation exacerbates experimentally induced liver fibrosis in rats.
Marsillach J, etal., Exp Biol Med (Maywood). 2008 Jan;233(1):38-47.
22.
Immunohistochemical changes in vulnerable rat brain regions after reversible global brain ischaemia.
Martinez G, etal., J Mol Histol. 2007 Aug;38(4):295-302. Epub 2007 Jun 6.
23.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
24.
Impaired regulation of the TNF-alpha converting enzyme/tissue inhibitor of metalloproteinase 3 proteolytic system in skeletal muscle of obese type 2 diabetic patients: a new mechanism of insulin resistance in humans.
Monroy A, etal., Diabetologia. 2009 Jul 25.
25.
Expression of tissue inhibitor of matrix metalloproteinases (TIMP)-3 protein in invasive breast carcinoma: relation to tumor phenotype and clinical outcome.
Mylona E, etal., Breast Cancer Res. 2006;8(5):R57.
26.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
27.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
28.
ADAM-17 and TIMP3 protein and mRNA expression in spinal cord white matter of rats with acute experimental autoimmune encephalomyelitis.
Plumb J, etal., J Neuroimmunol. 2005 Jul;164(1-2):1-9.
29.
GOA pipeline
RGD automated data pipeline
30.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
31.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
32.
Comprehensive gene review and curation
RGD comprehensive gene curation
33.
Identification of degradome components associated with prostate cancer progression by expression analysis of human prostatic tissues.
Riddick AC, etal., Br J Cancer. 2005 Jun 20;92(12):2171-80.
34.
Expression of matrix metalloproteinase-26 and tissue inhibitors of metalloproteinase-3 and -4 in normal ovary and ovarian carcinoma.
Ripley D, etal., Int J Gynecol Cancer. 2006 Sep-Oct;16(5):1794-800.
35.
An ATIPical family of angiotensin II AT2 receptor-interacting proteins.
Rodrigues-Ferreira S and Nahmias C, Trends Endocrinol Metab. 2010 Nov;21(11):684-90.
36.
Matrix metalloproteinases and their natural inhibitors in fibrovascular membranes of proliferative diabetic retinopathy.
Salzmann J, etal., Br J Ophthalmol. 2000 Oct;84(10):1091-6.
37.
Ectodomain shedding of neuroglycan C, a brain-specific chondroitin sulfate proteoglycan, by TIMP-2- and TIMP-3-sensitive proteolysis.
Shuo T, etal., J Neurochem. 2007 Sep;102(5):1561-8. Epub 2007 May 26.
38.
Age-related changes in the expression of gelatinase and tissue inhibitor of metalloproteinase genes in mandibular condylar, growth plate, and articular cartilage in rats.
Takahashi I, etal., J Mol Histol. 2005 Jun;36(5):355-66. Epub 2005 Oct 6.
39.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
40.
Expression of matrix metalloproteinase-26 and tissue inhibitors of metalloproteinases TIMP-3 and -4 in benign endometrium and endometrial cancer.
Tunuguntla R, etal., Gynecol Oncol. 2003 Jun;89(3):453-9.
41.
[Effects of glutamine on matrix metalloproteinase-3 and tissue inhibitor of metalloproteinase-3 expressions in myocardium of rats with sepsis]
Wang H, etal., Zhonghua Er Ke Za Zhi. 2006 Aug;44(8):587-91.
42.
Assessment of gene promoter hypermethylation for detection of cervical neoplasia.
Wisman GB, etal., Int J Cancer. 2006 Oct 15;119(8):1908-14.
43.
Suppression subtractive hybridization identified differentially expressed genes in lung adenocarcinoma: ERGIC3 as a novel lung cancer-related gene.
Wu M, etal., BMC Cancer. 2013 Feb 1;13:44. doi: 10.1186/1471-2407-13-44.
44.
MicroRNA-222 Promotes the Proliferation of Pulmonary Arterial Smooth Muscle Cells by Targeting P27 and TIMP3.
Xu Y, etal., Cell Physiol Biochem. 2017;43(1):282-292. doi: 10.1159/000480371. Epub 2017 Aug 30.
45.
Promoter hypermethylation of multiple genes in hydatidiform mole and choriocarcinoma.
Xue WC, etal., J Mol Diagn. 2004 Nov;6(4):326-34.
46.
Dietary loading and aggrecanase-1/TIMP-3 expression in rat mandibular condylar cartilage.
Yu D, etal., J Orofac Pain. 2007 Summer;21(3):232-8.
47.
Distribution and expression of tissue inhibitors of metalloproteinase in dorsal root entry zone and dorsal column after dorsal root injury.
Zhang X, etal., J Neurosci Res. 2006 Aug 1;84(2):278-90.
48.
Adenovirus carrying TIMP-3: a potential tool for cervical cancer treatment.
Zhang Y, etal., Gynecol Oncol. 2008 Jan;108(1):234-40. Epub 2007 Oct 31.
49.
Expression of matrix metalloproteinase -2, -9 and tissue inhibitors of metalloproteinase -1, -2, -3 mRNAs in rat uterus during early pregnancy.
Zhao YG, etal., Mol Reprod Dev 2002 Jun;62(2):149-58.
50.
[Changes of matrix metalloproteinase 2,9 and tissue inhibitor of metalloproteinase 1, 2, 3 expression level in aged rat lung.]
Zhao ZJ, etal., Beijing Da Xue Xue Bao. 2008 Feb 18;40(1):101-104.
51.
MiR-21 and miR-222 inhibit apoptosis of adult dorsal root ganglion neurons by repressing TIMP3 following sciatic nerve injury.
Zhou S, etal., Neurosci Lett. 2015 Jan 23;586:43-9. doi: 10.1016/j.neulet.2014.12.006. Epub 2014 Dec 4.
Timp3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 19,408,539 - 19,459,558 (-) NCBI GRCr8 mRatBN7.2 7 17,520,827 - 17,571,850 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 17,521,919 - 17,571,839 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 19,480,687 - 19,531,680 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 21,639,451 - 21,690,578 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 21,420,352 - 21,471,347 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 23,543,125 - 23,594,170 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 23,544,215 - 23,594,133 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 23,693,364 - 23,744,404 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 19,677,144 - 19,727,072 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 19,686,693 - 19,737,062 (-) NCBI Celera 7 14,761,240 - 14,810,915 (-) NCBI Celera Cytogenetic Map 7 q13 NCBI
TIMP3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 32,801,705 - 32,863,041 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 32,801,705 - 32,863,041 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 33,197,691 - 33,259,028 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 31,526,802 - 31,589,028 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 31,521,361 - 31,583,581 NCBI Celera 22 16,999,013 - 17,061,296 (+) NCBI Celera Cytogenetic Map 22 q12.3 ENTREZGENE HuRef 22 16,154,700 - 16,216,984 (+) NCBI HuRef CHM1_1 22 33,156,307 - 33,218,500 (+) NCBI CHM1_1 T2T-CHM13v2.0 22 33,266,136 - 33,327,517 (+) NCBI T2T-CHM13v2.0
Timp3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 86,136,276 - 86,185,369 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 86,136,236 - 86,185,370 (+) Ensembl GRCm39 Ensembl GRCm38 10 86,300,412 - 86,349,505 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 86,300,372 - 86,349,506 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 85,763,157 - 85,812,250 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 85,730,336 - 85,779,305 (+) NCBI MGSCv36 mm8 Celera 10 88,278,411 - 88,327,541 (+) NCBI Celera Cytogenetic Map 10 C1 NCBI cM Map 10 42.83 NCBI
Timp3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955405 41,613,966 - 41,655,813 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955405 41,613,976 - 41,655,813 (+) NCBI ChiLan1.0 ChiLan1.0
TIMP3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 42,741,534 - 42,803,142 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 45,441,873 - 45,503,391 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 22 13,811,297 - 13,872,799 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 22 31,662,567 - 31,721,500 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 22 31,662,562 - 31,723,964 (+) Ensembl panpan1.1 panPan2
TIMP3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 30,627,154 - 30,681,520 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 30,627,154 - 30,694,288 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 30,610,166 - 30,664,261 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 31,469,330 - 31,523,514 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 31,465,801 - 31,536,528 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 31,209,878 - 31,264,020 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 31,499,587 - 31,553,699 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 31,684,823 - 31,738,972 (-) NCBI UU_Cfam_GSD_1.0
Timp3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 13,986,214 - 14,035,739 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936492 6,996,613 - 7,046,190 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936492 6,996,627 - 7,046,137 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TIMP3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 12,185,818 - 12,242,581 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 12,185,816 - 12,242,599 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 11,962,119 - 12,019,214 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TIMP3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 19 15,621,609 - 15,684,118 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 19 15,622,431 - 15,680,449 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 110,320,510 - 110,382,442 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Timp3
.
Predicted Target Of
Count of predictions: 73 Count of miRNA genes: 66 Interacting mature miRNAs: 68 Transcripts: ENSRNOT00000005746 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
2317059 Aia15 Adjuvant induced arthritis QTL 15 2.46 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 17004598 62004598 Rat 61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1300176 Hrtrt10 Heart rate QTL 10 3.19 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 664270 26029351 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 1578652 Bmd15 Bone mineral density QTL 15 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 7 9866467 60460686 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 9590142 Scort5 Serum corticosterone level QTL 5 24.4 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 1 31962314 Rat 1582260 Bw72 Body weight QTL 72 3.2 0.0043 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 1582261 Bw69 Body weight QTL 69 3.2 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 1582262 Bw75 Body weight QTL 75 3 0.0038 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 2298547 Neuinf5 Neuroinflammation QTL 5 3.7 nervous system integrity trait (VT:0010566) spinal cord Cd74 protein level (CMO:0002131) 7 9462246 58265113 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 2298550 Neuinf6 Neuroinflammation QTL 6 3.3 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 7 1 27829089 Rat 738033 Anxrr6 Anxiety related response QTL 6 4.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 7 15573889 60573889 Rat 724560 Plsm3 Polydactyly-luxate syndrome (PLS) morphotypes QTL 3 0.0003 tibia length (VT:0004357) tibia length (CMO:0000450) 7 1 34000259 Rat 7411566 Bw136 Body weight QTL 136 10.4 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 1 31962314 Rat
RH128273
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 17,523,310 - 17,523,527 (+) MAPPER mRatBN7.2 Rnor_6.0 7 23,545,609 - 23,545,825 NCBI Rnor6.0 Rnor_5.0 7 23,695,848 - 23,696,064 UniSTS Rnor5.0 RGSC_v3.4 7 19,678,548 - 19,678,764 UniSTS RGSC3.4 Celera 7 14,762,644 - 14,762,860 UniSTS Cytogenetic Map 7 q13 UniSTS
RH129267
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 17,523,345 - 17,523,536 (+) MAPPER mRatBN7.2 Rnor_6.0 7 23,545,644 - 23,545,834 NCBI Rnor6.0 Rnor_5.0 7 23,695,883 - 23,696,073 UniSTS Rnor5.0 RGSC_v3.4 7 19,678,583 - 19,678,773 UniSTS RGSC3.4 Celera 7 14,762,679 - 14,762,869 UniSTS Cytogenetic Map 7 q13 UniSTS
RH94615
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 17,524,335 - 17,524,409 (+) MAPPER mRatBN7.2 Rnor_6.0 7 23,546,634 - 23,546,707 NCBI Rnor6.0 Rnor_5.0 7 23,696,873 - 23,696,946 UniSTS Rnor5.0 RGSC_v3.4 7 19,679,573 - 19,679,646 UniSTS RGSC3.4 Celera 7 14,763,669 - 14,763,742 UniSTS Cytogenetic Map 7 q13 UniSTS
RH144261
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 17,551,976 - 17,552,083 (+) MAPPER mRatBN7.2 Rnor_6.0 7 23,574,271 - 23,574,377 NCBI Rnor6.0 Rnor_5.0 7 23,724,510 - 23,724,616 UniSTS Rnor5.0 RGSC_v3.4 7 19,707,210 - 19,707,316 UniSTS RGSC3.4 Celera 7 14,791,244 - 14,791,350 UniSTS Cytogenetic Map 7 q13 UniSTS
BI278238
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 17,523,117 - 17,523,220 (+) MAPPER mRatBN7.2 Rnor_6.0 7 23,545,416 - 23,545,518 NCBI Rnor6.0 Rnor_5.0 7 23,695,655 - 23,695,757 UniSTS Rnor5.0 RGSC_v3.4 7 19,678,355 - 19,678,457 UniSTS RGSC3.4 Celera 7 14,762,451 - 14,762,553 UniSTS Cytogenetic Map 7 q13 UniSTS
RH135110
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 17,522,418 - 17,522,611 (+) MAPPER mRatBN7.2 Rnor_6.0 7 23,544,717 - 23,544,909 NCBI Rnor6.0 Rnor_5.0 7 23,694,956 - 23,695,148 UniSTS Rnor5.0 RGSC_v3.4 7 19,677,656 - 19,677,848 UniSTS RGSC3.4 Celera 7 14,761,752 - 14,761,944 UniSTS Cytogenetic Map 7 q13 UniSTS
Timp3
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 17,523,945 - 17,524,436 (+) MAPPER mRatBN7.2 Rnor_6.0 7 23,546,244 - 23,546,734 NCBI Rnor6.0 Rnor_5.0 7 23,696,483 - 23,696,973 UniSTS Rnor5.0 RGSC_v3.4 7 19,679,183 - 19,679,673 UniSTS RGSC3.4 Celera 7 14,763,279 - 14,763,769 UniSTS Cytogenetic Map 7 q13 UniSTS
G45201
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 17,562,016 - 17,562,389 (+) MAPPER mRatBN7.2 mRatBN7.2 7 17,562,046 - 17,562,389 (+) MAPPER mRatBN7.2 Rnor_6.0 7 23,584,341 - 23,584,683 NCBI Rnor6.0 Rnor_6.0 7 23,584,311 - 23,584,683 NCBI Rnor6.0 Rnor_5.0 7 23,734,580 - 23,734,922 UniSTS Rnor5.0 Rnor_5.0 7 23,734,550 - 23,734,922 UniSTS Rnor5.0 RGSC_v3.4 7 19,717,250 - 19,717,622 UniSTS RGSC3.4 RGSC_v3.4 7 19,717,280 - 19,717,622 UniSTS RGSC3.4 Celera 7 14,801,206 - 14,801,548 UniSTS Celera 7 14,801,176 - 14,801,548 UniSTS Cytogenetic Map 7 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000005746 ⟹ ENSRNOP00000005746
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 17,521,919 - 17,571,839 (-) Ensembl Rnor_6.0 Ensembl 7 23,544,215 - 23,594,133 (-) Ensembl
RefSeq Acc Id:
NM_012886 ⟹ NP_037018
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 19,408,539 - 19,459,558 (-) NCBI mRatBN7.2 7 17,520,827 - 17,571,850 (-) NCBI Rnor_6.0 7 23,544,205 - 23,594,133 (-) NCBI Rnor_5.0 7 23,693,364 - 23,744,404 (-) NCBI RGSC_v3.4 7 19,677,144 - 19,727,072 (-) RGD Celera 7 14,761,240 - 14,810,915 (-) RGD
Sequence:
CGGGCAGCCGCCAGCGCCAAGGAGCTTCTTCTCTTGCTTCTCCGCTTCCCGATCCTTCTCCCGGAGGCCACTCACTGGCTCCGCGGACTCGTGCGCCAGACACCCTTGGCCACTTGGTCACATCCCGC
hide sequence
RefSeq Acc Id:
NP_037018 ⟸ NM_012886
- Peptide Label:
precursor
- UniProtKB:
P48032 (UniProtKB/Swiss-Prot), Q4V8L0 (UniProtKB/TrEMBL), F7FFD0 (UniProtKB/TrEMBL)
- Sequence:
MTPWLGLVLLLSCWSLGHWGTEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFSKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYEGKMYTGLCNFVERWDHLT
hide sequence
Ensembl Acc Id:
ENSRNOP00000005746 ⟸ ENSRNOT00000005746
RGD ID: 13695091 Promoter ID: EPDNEW_R5616 Type: multiple initiation site Name: Timp3_1 Description: TIMP metallopeptidase inhibitor 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 23,594,144 - 23,594,204 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-10-23
Timp3
TIMP metallopeptidase inhibitor 3
Timp3
tissue inhibitor of metalloproteinase 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-15
Timp3
tissue inhibitor of metalloproteinase 3
Timp3
tissue inhibitor of metalloproteinase 3 (Sorsby fundus dystrophy, pseudoinflammatory)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Timp3
tissue inhibitor of metalloproteinase 3 (Sorsby fundus dystrophy, pseudoinflammatory)
tissue inhibitor of metalloproteinase 3
Name updated
1299863 APPROVED
2002-06-10
Timp3
Tissue inhibitor of metalloproteinase 3
Symbol and Name status set to approved
70586 APPROVED
