Symbol:
Smad2
Name:
SMAD family member 2
RGD ID:
3031
Description:
Predicted to enable several functions, including DNA-binding transcription activator activity, RNA polymerase II-specific; SMAD binding activity; and enzyme binding activity. Predicted to contribute to DNA binding activity and DNA-binding transcription factor activity. Involved in several processes, including cell surface receptor protein serine/threonine kinase signaling pathway; cellular response to glucose stimulus; and regulation of gene expression. Part of protein-containing complex. Used to study hepatocellular carcinoma. Biomarker of colon cancer and myocardial infarction. Human ortholog(s) of this gene implicated in Loeys-Dietz syndrome 6; Lynch syndrome; cervical cancer; and ovarian cancer. Orthologous to human SMAD2 (SMAD family member 2); PARTICIPATES IN transforming growth factor-beta Smad dependent signaling pathway; altered transforming growth factor-beta Smad dependent signaling pathway; colorectal cancer pathway; INTERACTS WITH (S)-nicotine; 1,2-dimethylhydrazine; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
MAD (mothers against decapentaplegic Drosophila) homolog 2; MAD (mothers against decapentaplegic, Drosophila) homolog 2; MAD homolog 2; MAD homolog 2 (Drosophila); mad-related protein 2; Madh2; MGC156656; mothers against decapentaplegic homolog 2; mothers against DPP homolog 2; SMAD 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SMAD2 (SMAD family member 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Smad2 (SMAD family member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Smad2 (SMAD family member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SMAD2 (SMAD family member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SMAD2 (SMAD family member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Smad2 (SMAD family member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SMAD2 (SMAD family member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SMAD2 (SMAD family member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Smad2 (SMAD family member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
SMAD3 (SMAD family member 3) HGNC
OrthoDB
Alliance orthologs 3
Mus musculus (house mouse):
Smad2 (SMAD family member 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SMAD2 (SMAD family member 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
smad2 (SMAD family member 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
sma-2
Alliance
DIOPT (InParanoid|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
Smox
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
smad2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Candidate Gene For:
Mcs34
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 72,124,792 - 72,193,345 (+) NCBI GRCr8 mRatBN7.2 18 69,849,884 - 69,918,926 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 69,850,377 - 69,912,323 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 71,959,978 - 72,021,908 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 72,629,252 - 72,691,176 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 70,485,797 - 70,547,727 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 72,550,107 - 72,612,078 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 72,550,219 - 72,612,078 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 71,672,879 - 71,735,128 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 73,180,520 - 73,241,707 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 73,253,792 - 73,314,980 (+) NCBI Celera 18 68,381,756 - 68,443,610 (+) NCBI Celera Cytogenetic Map 18 q12.3 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Smad2 Rat chromosome 18q deletion syndrome ISO RGD:1347299 8554872 ClinVar Annotator: match by term: Monosomy 18q, deletion 18q ClinVar PMID:31690835 Smad2 Rat CONGENITAL HEART DEFECTS, MULTIPLE TYPES, 8, WITH OR WITHOUT HETEROTAXY ISO RGD:1347299 8554872 ClinVar Annotator: match by term: CONGENITAL HEART DEFECTS, MULTIPLE TYPES, 8, WITH OR WITHOUT HETEROTAXY more ... ClinVar PMID:23665959|PMID:25741868|PMID:28492532|PMID:29967133|PMID:30157302 Smad2 Rat genetic disease ISO RGD:1347299 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:25741868|PMID:28492532|PMID:30157302 Smad2 Rat intellectual disability ISO RGD:1347299 8554872 ClinVar Annotator: match by term: Intellectual disability ClinVar Smad2 Rat Loeys-Dietz syndrome ISO RGD:1347299 8554872 ClinVar Annotator: match by term: Loeys-Dietz syndrome ClinVar PMID:16199547|PMID:28492532 Smad2 Rat Loeys-Dietz syndrome 6 ISO RGD:1347299 8554872 ClinVar Annotator: match by term: Loeys-Dietz syndrome 6 ClinVar PMID:15210694|PMID:25741868|PMID:26247899|PMID:28283438|PMID:28492532|PMID:29392890|PMID:29967133|PMID:30157302|PMID:34655614 Smad2 Rat Microcephaly, Epilepsy, and Diabetes Syndrome ISO RGD:1347299 8554872 ClinVar Annotator: match by term: Microcephaly, epilepsy, and diabetes syndrome ClinVar PMID:28492532 Smad2 Rat scimitar syndrome ISO RGD:1347299 8554872 ClinVar Annotator: match by term: Anomalous pulmonary venous return ClinVar Smad2 Rat thoracic aortic aneurysm ISO RGD:1347299 8554872 ClinVar Annotator: match by term: Thoracic aortic aneurysms and dissections ClinVar PMID:25741868|PMID:28492532 Smad2 Rat Vici syndrome ISO RGD:1347299 8554872 ClinVar Annotator: match by term: Vici syndrome ClinVar PMID:28492532
Only show annotations with direct experimental evidence (0 objects hidden)
Smad2 Rat (20S)-ginsenoside Rg3 multiple interactions ISO RGD:1347299 6480464 ginsenoside Rg3 analog inhibits the reaction [TGFB1 protein results in increased phosphorylation of SMAD2 protein] CTD PMID:24793912 Smad2 Rat (R)-lipoic acid multiple interactions ISO RGD:736957 6480464 Thioctic Acid inhibits the reaction [Bleomycin results in increased phosphorylation of SMAD2 protein] CTD PMID:35187969 Smad2 Rat (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of SMAD2 mRNA; Nicotine results in decreased expression of SMAD2 more ... CTD PMID:29660438|PMID:31299270 Smad2 Rat 1,2-dimethylhydrazine decreases expression EXP 6480464 1,2-Dimethylhydrazine results in decreased expression of SMAD2 mRNA CTD PMID:32387197 Smad2 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:736957 6480464 1,2-Dimethylhydrazine results in decreased expression of SMAD2 mRNA CTD PMID:22206623 Smad2 Rat 1-naphthyl isothiocyanate multiple interactions ISO RGD:736957 6480464 [ITGA5 protein co-treated with ITGB6 protein] promotes the reaction [1-Naphthylisothiocyanate results in increased phosphorylation of more ... CTD PMID:21037076 Smad2 Rat 1-naphthyl isothiocyanate increases phosphorylation ISO RGD:736957 6480464 1-Naphthylisothiocyanate results in increased phosphorylation of SMAD2 protein CTD PMID:21037076 Smad2 Rat 15-deoxy-Delta(12,14)-prostaglandin J2 multiple interactions ISO RGD:1347299 6480464 15-deoxy-delta(12,14)-prostaglandin J2 inhibits the reaction [TGFB1 protein results in increased phosphorylation of SMAD2 protein]; SMAD2 more ... CTD PMID:19429239 Smad2 Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:736957 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SMAD2 mRNA CTD PMID:17942748 Smad2 Rat 17beta-estradiol decreases phosphorylation ISO RGD:736957 6480464 Estradiol results in decreased phosphorylation of SMAD2 protein CTD PMID:17255206 Smad2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:736957 6480464 Tetrachlorodibenzodioxin results in increased expression of SMAD2 mRNA; Tetrachlorodibenzodioxin results in increased expression of SMAD2 more ... CTD PMID:18467041|PMID:24058054 Smad2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SMAD2 mRNA CTD PMID:34747641 Smad2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:736957 6480464 Tetrachlorodibenzodioxin results in decreased expression of SMAD2 protein; Tetrachlorodibenzodioxin results in decreased expression of SMAD2 more ... CTD PMID:33812962 Smad2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1347299 6480464 AHR protein affects the reaction [Tetrachlorodibenzodioxin affects the phosphorylation of SMAD2 protein] CTD PMID:31887333 Smad2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects phosphorylation ISO RGD:1347299 6480464 Tetrachlorodibenzodioxin affects the phosphorylation of SMAD2 protein CTD PMID:31887333 Smad2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:736957 6480464 Tetrachlorodibenzodioxin affects the expression of SMAD2 mRNA CTD PMID:21570461 Smad2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases activity ISO RGD:736957 6480464 Tetrachlorodibenzodioxin results in increased activity of SMAD2 protein CTD PMID:18467041 Smad2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:736957 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SMAD2 mRNA; [Tetrachlorodibenzodioxin results in more ... CTD PMID:17942748|PMID:18467041 Smad2 Rat 2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile multiple interactions ISO RGD:1347299 6480464 Verapamil inhibits the reaction [TGFB1 protein results in increased phosphorylation of SMAD2 protein] CTD PMID:34217686 Smad2 Rat 2-acetamidofluorene multiple interactions EXP 6480464 [2-Acetylaminofluorene co-treated with Diethylnitrosamine] results in increased phosphorylation of SMAD2 protein; IFNA2 protein promotes the more ... CTD PMID:15368444 Smad2 Rat 2-amino-2-deoxy-D-galactopyranose multiple interactions EXP 6480464 Genistein inhibits the reaction [Galactosamine results in increased phosphorylation of SMAD2 protein] CTD PMID:27876602 Smad2 Rat 2-amino-2-deoxy-D-galactopyranose increases phosphorylation EXP 6480464 Galactosamine results in increased phosphorylation of SMAD2 protein CTD PMID:27876602 Smad2 Rat 2-amino-2-deoxy-D-glucopyranose multiple interactions ISO RGD:1347299 6480464 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide inhibits the reaction [Glucosamine analog results in increased phosphorylation of SMAD2 protein] CTD PMID:20458730 Smad2 Rat 2-amino-2-deoxy-D-glucopyranose increases phosphorylation ISO RGD:1347299 6480464 Glucosamine analog results in increased phosphorylation of SMAD2 protein CTD PMID:20458730 Smad2 Rat 2-hydroxypropanoic acid increases expression ISO RGD:1347299 6480464 Lactic Acid results in increased expression of SMAD2 mRNA CTD PMID:30851411 Smad2 Rat 2-methoxy-17beta-estradiol multiple interactions EXP 6480464 2-Methoxyestradiol inhibits the reaction [testosterone enanthate results in increased phosphorylation of SMAD2 protein] CTD PMID:30154949 Smad2 Rat 2-methoxyethanol increases expression EXP 6480464 methyl cellosolve results in increased expression of SMAD2 mRNA CTD PMID:21061450 Smad2 Rat 3,4-dihydroxybenzaldehyde multiple interactions ISO RGD:1347299 6480464 protocatechualdehyde inhibits the reaction [Glucose results in increased phosphorylation of and affects the localization of more ... CTD PMID:17597607 Smad2 Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions ISO RGD:736957 6480464 bisindolylmaleimide I inhibits the reaction [Cyclosporine results in increased phosphorylation of and results in increased more ... CTD PMID:22155090 Smad2 Rat 3-phenylprop-2-enal increases expression ISO RGD:1347299 6480464 cinnamaldehyde results in increased expression of SMAD2 mRNA CTD PMID:19524605 Smad2 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1,2-dithiol-3-thione results in decreased expression of SMAD2 mRNA CTD PMID:19162173 Smad2 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1347299 6480464 bisphenol S results in increased expression of SMAD2 protein CTD PMID:34186270 Smad2 Rat 4-nitrophenol decreases expression ISO RGD:736957 6480464 4-nitrophenol results in decreased expression of SMAD2 mRNA CTD PMID:34673133 Smad2 Rat 5-aza-2'-deoxycytidine increases expression ISO RGD:736957 6480464 Decitabine results in increased expression of SMAD2 mRNA CTD PMID:27915011 Smad2 Rat 5-aza-2'-deoxycytidine multiple interactions EXP 6480464 Decitabine inhibits the reaction [TGFB1 protein results in increased phosphorylation of SMAD2 protein] CTD PMID:24211420 Smad2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SMAD2 mRNA CTD PMID:30047161 Smad2 Rat 6-propyl-2-thiouracil multiple interactions EXP 6480464 Propylthiouracil inhibits the reaction [Aminopropionitrile results in increased phosphorylation of SMAD2 protein] CTD PMID:33462684 Smad2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of SMAD2 mRNA CTD PMID:39441382 Smad2 Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione increases phosphorylation ISO RGD:1347299 6480464 Uric Acid results in increased phosphorylation of SMAD2 protein CTD PMID:36850003 Smad2 Rat aconitic acid multiple interactions ISO RGD:1347299 6480464 [Huang Qi co-treated with Coptidis rhizoma extract co-treated with Aconitic Acid co-treated with Centella asiatica more ... CTD PMID:38282657 Smad2 Rat aconitic acid multiple interactions ISO RGD:736957 6480464 [Huang Qi co-treated with Coptidis rhizoma extract co-treated with Aconitic Acid co-treated with Centella asiatica more ... CTD PMID:38282657 Smad2 Rat acteoside increases phosphorylation ISO RGD:1347299 6480464 acteoside results in increased phosphorylation of SMAD2 protein CTD PMID:17634406 Smad2 Rat aldehydo-D-glucosamine multiple interactions ISO RGD:1347299 6480464 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide inhibits the reaction [Glucosamine analog results in increased phosphorylation of SMAD2 protein] CTD PMID:20458730 Smad2 Rat aldehydo-D-glucosamine increases phosphorylation ISO RGD:1347299 6480464 Glucosamine analog results in increased phosphorylation of SMAD2 protein CTD PMID:20458730 Smad2 Rat aldehydo-D-glucose increases phosphorylation ISO RGD:1347299 6480464 Glucose results in increased phosphorylation of SMAD2 protein CTD PMID:21367880 Smad2 Rat aldehydo-D-glucose multiple interactions EXP 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Glucose results in increased phosphorylation of SMAD2 protein]; diphenyleneiodonium inhibits the more ... CTD PMID:31838053 Smad2 Rat aldehydo-D-glucose increases phosphorylation EXP 6480464 Glucose results in increased phosphorylation of SMAD2 protein CTD PMID:31838053 Smad2 Rat aldehydo-D-glucose multiple interactions ISO RGD:1347299 6480464 Glucose results in increased phosphorylation of and affects the localization of SMAD2 protein; isoangustone A more ... CTD PMID:17597607|PMID:21367880 Smad2 Rat all-trans-retinoic acid increases phosphorylation ISO RGD:1347299 6480464 Tretinoin results in increased phosphorylation of SMAD2 protein CTD PMID:17098229 Smad2 Rat all-trans-retinoic acid multiple interactions ISO RGD:736957 6480464 Tretinoin promotes the reaction [SMAD2 protein binds to MEG3 mRNA] CTD PMID:33493612 Smad2 Rat all-trans-retinoic acid decreases phosphorylation ISO RGD:1347299 6480464 Tretinoin results in decreased phosphorylation of SMAD2 protein CTD PMID:24374174 Smad2 Rat all-trans-retinoic acid decreases expression ISO RGD:736957 6480464 Tretinoin results in decreased expression of SMAD2 mRNA CTD PMID:18703560 Smad2 Rat all-trans-retinoic acid decreases expression ISO RGD:1347299 6480464 Tretinoin results in decreased expression of SMAD2 mRNA CTD PMID:15498508 Smad2 Rat all-trans-retinoic acid multiple interactions ISO RGD:1347299 6480464 Tamoxifen promotes the reaction [Tretinoin results in increased phosphorylation of SMAD2 protein]; Tretinoin inhibits the more ... CTD PMID:17098229|PMID:21274875 Smad2 Rat all-trans-retinoic acid decreases phosphorylation ISO RGD:736957 6480464 Tretinoin results in decreased phosphorylation of SMAD2 protein CTD PMID:16410076|PMID:33493612|PMID:37866657 Smad2 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of SMAD2 mRNA CTD PMID:30047161 Smad2 Rat amlodipine multiple interactions ISO RGD:1347299 6480464 Amlodipine inhibits the reaction [[Doxorubicin co-treated with TGFB1 protein] results in increased phosphorylation of SMAD2 more ... CTD PMID:21337027 Smad2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SMAD2 mRNA CTD PMID:16483693 Smad2 Rat Ammothamnine decreases expression ISO RGD:736957 6480464 oxymatrine results in decreased expression of SMAD2 protein CTD PMID:35785413 Smad2 Rat andrographolide multiple interactions ISO RGD:736957 6480464 andrographolide inhibits the reaction [TGFB1 protein results in increased phosphorylation of SMAD2 protein] CTD PMID:31706003 Smad2 Rat anthocyanin multiple interactions EXP 6480464 Anthocyanins inhibits the reaction [Paraquat results in increased phosphorylation of SMAD2 protein] CTD PMID:30403199 Smad2 Rat antirheumatic drug increases expression ISO RGD:1347299 6480464 Antirheumatic Agents results in increased expression of SMAD2 mRNA CTD PMID:24449571 Smad2 Rat aristolochic acid A increases expression ISO RGD:736957 6480464 aristolochic acid I results in increased expression of SMAD2 mRNA; aristolochic acid I results in more ... CTD PMID:26108275 Smad2 Rat arsane increases expression EXP 6480464 Arsenic results in increased expression of SMAD2 protein modified form CTD PMID:24348802 Smad2 Rat arsane multiple interactions ISO RGD:1347299 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Smad2 Rat arsane multiple interactions EXP 6480464 Grape Seed Extract inhibits the reaction [Arsenic results in increased expression of SMAD2 protein modified more ... CTD PMID:24348802 Smad2 Rat arsenic atom increases expression EXP 6480464 Arsenic results in increased expression of SMAD2 protein modified form CTD PMID:24348802 Smad2 Rat arsenic atom multiple interactions ISO RGD:1347299 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Smad2 Rat arsenic atom multiple interactions EXP 6480464 Grape Seed Extract inhibits the reaction [Arsenic results in increased expression of SMAD2 protein modified more ... CTD PMID:24348802 Smad2 Rat arsenite(3-) multiple interactions ISO RGD:736957 6480464 arsenite inhibits the reaction [TGFB2 protein affects the localization of SMAD2 protein]; arsenite inhibits the more ... CTD PMID:25145660|PMID:26354774 Smad2 Rat arsenous acid decreases expression ISO RGD:1347299 6480464 Arsenic Trioxide results in decreased expression of SMAD2 mRNA CTD PMID:25258189 Smad2 Rat arsenous acid increases expression ISO RGD:1347299 6480464 Arsenic Trioxide results in increased expression of SMAD2 mRNA CTD PMID:32240679 Smad2 Rat arsenous acid multiple interactions ISO RGD:1347299 6480464 Arsenic Trioxide inhibits the reaction [TGFB1 protein results in increased phosphorylation of SMAD2 protein]; RNF4 more ... CTD PMID:24762191|PMID:30317545|PMID:32240679 Smad2 Rat asbestos multiple interactions ISO RGD:1347299 6480464 [Asbestos, Serpentine results in decreased susceptibility to Asbestos] which results in increased expression of SMAD2 more ... CTD PMID:25358858 Smad2 Rat atrazine multiple interactions ISO RGD:1347299 6480464 [Atrazine co-treated with Arsenates] results in increased expression of SMAD2 mRNA CTD PMID:18585445 Smad2 Rat bellidifolin multiple interactions EXP 6480464 bellidifolin inhibits the reaction [TGFB1 protein results in increased expression of and results in increased more ... CTD PMID:33995055 Smad2 Rat benazepril affects expression EXP 6480464 benazepril affects the expression of SMAD2 mRNA; benazepril affects the expression of SMAD2 protein CTD PMID:16635409 Smad2 Rat benazepril multiple interactions EXP 6480464 [benazepril co-treated with irbesartan] affects the expression of SMAD2 mRNA; [benazepril co-treated with irbesartan] affects more ... CTD PMID:16635409 Smad2 Rat benzo[a]pyrene increases methylation ISO RGD:1347299 6480464 Benzo(a)pyrene results in increased methylation of SMAD2 5' UTR; Benzo(a)pyrene results in increased methylation of more ... CTD PMID:27901495 Smad2 Rat benzo[a]pyrene diol epoxide I decreases expression ISO RGD:1347299 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of SMAD2 mRNA CTD PMID:19150397 Smad2 Rat benzo[a]pyrene diol epoxide I increases expression ISO RGD:1347299 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in increased expression of SMAD2 mRNA; 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in increased expression more ... CTD PMID:28529061 Smad2 Rat beta-aminopropionitrile increases phosphorylation EXP 6480464 Aminopropionitrile results in increased phosphorylation of SMAD2 protein CTD PMID:33462684 Smad2 Rat beta-aminopropionitrile multiple interactions EXP 6480464 Propylthiouracil inhibits the reaction [Aminopropionitrile results in increased phosphorylation of SMAD2 protein] CTD PMID:33462684 Smad2 Rat beta-D-glucosamine multiple interactions ISO RGD:1347299 6480464 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide inhibits the reaction [Glucosamine analog results in increased phosphorylation of SMAD2 protein] CTD PMID:20458730 Smad2 Rat beta-D-glucosamine increases phosphorylation ISO RGD:1347299 6480464 Glucosamine analog results in increased phosphorylation of SMAD2 protein CTD PMID:20458730 Smad2 Rat beta-lapachone increases expression ISO RGD:1347299 6480464 beta-lapachone results in increased expression of SMAD2 mRNA CTD PMID:38218311 Smad2 Rat bis(2-ethylhexyl) phthalate decreases phosphorylation EXP 6480464 Diethylhexyl Phthalate results in decreased phosphorylation of SMAD2 protein CTD PMID:31726466 Smad2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SMAD2 mRNA CTD PMID:25181051 Smad2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SMAD2 mRNA CTD PMID:34097993 Smad2 Rat bisphenol A increases expression ISO RGD:1347299 6480464 bisphenol A analog results in increased expression of SMAD2 mRNA; bisphenol A results in increased more ... CTD PMID:32387340|PMID:34186270 Smad2 Rat bisphenol A increases methylation ISO RGD:1347299 6480464 bisphenol A results in increased methylation of SMAD2 promoter CTD PMID:27271280 Smad2 Rat bisphenol A affects methylation ISO RGD:736957 6480464 bisphenol A affects the methylation of SMAD2 promoter CTD PMID:27334623 Smad2 Rat bisphenol AF increases expression ISO RGD:1347299 6480464 bisphenol AF results in increased expression of SMAD2 protein CTD PMID:34186270 Smad2 Rat bisphenol F increases expression ISO RGD:736957 6480464 bisphenol F results in increased expression of SMAD2 mRNA CTD PMID:38685157 Smad2 Rat bleomycin A2 multiple interactions ISO RGD:736957 6480464 camostat inhibits the reaction [Bleomycin results in increased phosphorylation of SMAD2 protein]; honokiol inhibits the more ... CTD PMID:26599507|PMID:31884830|PMID:32032644|PMID:35187969 Smad2 Rat bleomycin A2 increases expression ISO RGD:1347299 6480464 Bleomycin results in increased expression of SMAD2 mRNA CTD PMID:37898439 Smad2 Rat bleomycin A2 multiple interactions ISO RGD:1347299 6480464 yupingfeng inhibits the reaction [Bleomycin results in increased expression of SMAD2 mRNA]; yupingfeng inhibits the more ... CTD PMID:37898439 Smad2 Rat bleomycin A2 increases phosphorylation ISO RGD:1347299 6480464 Bleomycin results in increased phosphorylation of SMAD2 protein CTD PMID:37898439 Smad2 Rat bleomycin A2 increases phosphorylation ISO RGD:736957 6480464 Bleomycin results in increased phosphorylation of SMAD2 protein CTD PMID:26599507|PMID:31884830|PMID:32032644|PMID:35187969 Smad2 Rat butanal decreases expression ISO RGD:1347299 6480464 butyraldehyde results in decreased expression of SMAD2 mRNA CTD PMID:26079696 Smad2 Rat cadmium dichloride multiple interactions ISO RGD:1347299 6480464 [Cadmium Chloride co-treated with sodium arsenite] results in increased expression of SMAD2 mRNA; Acetylcysteine inhibits more ... CTD PMID:29408318 Smad2 Rat cadmium dichloride increases expression ISO RGD:1347299 6480464 Cadmium Chloride results in increased expression of SMAD2 mRNA CTD PMID:38382870 Smad2 Rat caffeine decreases expression EXP 6480464 Caffeine results in decreased expression of SMAD2 mRNA; Caffeine results in decreased expression of SMAD2 more ... CTD PMID:32663519 Smad2 Rat camostat multiple interactions ISO RGD:736957 6480464 camostat inhibits the reaction [Bleomycin results in increased phosphorylation of SMAD2 protein] CTD PMID:26599507 Smad2 Rat carbofuran increases expression EXP 6480464 Carbofuran results in increased expression of SMAD2 mRNA CTD PMID:28982980 Smad2 Rat carbofuran multiple interactions EXP 6480464 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide inhibits the reaction [Carbofuran results in increased phosphorylation of SMAD2 protein] CTD PMID:28982980 Smad2 Rat carbofuran increases phosphorylation EXP 6480464 Carbofuran results in increased phosphorylation of SMAD2 protein CTD PMID:28982980 Smad2 Rat carnosine multiple interactions EXP 6480464 Carnosine inhibits the reaction [Sodium Nitrite results in increased expression of SMAD2 protein] CTD PMID:28266762 Smad2 Rat ceruletide multiple interactions ISO RGD:736957 6480464 [Shuangshen co-treated with Ceruletide] results in decreased expression of SMAD2 protein CTD PMID:38113986 Smad2 Rat CGP 52608 multiple interactions ISO RGD:1347299 6480464 CGP 52608 promotes the reaction [RORA protein binds to SMAD2 gene] CTD PMID:28238834 Smad2 Rat chlorpyrifos increases phosphorylation ISO RGD:1347299 6480464 Chlorpyrifos results in increased phosphorylation of SMAD2 protein CTD PMID:32156659 Smad2 Rat chromium atom increases expression EXP 6480464 Chromium results in increased expression of SMAD2 mRNA CTD PMID:17692352 Smad2 Rat chrysin multiple interactions ISO RGD:736957 6480464 chrysin inhibits the reaction [Carbon Tetrachloride results in increased expression of SMAD2 mRNA] CTD PMID:26297989 Smad2 Rat cisplatin decreases expression ISO RGD:736957 6480464 Cisplatin results in decreased expression of SMAD2 protein CTD PMID:23628706 Smad2 Rat cisplatin multiple interactions EXP 6480464 Cisplatin inhibits the reaction [crocin results in decreased expression of SMAD2 protein]; crocin inhibits the more ... CTD PMID:32259551 Smad2 Rat cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of SMAD2 protein CTD PMID:32259551 Smad2 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of SMAD2 protein CTD PMID:23628706 Smad2 Rat cobalt dichloride decreases expression ISO RGD:1347299 6480464 cobaltous chloride results in decreased expression of SMAD2 mRNA CTD PMID:19320972|PMID:19376846 Smad2 Rat copper atom multiple interactions ISO RGD:1347299 6480464 [Chelating Agents binds to Copper] which results in increased expression of SMAD2 mRNA CTD PMID:30911355 Smad2 Rat copper(0) multiple interactions ISO RGD:1347299 6480464 [Chelating Agents binds to Copper] which results in increased expression of SMAD2 mRNA CTD PMID:30911355 Smad2 Rat copper(II) sulfate increases phosphorylation ISO RGD:736957 6480464 Copper Sulfate results in increased phosphorylation of SMAD2 protein CTD PMID:33744278 Smad2 Rat copper(II) sulfate increases expression ISO RGD:736957 6480464 Copper Sulfate results in increased expression of SMAD2 mRNA CTD PMID:33744278 Smad2 Rat corticosterone decreases expression EXP 6480464 Corticosterone results in decreased expression of SMAD2 mRNA; Corticosterone results in decreased expression of SMAD2 more ... CTD PMID:29660438|PMID:32663519 Smad2 Rat coumestrol multiple interactions ISO RGD:1347299 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of SMAD2 mRNA CTD PMID:19167446 Smad2 Rat crocidolite asbestos affects expression ISO RGD:1347299 6480464 Asbestos, Crocidolite affects the expression of SMAD2 mRNA CTD PMID:17331233 Smad2 Rat crocidolite asbestos increases phosphorylation ISO RGD:1347299 6480464 Asbestos, Crocidolite results in increased phosphorylation of SMAD2 protein CTD PMID:17975199 Smad2 Rat crocin-1 decreases expression EXP 6480464 crocin results in decreased expression of SMAD2 protein CTD PMID:32259551 Smad2 Rat crocin-1 multiple interactions EXP 6480464 Cisplatin inhibits the reaction [crocin results in decreased expression of SMAD2 protein]; crocin inhibits the more ... CTD PMID:32259551 Smad2 Rat curcumin multiple interactions EXP 6480464 Curcumin inhibits the reaction [AGT protein results in increased phosphorylation of SMAD2 protein] CTD PMID:26648693 Smad2 Rat cyclosporin A multiple interactions ISO RGD:736957 6480464 bisindolylmaleimide I inhibits the reaction [Cyclosporine results in increased phosphorylation of and results in increased more ... CTD PMID:22155090 Smad2 Rat cytochalasin D affects localization ISO RGD:1347299 6480464 Cytochalasin D affects the localization of SMAD2 protein CTD PMID:25756282 Smad2 Rat D-glucose multiple interactions ISO RGD:1347299 6480464 Glucose results in increased phosphorylation of and affects the localization of SMAD2 protein; isoangustone A more ... CTD PMID:17597607|PMID:21367880 Smad2 Rat D-glucose increases phosphorylation EXP 6480464 Glucose results in increased phosphorylation of SMAD2 protein CTD PMID:31838053 Smad2 Rat D-glucose multiple interactions EXP 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Glucose results in increased phosphorylation of SMAD2 protein]; diphenyleneiodonium inhibits the more ... CTD PMID:31838053 Smad2 Rat D-glucose increases phosphorylation ISO RGD:1347299 6480464 Glucose results in increased phosphorylation of SMAD2 protein CTD PMID:21367880 Smad2 Rat dexamethasone decreases expression ISO RGD:736957 6480464 Dexamethasone results in decreased expression of SMAD2 mRNA CTD PMID:29329878 Smad2 Rat diarsenic trioxide multiple interactions ISO RGD:1347299 6480464 Arsenic Trioxide inhibits the reaction [TGFB1 protein results in increased phosphorylation of SMAD2 protein]; RNF4 more ... CTD PMID:24762191|PMID:30317545|PMID:32240679 Smad2 Rat diarsenic trioxide increases expression ISO RGD:1347299 6480464 Arsenic Trioxide results in increased expression of SMAD2 mRNA CTD PMID:32240679 Smad2 Rat diarsenic trioxide decreases expression ISO RGD:1347299 6480464 Arsenic Trioxide results in decreased expression of SMAD2 mRNA CTD PMID:25258189 Smad2 Rat dibenziodolium multiple interactions EXP 6480464 diphenyleneiodonium inhibits the reaction [Glucose results in increased phosphorylation of SMAD2 protein] CTD PMID:31838053 Smad2 Rat diethylstilbestrol decreases phosphorylation ISO RGD:736957 6480464 Diethylstilbestrol results in decreased phosphorylation of SMAD2 protein CTD PMID:17255206 Smad2 Rat dimethyl sulfoxide multiple interactions ISO RGD:1347299 6480464 [Dimethyl Sulfoxide co-treated with TGFB1 protein] results in increased expression of SMAD2 protein modified form CTD PMID:35366062 Smad2 Rat diminazene diaceturate decreases phosphorylation ISO RGD:1347299 6480464 diminazene aceturate results in decreased phosphorylation of SMAD2 protein CTD PMID:29977014 Smad2 Rat dioxygen multiple interactions ISO RGD:736957 6480464 rosiglitazone inhibits the reaction [Oxygen deficiency results in increased phosphorylation of SMAD2 protein] CTD PMID:21531777 Smad2 Rat dioxygen increases phosphorylation ISO RGD:1347299 6480464 Oxygen deficiency results in increased phosphorylation of SMAD2 protein CTD PMID:23725749 Smad2 Rat dioxygen increases phosphorylation ISO RGD:736957 6480464 Oxygen deficiency results in increased phosphorylation of SMAD2 protein CTD PMID:21531777 Smad2 Rat disodium selenite multiple interactions ISO RGD:736957 6480464 [Folic Acid co-treated with INS protein co-treated with TF protein co-treated with Sodium Selenite] results more ... CTD PMID:32324263 Smad2 Rat dorsomorphin multiple interactions ISO RGD:1347299 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Smad2 Rat doxorubicin decreases expression ISO RGD:1347299 6480464 Doxorubicin results in decreased expression of SMAD2 protein CTD PMID:18606404 Smad2 Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of SMAD2 mRNA CTD PMID:21337027 Smad2 Rat doxorubicin multiple interactions ISO RGD:1347299 6480464 [Doxorubicin co-treated with TGFB1 protein] results in increased expression of SMAD2 mRNA; [Doxorubicin co-treated with more ... CTD PMID:21337027 Smad2 Rat enalapril multiple interactions EXP 6480464 Enalapril promotes the reaction [paricalcitol results in decreased phosphorylation of SMAD2 protein] CTD PMID:17513326 Smad2 Rat endosulfan multiple interactions ISO RGD:1347299 6480464 Endosulfan results in decreased expression of and results in decreased phosphorylation of SMAD2 protein; Endosulfan more ... CTD PMID:32413665|PMID:34856488|PMID:36513242 Smad2 Rat endosulfan increases phosphorylation ISO RGD:1347299 6480464 Endosulfan results in increased phosphorylation of SMAD2 protein CTD PMID:34856488 Smad2 Rat endosulfan decreases expression ISO RGD:1347299 6480464 Endosulfan results in decreased expression of SMAD2 mRNA CTD PMID:30090376 Smad2 Rat Enterolactone multiple interactions ISO RGD:1347299 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of SMAD2 mRNA CTD PMID:19167446 Smad2 Rat entinostat decreases expression ISO RGD:1347299 6480464 entinostat results in decreased expression of SMAD2 mRNA CTD PMID:26272509 Smad2 Rat entinostat multiple interactions ISO RGD:1347299 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Smad2 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of SMAD2 mRNA CTD PMID:17920746 Smad2 Rat ethanol multiple interactions EXP 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased phosphorylation of SMAD2 protein; methyl ferulate inhibits more ... CTD PMID:30543783 Smad2 Rat etoposide multiple interactions ISO RGD:1347299 6480464 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide inhibits the reaction [Etoposide results in increased phosphorylation of SMAD2 protein] CTD PMID:22363485 Smad2 Rat etoposide increases phosphorylation ISO RGD:1347299 6480464 Etoposide results in increased phosphorylation of SMAD2 protein CTD PMID:22363485 Smad2 Rat Evodiamine multiple interactions ISO RGD:1347299 6480464 evodiamine inhibits the reaction [TGFB1 protein results in increased phosphorylation of and results in increased more ... CTD PMID:28303407 Smad2 Rat Evodiamine multiple interactions EXP 6480464 evodiamine inhibits the reaction [TGFB1 protein results in increased phosphorylation of and results in increased more ... CTD PMID:28303407 Smad2 Rat farrerol multiple interactions EXP 6480464 farrerol inhibits the reaction [Glucose results in increased phosphorylation of SMAD2 protein] CTD PMID:31838053 Smad2 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of SMAD2 mRNA; Flutamide results in decreased expression of SMAD2 more ... CTD PMID:16166221 Smad2 Rat folic acid multiple interactions ISO RGD:736957 6480464 [Folic Acid co-treated with INS protein co-treated with TF protein co-treated with Sodium Selenite] results more ... CTD PMID:32324263 Smad2 Rat FR900359 multiple interactions ISO RGD:1347299 6480464 FR900359 inhibits the reaction [Thrombin results in increased phosphorylation of SMAD2 protein] CTD PMID:36430902 Smad2 Rat FR900359 increases phosphorylation ISO RGD:1347299 6480464 FR900359 results in increased phosphorylation of SMAD2 protein CTD PMID:37730182 Smad2 Rat galangin increases phosphorylation ISO RGD:1347299 6480464 galangin results in increased phosphorylation of SMAD2 protein CTD PMID:25268046 Smad2 Rat galangin increases expression ISO RGD:1347299 6480464 galangin results in increased expression of SMAD2 mRNA CTD PMID:25268046 Smad2 Rat galangin multiple interactions ISO RGD:1347299 6480464 LY2109761 inhibits the reaction [galangin results in increased phosphorylation of SMAD2 protein] CTD PMID:25268046 Smad2 Rat genistein multiple interactions EXP 6480464 Genistein inhibits the reaction [Galactosamine results in increased phosphorylation of SMAD2 protein] CTD PMID:27876602 Smad2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of SMAD2 mRNA CTD PMID:22061828 Smad2 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of SMAD2 mRNA CTD PMID:33387578 Smad2 Rat glucose multiple interactions ISO RGD:1347299 6480464 Glucose results in increased phosphorylation of and affects the localization of SMAD2 protein; isoangustone A more ... CTD PMID:17597607|PMID:21367880 Smad2 Rat glucose increases phosphorylation EXP 6480464 Glucose results in increased phosphorylation of SMAD2 protein CTD PMID:31838053 Smad2 Rat glucose multiple interactions EXP 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Glucose results in increased phosphorylation of SMAD2 protein]; diphenyleneiodonium inhibits the more ... CTD PMID:31838053 Smad2 Rat glucose increases phosphorylation ISO RGD:1347299 6480464 Glucose results in increased phosphorylation of SMAD2 protein CTD PMID:21367880 Smad2 Rat glycerol 2-phosphate multiple interactions ISO RGD:736957 6480464 [beta-glycerophosphoric acid co-treated with Ascorbic Acid] results in decreased phosphorylation of and affects the localization more ... CTD PMID:38914176 Smad2 Rat heptachlor increases expression ISO RGD:1347299 6480464 Heptachlor results in increased expression of SMAD2 mRNA; Heptachlor results in increased expression of SMAD2 more ... CTD PMID:30719927 Smad2 Rat hispidin multiple interactions ISO RGD:736957 6480464 hispidin inhibits the reaction [Cyclosporine results in increased phosphorylation of and results in increased activity more ... CTD PMID:22155090 Smad2 Rat Honokiol multiple interactions ISO RGD:736957 6480464 honokiol inhibits the reaction [Bleomycin results in increased phosphorylation of SMAD2 protein] CTD PMID:32032644 Smad2 Rat Honokiol multiple interactions EXP 6480464 honokiol inhibits the reaction [TGFB1 protein results in increased phosphorylation of SMAD2 protein] CTD PMID:21265825 Smad2 Rat Honokiol multiple interactions ISO RGD:1347299 6480464 honokiol inhibits the reaction [TGFB1 protein results in increased phosphorylation of SMAD2 protein] CTD PMID:32032644 Smad2 Rat hyaluronic acid multiple interactions ISO RGD:1347299 6480464 [4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide results in decreased activity of [SMAD2 protein co-treated with SMAD3 protein]] inhibits the reaction more ... CTD PMID:21520325 Smad2 Rat hydrogen peroxide increases phosphorylation ISO RGD:1347299 6480464 Hydrogen Peroxide results in increased phosphorylation of SMAD2 protein CTD PMID:15147944 Smad2 Rat hydrogen peroxide decreases expression ISO RGD:1347299 6480464 Hydrogen Peroxide results in decreased expression of SMAD2 mRNA CTD PMID:34581912 Smad2 Rat hydrogen peroxide multiple interactions ISO RGD:1347299 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in increased expression of SMAD2 protein CTD PMID:18951874 Smad2 Rat irbesartan multiple interactions EXP 6480464 [benazepril co-treated with irbesartan] affects the expression of SMAD2 mRNA; [benazepril co-treated with irbesartan] affects more ... CTD PMID:16635409 Smad2 Rat irbesartan affects expression EXP 6480464 irbesartan affects the expression of SMAD2 mRNA; irbesartan affects the expression of SMAD2 protein CTD PMID:16635409 Smad2 Rat Isoangustone A multiple interactions ISO RGD:1347299 6480464 isoangustone A inhibits the reaction [Glucose results in increased phosphorylation of SMAD2 protein] CTD PMID:21367880 Smad2 Rat isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of SMAD2 mRNA CTD PMID:35014750 Smad2 Rat isorhamnetin multiple interactions ISO RGD:1347299 6480464 3-methylquercetin inhibits the reaction [TGFB1 protein results in increased phosphorylation of SMAD2 protein] CTD PMID:27151496 Smad2 Rat ivermectin decreases expression ISO RGD:1347299 6480464 Ivermectin results in decreased expression of SMAD2 protein CTD PMID:32959892 Smad2 Rat L-ascorbic acid multiple interactions ISO RGD:736957 6480464 [beta-glycerophosphoric acid co-treated with Ascorbic Acid] results in decreased phosphorylation of and affects the localization more ... CTD PMID:38914176 Smad2 Rat leptomycin B multiple interactions ISO RGD:736957 6480464 leptomycin B inhibits the reaction [arsenite inhibits the reaction [TGFB2 protein affects the localization of more ... CTD PMID:26354774 Smad2 Rat lipoic acid multiple interactions ISO RGD:736957 6480464 Thioctic Acid inhibits the reaction [Bleomycin results in increased phosphorylation of SMAD2 protein] CTD PMID:35187969 Smad2 Rat lipopolysaccharide increases expression ISO RGD:736957 6480464 Lipopolysaccharides results in increased expression of SMAD2 mRNA CTD PMID:10975854 Smad2 Rat lipopolysaccharide increases expression ISO RGD:1347299 6480464 Lipopolysaccharides results in increased expression of SMAD2 mRNA CTD PMID:35953652 Smad2 Rat lipopolysaccharide multiple interactions ISO RGD:1347299 6480464 Lipopolysaccharides inhibits the reaction [Propofol results in decreased expression of SMAD2 mRNA]; Lipopolysaccharides inhibits the more ... CTD PMID:35953652 Smad2 Rat lipopolysaccharide multiple interactions EXP 6480464 Lipopolysaccharides promotes the reaction [Thioacetamide results in increased expression of SMAD2 mRNA] CTD PMID:17621560 Smad2 Rat LY-2157299 multiple interactions ISO RGD:736957 6480464 [ABCB4 protein affects the susceptibility to LY-2157299] which affects the phosphorylation of SMAD2 protein CTD PMID:29808285 Smad2 Rat LY294002 multiple interactions ISO RGD:1347299 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [cyanoginosin LR results in increased phosphorylation of SMAD2 protein] CTD PMID:27856280 Smad2 Rat manganese atom multiple interactions ISO RGD:1347299 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Smad2 Rat manganese(0) multiple interactions ISO RGD:1347299 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Smad2 Rat manganese(II) chloride multiple interactions ISO RGD:1347299 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Smad2 Rat melphalan multiple interactions ISO RGD:1347299 6480464 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide inhibits the reaction [Melphalan results in increased phosphorylation of SMAD2 protein] CTD PMID:22363485 Smad2 Rat melphalan increases phosphorylation ISO RGD:1347299 6480464 Melphalan results in increased phosphorylation of SMAD2 protein CTD PMID:22363485 Smad2 Rat mercury atom increases expression ISO RGD:1347299 6480464 Mercury results in increased expression of SMAD2 mRNA CTD PMID:19937285 Smad2 Rat mercury(0) increases expression ISO RGD:1347299 6480464 Mercury results in increased expression of SMAD2 mRNA CTD PMID:19937285 Smad2 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of SMAD2 mRNA CTD PMID:30047161 Smad2 Rat methoxychlor decreases expression EXP 6480464 Methoxychlor results in decreased expression of SMAD2 mRNA CTD PMID:23303685 Smad2 Rat methoxychlor increases methylation EXP 6480464 Methoxychlor results in increased methylation of SMAD2 gene CTD PMID:23303685 Smad2 Rat methyl beta-cyclodextrin multiple interactions ISO RGD:1347299 6480464 methyl-beta-cyclodextrin inhibits the reaction [pentabromophenol inhibits the reaction [TGFB1 protein results in increased phosphorylation of more ... CTD PMID:28230093 Smad2 Rat methyl methanesulfonate decreases expression ISO RGD:1347299 6480464 Methyl Methanesulfonate results in decreased expression of SMAD2 mRNA CTD PMID:23649840 Smad2 Rat methylmercury chloride decreases expression ISO RGD:1347299 6480464 methylmercuric chloride results in decreased expression of SMAD2 mRNA CTD PMID:28001369 Smad2 Rat microcystin-LR multiple interactions ISO RGD:1347299 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [cyanoginosin LR results in increased phosphorylation of SMAD2 protein]; cyanoginosin LR more ... CTD PMID:27856280 Smad2 Rat mitoxantrone affects response to substance ISO RGD:1347299 6480464 SMAD2 protein affects the susceptibility to Mitoxantrone CTD PMID:16217747 Smad2 Rat mono(2-ethylhexyl) phthalate decreases phosphorylation EXP 6480464 mono-(2-ethylhexyl)phthalate results in decreased phosphorylation of SMAD2 protein CTD PMID:31726466 Smad2 Rat mono(2-ethylhexyl) phthalate multiple interactions EXP 6480464 TGFB1 protein inhibits the reaction [mono-(2-ethylhexyl)phthalate results in decreased phosphorylation of SMAD2 protein] CTD PMID:31726466 Smad2 Rat N(gamma)-nitro-L-arginine methyl ester multiple interactions ISO RGD:736957 6480464 [Huang Qi co-treated with Coptidis rhizoma extract co-treated with Aconitic Acid co-treated with Centella asiatica more ... CTD PMID:38282657 Smad2 Rat N-acetyl-L-cysteine decreases phosphorylation ISO RGD:1347299 6480464 Acetylcysteine results in decreased phosphorylation of SMAD2 protein CTD PMID:32947957 Smad2 Rat N-acetyl-L-cysteine multiple interactions ISO RGD:736957 6480464 Acetylcysteine inhibits the reaction [[nickel chloride results in increased abundance of Nickel] which results in more ... CTD PMID:38488660 Smad2 Rat N-acetyl-L-cysteine multiple interactions ISO RGD:1347299 6480464 Acetylcysteine inhibits the reaction [[Cadmium Chloride co-treated with sodium arsenite] results in increased expression of more ... CTD PMID:29408318|PMID:30317545 Smad2 Rat N-ethyl-N-nitrosourea increases mutagenesis ISO RGD:736957 6480464 Ethylnitrosourea results in increased mutagenesis of SMAD2 gene CTD PMID:16724327 Smad2 Rat N-methyl-N'-nitro-N-nitrosoguanidine decreases expression ISO RGD:1347299 6480464 Methylnitronitrosoguanidine results in decreased expression of SMAD2 mRNA CTD PMID:12634122 Smad2 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [2-Acetylaminofluorene co-treated with Diethylnitrosamine] results in increased phosphorylation of SMAD2 protein; IFNA2 protein promotes the more ... CTD PMID:15368444 Smad2 Rat N-nitrosodiethylamine decreases phosphorylation EXP 6480464 Diethylnitrosamine results in decreased phosphorylation of SMAD2 protein CTD PMID:18971187 Smad2 Rat N-nitrosodimethylamine increases phosphorylation EXP 6480464 Dimethylnitrosamine results in increased phosphorylation of SMAD2 protein CTD PMID:14568256 Smad2 Rat N-nitrosodimethylamine multiple interactions EXP 6480464 Leu-Ser-Lys-Leu peptide inhibits the reaction [Dimethylnitrosamine results in increased phosphorylation of SMAD2 protein] CTD PMID:14568256 Smad2 Rat nickel atom multiple interactions ISO RGD:736957 6480464 [nickel chloride results in increased abundance of Nickel] which results in increased phosphorylation of SMAD2 more ... CTD PMID:38488660 Smad2 Rat nickel dichloride multiple interactions ISO RGD:736957 6480464 [nickel chloride results in increased abundance of Nickel] which results in increased phosphorylation of SMAD2 more ... CTD PMID:38488660 Smad2 Rat niclosamide multiple interactions ISO RGD:1347299 6480464 Niclosamide inhibits the reaction [TGFB1 protein results in increased phosphorylation of SMAD2 protein] CTD PMID:36870549 Smad2 Rat nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of SMAD2 mRNA; Nicotine results in decreased expression of SMAD2 more ... CTD PMID:29660438|PMID:31299270 Smad2 Rat nitrates multiple interactions ISO RGD:736957 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of SMAD2 more ... CTD PMID:35964746 Smad2 Rat nitrofen decreases expression ISO RGD:736957 6480464 nitrofen results in decreased expression of SMAD2 mRNA CTD PMID:12149686 Smad2 Rat ochratoxin A increases expression ISO RGD:736957 6480464 ochratoxin A results in increased expression of SMAD2 mRNA CTD PMID:32617660|PMID:35543154 Smad2 Rat ochratoxin A increases response to substance ISO RGD:1347299 6480464 SMAD2 results in increased susceptibility to ochratoxin A CTD PMID:35543154 Smad2 Rat ochratoxin A multiple interactions ISO RGD:736957 6480464 ochratoxin A results in increased expression of and results in increased phosphorylation of SMAD2 protein CTD PMID:35543154 Smad2 Rat ochratoxin A multiple interactions ISO RGD:1347299 6480464 4-(4-(3-(pyridin-2-yl)-1H-pyrazol-4-yl)pyridin-2-yl)-N-(tetrahydro-2H-pyran-4-yl)benzamide inhibits the reaction [ochratoxin A results in increased expression of SMAD2 mRNA]; 4-(4-(3-(pyridin-2-yl)-1H-pyrazol-4-yl)pyridin-2-yl)-N-(tetrahydro-2H-pyran-4-yl)benzamide inhibits more ... CTD PMID:32617660|PMID:35543154 Smad2 Rat ochratoxin A increases expression ISO RGD:1347299 6480464 ochratoxin A results in increased expression of SMAD2 mRNA CTD PMID:32617660|PMID:35543154 Smad2 Rat oridonin multiple interactions ISO RGD:1347299 6480464 oridonin inhibits the reaction [TGFB1 protein results in increased phosphorylation of SMAD2 protein] CTD PMID:30243739 Smad2 Rat osthole multiple interactions ISO RGD:1347299 6480464 [platycodin D co-treated with osthol] inhibits the reaction [TGFB1 protein results in increased phosphorylation of more ... CTD PMID:23603464 Smad2 Rat ozone multiple interactions ISO RGD:1347299 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of SMAD2 mRNA CTD PMID:35430440 Smad2 Rat panobinostat multiple interactions ISO RGD:1347299 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Smad2 Rat panobinostat decreases expression ISO RGD:1347299 6480464 panobinostat results in decreased expression of SMAD2 mRNA CTD PMID:26272509 Smad2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of SMAD2 mRNA CTD PMID:16701773 Smad2 Rat paraquat increases expression ISO RGD:1347299 6480464 Paraquat results in increased expression of SMAD2 protein modified form CTD PMID:27682480 Smad2 Rat paraquat increases phosphorylation ISO RGD:1347299 6480464 Paraquat results in increased phosphorylation of SMAD2 protein CTD PMID:30265375 Smad2 Rat paraquat increases expression ISO RGD:736957 6480464 Paraquat results in increased expression of SMAD2 mRNA CTD PMID:32462952 Smad2 Rat paraquat multiple interactions ISO RGD:736957 6480464 tetramethylpyrazine inhibits the reaction [Paraquat results in increased phosphorylation of SMAD2 protein]; Xuebijing inhibits the more ... CTD PMID:30744607|PMID:32462952 Smad2 Rat paraquat increases phosphorylation ISO RGD:736957 6480464 Paraquat results in increased phosphorylation of SMAD2 protein CTD PMID:30744607|PMID:32462952 Smad2 Rat paraquat multiple interactions ISO RGD:1347299 6480464 sodium bisulfide inhibits the reaction [Paraquat results in increased phosphorylation of SMAD2 protein]; TGFB1 protein more ... CTD PMID:27682480|PMID:30265375 Smad2 Rat paraquat multiple interactions EXP 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Paraquat results in increased phosphorylation of SMAD2 protein]; [SB 203580 co-treated more ... CTD PMID:25873302|PMID:30403199 Smad2 Rat paraquat increases phosphorylation EXP 6480464 Paraquat results in increased phosphorylation of SMAD2 protein CTD PMID:25873302|PMID:30403199 Smad2 Rat paricalcitol decreases phosphorylation EXP 6480464 paricalcitol results in decreased phosphorylation of SMAD2 protein CTD PMID:17513326 Smad2 Rat paricalcitol multiple interactions EXP 6480464 Enalapril promotes the reaction [paricalcitol results in decreased phosphorylation of SMAD2 protein] CTD PMID:17513326 Smad2 Rat patulin increases phosphorylation EXP 6480464 Patulin results in increased phosphorylation of SMAD2 protein CTD PMID:34896196 Smad2 Rat phenobarbital affects expression ISO RGD:1347299 6480464 Phenobarbital affects the expression of SMAD2 mRNA CTD PMID:19159669 Smad2 Rat phenylephrine multiple interactions EXP 6480464 Phenylephrine results in increased phosphorylation of and results in increased localization of and results in more ... CTD PMID:19443575 Smad2 Rat phenylmercury acetate decreases expression ISO RGD:1347299 6480464 Phenylmercuric Acetate results in decreased expression of SMAD2 mRNA CTD PMID:26272509 Smad2 Rat phenylmercury acetate multiple interactions ISO RGD:1347299 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Smad2 Rat phloroglucinol multiple interactions ISO RGD:1347299 6480464 Phloroglucinol analog inhibits the reaction [TGFB1 protein results in increased phosphorylation of SMAD2 protein] CTD PMID:26054450 Smad2 Rat phorbol 13-acetate 12-myristate multiple interactions ISO RGD:736957 6480464 Tetradecanoylphorbol Acetate results in increased expression of and affects the localization of SMAD2 protein; Tetradecanoylphorbol more ... CTD PMID:20172950 Smad2 Rat phorbol 13-acetate 12-myristate increases expression ISO RGD:736957 6480464 Tetradecanoylphorbol Acetate results in increased expression of SMAD2 protein CTD PMID:20172950 Smad2 Rat Phyllanthin multiple interactions ISO RGD:736957 6480464 phyllanthin inhibits the reaction [Carbon Tetrachloride results in increased expression of SMAD2 protein] CTD PMID:26337812 Smad2 Rat platycodin D multiple interactions ISO RGD:1347299 6480464 [platycodin D co-treated with osthol] inhibits the reaction [TGFB1 protein results in increased phosphorylation of more ... CTD PMID:23603464 Smad2 Rat procymidone decreases expression EXP 6480464 procymidone results in decreased expression of SMAD2 mRNA CTD PMID:15686871 Smad2 Rat progesterone affects expression ISO RGD:736957 6480464 Progesterone affects the expression of SMAD2 mRNA CTD PMID:17251523 Smad2 Rat progesterone multiple interactions ISO RGD:1347299 6480464 [4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide results in decreased activity of [SMAD2 protein co-treated with SMAD3 protein]] promotes the reaction more ... CTD PMID:21520325 Smad2 Rat propiconazole increases localization ISO RGD:1347299 6480464 propiconazole results in increased localization of SMAD2 protein CTD PMID:34170130 Smad2 Rat propofol multiple interactions ISO RGD:1347299 6480464 Lipopolysaccharides inhibits the reaction [Propofol results in decreased expression of SMAD2 mRNA] CTD PMID:35953652 Smad2 Rat propofol decreases expression ISO RGD:1347299 6480464 Propofol results in decreased expression of SMAD2 mRNA CTD PMID:35953652 Smad2 Rat quercetin multiple interactions ISO RGD:1347299 6480464 Quercetin inhibits the reaction [SMAD2 protein modified form binds to SMAD3 protein modified form binds more ... CTD PMID:15580028|PMID:33070227 Smad2 Rat quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [Sodium Nitrite results in increased expression of SMAD2 protein] CTD PMID:28000380 Smad2 Rat quercetin multiple interactions ISO RGD:736957 6480464 Quercetin promotes the reaction [TGFB1 protein results in increased phosphorylation of SMAD2 protein] CTD PMID:21216973 Smad2 Rat quercetin decreases phosphorylation ISO RGD:1347299 6480464 Quercetin results in decreased phosphorylation of SMAD2 protein CTD PMID:33070227 Smad2 Rat quercetin decreases expression ISO RGD:1347299 6480464 Quercetin results in decreased expression of SMAD2 protein; Quercetin results in decreased expression of SMAD2 more ... CTD PMID:15580028 Smad2 Rat rac-lactic acid increases expression ISO RGD:1347299 6480464 Lactic Acid results in increased expression of SMAD2 mRNA CTD PMID:30851411 Smad2 Rat raloxifene decreases phosphorylation ISO RGD:1347299 6480464 Raloxifene Hydrochloride results in decreased phosphorylation of SMAD2 protein CTD PMID:32947957 Smad2 Rat ramipril multiple interactions EXP 6480464 [Streptozocin co-treated with Resveratrol co-treated with Ramipril] results in decreased phosphorylation of SMAD2 protein CTD PMID:31062909 Smad2 Rat resveratrol multiple interactions EXP 6480464 [Streptozocin co-treated with Resveratrol co-treated with Ramipril] results in decreased phosphorylation of SMAD2 protein; Resveratrol more ... CTD PMID:21300041|PMID:31062909 Smad2 Rat resveratrol multiple interactions ISO RGD:736957 6480464 resveratrol inhibits the reaction [lipopolysaccharide, Escherichia coli O111 B4 results in increased phosphorylation of SMAD2 more ... CTD PMID:25234611 Smad2 Rat resveratrol decreases expression ISO RGD:1347299 6480464 resveratrol results in decreased expression of SMAD2 mRNA; resveratrol results in decreased expression of SMAD2 more ... CTD PMID:18089832|PMID:25721869 Smad2 Rat resveratrol decreases phosphorylation ISO RGD:736957 6480464 resveratrol results in decreased phosphorylation of SMAD2 protein CTD PMID:21679764 Smad2 Rat rutin multiple interactions EXP 6480464 Rutin inhibits the reaction [Cholesterol, Dietary results in increased expression of SMAD2 mRNA] CTD PMID:27239252 Smad2 Rat salubrinal multiple interactions ISO RGD:736957 6480464 salubrinal inhibits the reaction [Cyclosporine results in increased phosphorylation of and results in increased activity more ... CTD PMID:22155090 Smad2 Rat SB 203580 multiple interactions EXP 6480464 [SB 203580 co-treated with 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one] inhibits the reaction [Paraquat results in increased phosphorylation of SMAD2 more ... CTD PMID:25873302 Smad2 Rat SB 431542 decreases phosphorylation EXP 6480464 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide results in decreased phosphorylation of SMAD2 protein CTD PMID:28982980 Smad2 Rat SB 431542 affects phosphorylation ISO RGD:1347299 6480464 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide affects the phosphorylation of SMAD2 protein CTD PMID:22363485 Smad2 Rat SB 431542 decreases phosphorylation ISO RGD:736957 6480464 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide results in decreased phosphorylation of SMAD2 protein CTD PMID:20852150 Smad2 Rat SB 431542 multiple interactions ISO RGD:736957 6480464 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide inhibits the reaction [TGFB1 protein results in increased phosphorylation of and results in increased more ... CTD PMID:20852150 Smad2 Rat SB 431542 multiple interactions ISO RGD:1347299 6480464 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide inhibits the reaction [Etoposide results in increased phosphorylation of SMAD2 protein]; 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide inhibits the more ... CTD PMID:20074812|PMID:20458730|PMID:21520325|PMID:22363485|PMID:27188386|PMID:31381904|PMID:36430902 Smad2 Rat SB 431542 multiple interactions EXP 6480464 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide inhibits the reaction [Carbofuran results in increased phosphorylation of SMAD2 protein] CTD PMID:28982980 Smad2 Rat serpentine asbestos affects localization ISO RGD:1347299 6480464 Asbestos, Serpentine affects the localization of SMAD2 protein modified form CTD PMID:26685284 Smad2 Rat serpentine asbestos increases phosphorylation ISO RGD:1347299 6480464 Asbestos, Serpentine results in increased phosphorylation of SMAD2 protein CTD PMID:30609805 Smad2 Rat serpentine asbestos multiple interactions ISO RGD:1347299 6480464 [Asbestos, Serpentine results in decreased susceptibility to Asbestos] which results in increased expression of SMAD2 more ... CTD PMID:25358858 Smad2 Rat sevoflurane multiple interactions ISO RGD:1347299 6480464 Lipopolysaccharides inhibits the reaction [Sevoflurane results in decreased expression of SMAD2 mRNA] CTD PMID:35953652 Smad2 Rat sevoflurane increases expression ISO RGD:1347299 6480464 Sevoflurane results in increased expression of SMAD2 mRNA CTD PMID:35953652 Smad2 Rat silver(1+) nitrate decreases expression ISO RGD:1347299 6480464 Silver Nitrate analog results in decreased expression of SMAD2 mRNA CTD PMID:22831968 Smad2 Rat silver(1+) nitrate increases expression ISO RGD:1347299 6480464 Silver Nitrate results in increased expression of SMAD2 mRNA CTD PMID:22831968 Smad2 Rat simvastatin decreases phosphorylation EXP 6480464 Simvastatin results in decreased phosphorylation of SMAD2 protein CTD PMID:19659652 Smad2 Rat simvastatin increases phosphorylation ISO RGD:736957 6480464 Simvastatin results in increased phosphorylation of SMAD2 protein CTD PMID:33034787 Smad2 Rat simvastatin multiple interactions ISO RGD:736957 6480464 FST protein inhibits the reaction [Simvastatin results in increased phosphorylation of SMAD2 protein] CTD PMID:33034787 Smad2 Rat simvastatin increases expression ISO RGD:736957 6480464 Simvastatin results in increased expression of SMAD2 mRNA CTD PMID:18310456 Smad2 Rat sodium arsenite increases phosphorylation EXP 6480464 sodium arsenite results in increased phosphorylation of SMAD2 protein CTD PMID:21605584 Smad2 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of SMAD2 protein modified form CTD PMID:34673086 Smad2 Rat sodium arsenite decreases expression ISO RGD:1347299 6480464 sodium arsenite results in decreased expression of SMAD2 mRNA CTD PMID:29301061 Smad2 Rat sodium arsenite multiple interactions ISO RGD:1347299 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:29408318|PMID:39836092 Smad2 Rat sodium arsenite multiple interactions EXP 6480464 Grape Seed Extract inhibits the reaction [sodium arsenite results in increased phosphorylation of SMAD2 protein] CTD PMID:21605584 Smad2 Rat sodium arsenite decreases phosphorylation ISO RGD:736957 6480464 sodium arsenite results in decreased phosphorylation of SMAD2 protein CTD PMID:23732083 Smad2 Rat sodium arsenite multiple interactions ISO RGD:736957 6480464 sodium arsenite affects the expression of and affects the phosphorylation of SMAD2 protein; sodium arsenite more ... CTD PMID:23732083|PMID:28206643 Smad2 Rat sodium nitrite increases expression EXP 6480464 Sodium Nitrite results in increased expression of SMAD2 protein CTD PMID:28000380|PMID:28266762 Smad2 Rat sodium nitrite multiple interactions EXP 6480464 Carnosine inhibits the reaction [Sodium Nitrite results in increased expression of SMAD2 protein]; Quercetin inhibits more ... CTD PMID:28000380|PMID:28266762 Smad2 Rat Soman increases expression EXP 6480464 Soman results in increased expression of SMAD2 mRNA CTD PMID:19281266 Smad2 Rat sorafenib affects localization ISO RGD:736957 6480464 sorafenib affects the localization of SMAD2 protein CTD PMID:21360571 Smad2 Rat sorafenib multiple interactions ISO RGD:736957 6480464 sorafenib inhibits the reaction [TGFB1 protein results in increased phosphorylation of SMAD2 protein] CTD PMID:21360571 Smad2 Rat streptozocin increases phosphorylation EXP 6480464 Streptozocin results in increased phosphorylation of SMAD2 protein CTD PMID:21300041 Smad2 Rat streptozocin multiple interactions ISO RGD:736957 6480464 [Huang Qi co-treated with Coptidis rhizoma extract co-treated with Aconitic Acid co-treated with Centella asiatica more ... CTD PMID:38282657 Smad2 Rat streptozocin multiple interactions EXP 6480464 [Streptozocin co-treated with Resveratrol co-treated with Ramipril] results in decreased phosphorylation of SMAD2 protein; Resveratrol more ... CTD PMID:21300041|PMID:31062909 Smad2 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of SMAD2 mRNA CTD PMID:30047161 Smad2 Rat sunitinib increases expression ISO RGD:1347299 6480464 Sunitinib results in increased expression of SMAD2 mRNA CTD PMID:31533062 Smad2 Rat tamibarotene decreases expression ISO RGD:1347299 6480464 tamibarotene results in decreased expression of SMAD2 mRNA CTD PMID:15498508 Smad2 Rat tamibarotene increases phosphorylation ISO RGD:1347299 6480464 tamibarotene results in increased phosphorylation of SMAD2 protein CTD PMID:17611697 Smad2 Rat tamoxifen multiple interactions ISO RGD:1347299 6480464 Tamoxifen promotes the reaction [Tretinoin results in increased phosphorylation of SMAD2 protein] CTD PMID:17098229 Smad2 Rat tamoxifen increases phosphorylation ISO RGD:1347299 6480464 Tamoxifen results in increased phosphorylation of SMAD2 protein CTD PMID:17098229 Smad2 Rat testosterone enanthate multiple interactions EXP 6480464 2-Methoxyestradiol inhibits the reaction [testosterone enanthate results in increased phosphorylation of SMAD2 protein] CTD PMID:30154949 Smad2 Rat testosterone enanthate increases phosphorylation EXP 6480464 testosterone enanthate results in increased phosphorylation of SMAD2 protein CTD PMID:30154949 Smad2 Rat tetrachloromethane increases phosphorylation EXP 6480464 Carbon Tetrachloride results in increased phosphorylation of SMAD2 protein CTD PMID:24211420|PMID:25150141 Smad2 Rat tetrachloromethane increases phosphorylation ISO RGD:736957 6480464 Carbon Tetrachloride results in increased phosphorylation of SMAD2 protein CTD PMID:26337812 Smad2 Rat tetrachloromethane multiple interactions EXP 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased phosphorylation of SMAD2 protein; methyl ferulate inhibits more ... CTD PMID:30543783 Smad2 Rat tetrachloromethane multiple interactions ISO RGD:736957 6480464 chrysin inhibits the reaction [Carbon Tetrachloride results in increased expression of SMAD2 mRNA]; phyllanthin inhibits more ... CTD PMID:26297989|PMID:26337812 Smad2 Rat tetrachloromethane increases expression ISO RGD:736957 6480464 Carbon Tetrachloride results in increased expression of SMAD2 mRNA CTD PMID:26297989 Smad2 Rat tetrachloromethane decreases expression ISO RGD:736957 6480464 Carbon Tetrachloride results in decreased expression of SMAD2 protein modified form CTD PMID:25566828 Smad2 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of SMAD2 mRNA CTD PMID:16570350 Smad2 Rat tetrachloromethane affects response to substance ISO RGD:736957 6480464 SMAD2 protein affects the susceptibility to Carbon Tetrachloride CTD PMID:16382155 Smad2 Rat tetramethylpyrazine multiple interactions ISO RGD:736957 6480464 tetramethylpyrazine inhibits the reaction [Paraquat results in increased phosphorylation of SMAD2 protein] CTD PMID:30744607 Smad2 Rat theobromine treatment IEP 127229954 [Theobromine co-treated with Theanine] inhibits the reaction [1,2-dimethylhydrazine decreases expression and phosphorylation of Smad2 mRNA more ... RGD Smad2 Rat theophylline multiple interactions ISO RGD:1347299 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in increased expression of SMAD2 protein CTD PMID:18951874 Smad2 Rat thioacetamide multiple interactions EXP 6480464 Lipopolysaccharides promotes the reaction [Thioacetamide results in increased expression of SMAD2 mRNA] CTD PMID:17621560 Smad2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of SMAD2 mRNA CTD PMID:17621560|PMID:23411599 Smad2 Rat Thrombin increases phosphorylation ISO RGD:1347299 6480464 Thrombin results in increased phosphorylation of SMAD2 protein CTD PMID:36430902 Smad2 Rat Thrombin multiple interactions ISO RGD:1347299 6480464 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide inhibits the reaction [Thrombin results in increased phosphorylation of SMAD2 protein]; FR900359 inhibits the more ... CTD PMID:36430902 Smad2 Rat titanium dioxide decreases methylation ISO RGD:736957 6480464 titanium dioxide results in decreased methylation of SMAD2 promoter CTD PMID:35295148 Smad2 Rat titanium dioxide increases methylation ISO RGD:736957 6480464 titanium dioxide results in increased methylation of SMAD2 promoter CTD PMID:35295148 Smad2 Rat tolfenamic acid multiple interactions ISO RGD:1347299 6480464 tolfenamic acid inhibits the reaction [TGFB1 protein results in increased phosphorylation of SMAD2 protein] CTD PMID:31381904 Smad2 Rat trichloroethene increases expression ISO RGD:736957 6480464 Trichloroethylene results in increased expression of SMAD2 mRNA CTD PMID:19448997 Smad2 Rat trichostatin A decreases expression ISO RGD:1347299 6480464 trichostatin A results in decreased expression of SMAD2 mRNA CTD PMID:24935251|PMID:26272509 Smad2 Rat trichostatin A multiple interactions ISO RGD:1347299 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Smad2 Rat troglitazone multiple interactions ISO RGD:1347299 6480464 troglitazone inhibits the reaction [TGFB2 protein results in increased phosphorylation of and affects the localization more ... CTD PMID:18253093 Smad2 Rat valproic acid decreases expression ISO RGD:736957 6480464 Valproic Acid results in decreased expression of SMAD2 mRNA CTD PMID:21427059 Smad2 Rat valproic acid decreases expression ISO RGD:1347299 6480464 Valproic Acid results in decreased expression of SMAD2 mRNA CTD PMID:24383497|PMID:26272509|PMID:27188386 Smad2 Rat valproic acid multiple interactions ISO RGD:1347299 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Smad2 Rat valproic acid increases methylation ISO RGD:1347299 6480464 Valproic Acid results in increased methylation of SMAD2 gene CTD PMID:29154799 Smad2 Rat valproic acid affects expression ISO RGD:1347299 6480464 Valproic Acid affects the expression of SMAD2 mRNA CTD PMID:23179753|PMID:25979313 Smad2 Rat vancomycin decreases expression ISO RGD:736957 6480464 Vancomycin results in decreased expression of SMAD2 mRNA CTD PMID:18930951 Smad2 Rat verapamil multiple interactions ISO RGD:1347299 6480464 Verapamil inhibits the reaction [TGFB1 protein results in increased phosphorylation of SMAD2 protein] CTD PMID:34217686 Smad2 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of SMAD2 mRNA CTD PMID:15686871 Smad2 Rat vincristine decreases expression ISO RGD:1347299 6480464 Vincristine results in decreased expression of SMAD2 mRNA CTD PMID:23649840 Smad2 Rat vorinostat decreases expression ISO RGD:1347299 6480464 vorinostat results in decreased expression of SMAD2 mRNA CTD PMID:26272509 Smad2 Rat vorinostat multiple interactions ISO RGD:1347299 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Smad2 Rat zinc atom multiple interactions ISO RGD:736957 6480464 Zinc inhibits the reaction [arsenite inhibits the reaction [TGFB2 protein affects the localization of SMAD2 more ... CTD PMID:22228435|PMID:26354774 Smad2 Rat zinc(0) multiple interactions ISO RGD:736957 6480464 Zinc inhibits the reaction [arsenite inhibits the reaction [TGFB2 protein affects the localization of SMAD2 more ... CTD PMID:22228435|PMID:26354774
Biological Process
Only show annotations with direct experimental evidence (0 objects hidden)
Smad2 Rat activin receptor signaling pathway involved_in ISO RGD:1347299 1624291 PMID:15150278 RGD PMID:15150278 Smad2 Rat activin receptor signaling pathway involved_in IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat activin receptor signaling pathway involved_in IBA FB:FBgn0025800|PANTHER:PTN001008908|UniProtKB:P84022|UniProtKB:Q15796|ZFIN:ZDB-GENE-990603-7 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Smad2 Rat adrenal gland development IDA 728125 RGD Smad2 Rat anatomical structure morphogenesis involved_in IBA FB:FBgn0011648|FB:FBgn0020493|FB:FBgn0025800|FB:FBgn0288966|MGI:108051|MGI:109452|MGI:1100518|MGI:1201674|MGI:1336883|MGI:894293|PANTHER:PTN000344419|RGD:620158|RGD:71004|UniProtKB:A0A8J0R1N9|UniProtKB:A0A8J0T288|UniProtKB:A0A8M6Z2Y5|UniProtKB:O43541|UniProtKB:Q6IRR4|WB:WBGene00004856|WB:WBGene00004857|WB:WBGene00004858|Xenbase:XB-GENE-1018193|Xenbase:XB-GENE-482930|Xenbase:XB-GENE-484686|Xenbase:XB-GENE-485691|Xenbase:XB-GENE-486004|ZFIN:ZDB-GENE-990603-7|ZFIN:ZDB-GENE-990603-9 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Smad2 Rat anterior/posterior pattern specification involved_in ISS UniProtKB:Q62432 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Smad2 Rat anterior/posterior pattern specification acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:1857691|MGI:2668416 PMID:11418863, PMID:12842913, PMID:9529255 RGD PMID:11418863|PMID:12842913|PMID:9529255 Smad2 Rat aortic valve morphogenesis involved_in ISO RGD:736957 1624291 UniProtKB:Q9R001 PMID:23531444 RGD PMID:23531444 Smad2 Rat cell differentiation involved_in IBA FB:FBgn0011648|FB:FBgn0020493|FB:FBgn0025800|FB:FBgn0288966|MGI:108051|MGI:109452|MGI:1201674|MGI:1328787|MGI:1859993|MGI:894293|PANTHER:PTN000344419|RGD:3032|RGD:3033|UniProtKB:O15198|UniProtKB:O43541|UniProtKB:Q13485|UniProtKB:Q15797|UniProtKB:Q99717|ZFIN:ZDB-GENE-000509-3|ZFIN:ZDB-GENE-031014-1|ZFIN:ZDB-GENE-991119-8 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Smad2 Rat cell fate commitment involved_in ISS UniProtKB:Q62432 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Smad2 Rat cell fate commitment acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:2668416 PMID:12842913 RGD PMID:12842913 Smad2 Rat cell population proliferation acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:1201674 PMID:19679673 RGD PMID:19679673 Smad2 Rat cellular response to glucose stimulus IEP 401824679 RGD Smad2 Rat cellular response to transforming growth factor beta stimulus IEP 401794430 RGD Smad2 Rat determination of left/right asymmetry in lateral mesoderm involved_in ISO RGD:1347299 1624291 PMID:17239842 RGD PMID:17239842 Smad2 Rat determination of left/right asymmetry in lateral mesoderm involved_in IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat developmental growth acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:1201674 PMID:15183723 RGD PMID:15183723 Smad2 Rat embryonic cranial skeleton morphogenesis acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:1201674 PMID:15183723 RGD PMID:15183723 Smad2 Rat embryonic foregut morphogenesis acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:1201674 PMID:15183723 RGD PMID:15183723 Smad2 Rat embryonic pattern specification acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:1201674 PMID:15183723 RGD PMID:15183723 Smad2 Rat endocardial cushion morphogenesis involved_in ISO RGD:736957 1624291 UniProtKB:Q9R001 PMID:23531444 RGD PMID:23531444 Smad2 Rat endoderm development acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:1201674 PMID:15183723 RGD PMID:15183723 Smad2 Rat endoderm formation acts_upstream_of_or_within ISO RGD:736957 1624291 PMID:21822279 RGD PMID:21822279 Smad2 Rat gastrulation acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:1201674 PMID:15183723 RGD PMID:15183723 Smad2 Rat heart development acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:87912 PMID:17849440 RGD PMID:17849440 Smad2 Rat in utero embryonic development acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:1201674|MGI:1857692 PMID:15183723, PMID:17849440 RGD PMID:15183723|PMID:17849440 Smad2 Rat insulin secretion acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:87912 PMID:17849440 RGD PMID:17849440 Smad2 Rat intracellular signal transduction involved_in ISS UniProtKB:Q62432 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Smad2 Rat intracellular signal transduction acts_upstream_of_or_within ISO RGD:736957 1624291 PMID:14749725 RGD PMID:14749725 Smad2 Rat lung development acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:87912 PMID:17849440 RGD PMID:17849440 Smad2 Rat mesoderm formation involved_in ISS UniProtKB:Q62432 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Smad2 Rat mesoderm formation acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:1857691 PMID:15084457 RGD PMID:15084457 Smad2 Rat negative regulation of cell population proliferation IMP 2300418 RGD Smad2 Rat negative regulation of DNA-templated transcription involved_in ISO RGD:1347299 1624291 PMID:14555988 RGD PMID:14555988 Smad2 Rat negative regulation of DNA-templated transcription involved_in IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat negative regulation of gene expression acts_upstream_of_or_within ISO RGD:736957 1624291 PMID:23152446 RGD PMID:23152446 Smad2 Rat negative regulation of ossification involved_in ISO RGD:1347299 1624291 PMID:22155034 RGD PMID:22155034 Smad2 Rat negative regulation of ossification involved_in IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat nodal signaling pathway involved_in ISO RGD:1347299 1624291 PMID:15150278, PMID:17239842 RGD PMID:15150278|PMID:17239842 Smad2 Rat nodal signaling pathway involved_in IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat odontoblast differentiation involved_in ISO RGD:736957 1624291 PMID:33548622 RGD PMID:33548622 Smad2 Rat odontoblast differentiation involved_in ISS UniProtKB:Q62432 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Smad2 Rat organ growth acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:87912 PMID:17849440 RGD PMID:17849440 Smad2 Rat pancreas development acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:87912 PMID:17849440 RGD PMID:17849440 Smad2 Rat paraxial mesoderm morphogenesis involved_in ISS UniProtKB:Q62432 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Smad2 Rat paraxial mesoderm morphogenesis acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:1857691 PMID:15084457 RGD PMID:15084457 Smad2 Rat pattern specification process acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:87912 PMID:17849440 RGD PMID:17849440 Smad2 Rat pericardium development acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:1201674 PMID:15183723 RGD PMID:15183723 Smad2 Rat positive regulation of BMP signaling pathway involved_in ISO RGD:1347299 1624291 PMID:19366699 RGD PMID:19366699 Smad2 Rat positive regulation of BMP signaling pathway involved_in IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat positive regulation of DNA-templated transcription involved_in ISS UniProtKB:Q62432 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Smad2 Rat positive regulation of DNA-templated transcription involved_in ISO RGD:736957 1624291 PMID:14691138 RGD PMID:14691138 Smad2 Rat positive regulation of DNA-templated transcription involved_in IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat positive regulation of DNA-templated transcription acts_upstream_of_or_within ISO RGD:736957 1624291 PMID:15282343 RGD PMID:15282343 Smad2 Rat positive regulation of DNA-templated transcription involved_in ISO RGD:1347299 1624291 PMID:14555988, PMID:9311995, PMID:9389648, PMID:9732876 RGD PMID:14555988|PMID:9311995|PMID:9389648|PMID:9732876 Smad2 Rat positive regulation of epithelial to mesenchymal transition involved_in ISO RGD:736957 1624291 PMID:14691138 RGD PMID:14691138 Smad2 Rat positive regulation of gene expression acts_upstream_of_or_within ISO RGD:736957 1624291 PMID:23152446 RGD PMID:23152446 Smad2 Rat positive regulation of transcription by RNA polymerase II involved_in IMP 8554355 PMID:22073128 BHF-UCL Smad2 Rat positive regulation of transcription by RNA polymerase II involved_in IBA FB:FBgn0025800|MGI:108051|MGI:1201674|PANTHER:PTN001008908|RGD:3031|RGD:3032|UniProtKB:P84022|UniProtKB:Q15796|WB:WBGene00000904 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Smad2 Rat positive regulation of transcription by RNA polymerase II involved_in IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat positive regulation of transcription by RNA polymerase II acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:1201674|MGI:1314872|MGI:1347465|MGI:894293|MGI:98725|MGI:98727 PMID:17159989, PMID:17568773, PMID:23390484, PMID:9702197 RGD PMID:17159989|PMID:17568773|PMID:23390484|PMID:9702197 Smad2 Rat positive regulation of transcription by RNA polymerase II involved_in ISO RGD:1347299 1624291 PMID:9389648 RGD PMID:9389648 Smad2 Rat positive regulation of transcription by RNA polymerase II involved_in ISS UniProtKB:Q62432 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Smad2 Rat post-embryonic development acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:87912 PMID:17849440 RGD PMID:17849440 Smad2 Rat protein phosphorylation acts_upstream_of_or_within ISO RGD:736957 1624291 PMID:18990706 RGD PMID:18990706 Smad2 Rat pulmonary valve morphogenesis involved_in ISO RGD:736957 1624291 UniProtKB:Q9R001 PMID:23531444 RGD PMID:23531444 Smad2 Rat regulation of DNA-templated transcription involved_in IEA InterPro:IPR001132|InterPro:IPR003619|InterPro:IPR013019|InterPro:IPR013790 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Smad2 Rat regulation of transforming growth factor beta receptor signaling pathway involved_in ISO RGD:1347299 1624291 PMID:14555988 RGD PMID:14555988 Smad2 Rat regulation of transforming growth factor beta receptor signaling pathway involved_in IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat response to cholesterol involved_in ISO RGD:1347299 1624291 PMID:17878231 RGD PMID:17878231 Smad2 Rat response to cholesterol involved_in IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat response to glucose acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:87912 PMID:17849440 RGD PMID:17849440 Smad2 Rat response to transforming growth factor beta acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:1201674 PMID:19679673 RGD PMID:19679673 Smad2 Rat secondary palate development involved_in ISO RGD:736957 1624291 PMID:14691138 RGD PMID:14691138 Smad2 Rat signal transduction involved in regulation of gene expression involved_in IMP 8554355 PMID:22073128 BHF-UCL Smad2 Rat SMAD protein signal transduction involved_in IMP 8554355 PMID:22073128 BHF-UCL Smad2 Rat SMAD protein signal transduction acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:1201674 PMID:23390484 RGD PMID:23390484 Smad2 Rat SMAD protein signal transduction involved_in IBA FB:FBgn0011648|FB:FBgn0025800|FB:FBgn0288966|MGI:108051|MGI:109452|MGI:1100518|MGI:1201674|MGI:1328787|MGI:1859993|MGI:894293|PANTHER:PTN000344419|RGD:3031|RGD:3032|UniProtKB:O15105|UniProtKB:P84022|UniProtKB:Q13485|UniProtKB:Q15796|UniProtKB:Q15797 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Smad2 Rat SMAD protein signal transduction acts_upstream_of_or_within ISO RGD:1347299 1624291 PMID:16806156 RGD PMID:16806156 Smad2 Rat SMAD protein signal transduction involved_in IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat SMAD protein signal transduction involved_in ISO RGD:1347299 1624291 PMID:17239842, PMID:9111321, PMID:9311995, PMID:9732876 RGD PMID:17239842|PMID:9111321|PMID:9311995|PMID:9732876 Smad2 Rat transforming growth factor beta receptor signaling pathway involved_in ISS UniProtKB:Q62432 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Smad2 Rat transforming growth factor beta receptor signaling pathway involved_in IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat transforming growth factor beta receptor signaling pathway acts_upstream_of_or_within ISO RGD:736957 1624291 MGI:894293|MGI:98725|MGI:98834 PMID:11557747, PMID:14749725, PMID:18212064 RGD PMID:11557747|PMID:14749725|PMID:18212064 Smad2 Rat transforming growth factor beta receptor signaling pathway involved_in IBA MGI:108051|MGI:1201674|PANTHER:PTN002672225|RGD:3031|RGD:3032|UniProtKB:P84022|UniProtKB:Q15796 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Smad2 Rat transforming growth factor beta receptor signaling pathway involved_in ISO RGD:1347299 1624291 PMID:18548003, PMID:8752209, PMID:8980228, PMID:9311995, PMID:9389648, PMID:9732876 RGD PMID:18548003|PMID:8752209|PMID:8980228|PMID:9311995|PMID:9389648|PMID:9732876 Smad2 Rat transforming growth factor beta receptor signaling pathway involved_in IMP 8554355 PMID:22073128 BHF-UCL Smad2 Rat trophoblast cell migration involved_in ISO RGD:1347299 1624291 PMID:34432647 RGD PMID:34432647 Smad2 Rat trophoblast cell migration involved_in IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat ureteric bud development involved_in ISO RGD:736957 1624291 PMID:14656760 RGD PMID:14656760 Smad2 Rat zygotic specification of dorsal/ventral axis involved_in ISO RGD:1347299 1624291 PMID:9436979 RGD PMID:9436979 Smad2 Rat zygotic specification of dorsal/ventral axis involved_in IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107
Cellular Component
Only show annotations with direct experimental evidence (0 objects hidden)
Smad2 Rat activin responsive factor complex part_of ISO RGD:1347299 1624291 PMID:9389648 RGD PMID:9389648 Smad2 Rat activin responsive factor complex part_of IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat chromatin located_in IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat chromatin located_in ISO RGD:1347299 1624291 PMID:21828274 RGD PMID:21828274 Smad2 Rat cytoplasm located_in ISO RGD:736957 1624291 PMID:14691138, PMID:21145499, PMID:24964035, PMID:33548622 RGD PMID:14691138|PMID:21145499|PMID:24964035|PMID:33548622 Smad2 Rat cytoplasm located_in IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat cytoplasm located_in ISO RGD:1347299 1624291 PMID:12411310, PMID:21145499, PMID:9311995, PMID:9389648 RGD PMID:12411310|PMID:21145499|PMID:9311995|PMID:9389648 Smad2 Rat cytoplasm located_in IEA UniProtKB-SubCell:SL-0086 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Smad2 Rat cytoplasm located_in ISS UniProtKB:Q62432 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Smad2 Rat cytoplasm located_in IEA UniProtKB-KW:KW-0963 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Smad2 Rat heteromeric SMAD protein complex part_of ISO RGD:1347299 1624291 PMID:15350224, PMID:21828274 RGD PMID:15350224|PMID:21828274 Smad2 Rat heteromeric SMAD protein complex part_of IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat heteromeric SMAD protein complex part_of IBA FB:FBgn0011648|FB:FBgn0025800|FB:FBgn0288966|PANTHER:PTN000344419|UniProtKB:P84022|UniProtKB:Q13485|UniProtKB:Q15796|UniProtKB:Q15797 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Smad2 Rat homomeric SMAD protein complex part_of ISO RGD:1347299 1624291 PMID:11779503 RGD PMID:11779503 Smad2 Rat homomeric SMAD protein complex part_of IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat membrane located_in IEA UniProtKB-KW:KW-0472 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Smad2 Rat nucleoplasm located_in IEA UniProtKB:Q53XR6|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat nucleoplasm located_in IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat nucleoplasm located_in ISO RGD:1347299|UniProtKB:Q15796-1|UniProtKB:Q15796-2 1624291 RGD GO_REF:0000052 Smad2 Rat nucleus located_in IEA UniProtKB-SubCell:SL-0191 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Smad2 Rat nucleus located_in ISO RGD:736957 1624291 PMID:11160896, PMID:14691138, PMID:21145499, PMID:21300867, PMID:24964035, PMID:33548622 RGD PMID:11160896|PMID:14691138|PMID:21145499|PMID:21300867|PMID:24964035|PMID:33548622 Smad2 Rat nucleus located_in IEA UniProtKB-KW:KW-0539 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Smad2 Rat nucleus located_in IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat nucleus located_in ISO RGD:1347299 1624291 PMID:12411310, PMID:16751101, PMID:21145499, PMID:21599657, PMID:25893292, PMID:8980228, PMID:9311995, PMID:9389648 RGD PMID:12411310|PMID:16751101|PMID:21145499|PMID:21599657|PMID:25893292|PMID:8980228|PMID:9311995|PMID:9389648 Smad2 Rat nucleus located_in ISS UniProtKB:Q62432 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Smad2 Rat protein-containing complex IDA 1599906 RGD Smad2 Rat protein-containing complex part_of IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat protein-containing complex part_of ISO RGD:1347299 1624291 PMID:15231848 RGD PMID:15231848 Smad2 Rat SMAD protein complex part_of ISO RGD:1347299 1624291 PMID:18832382 RGD PMID:18832382 Smad2 Rat SMAD protein complex part_of IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat transcription regulator complex part_of IEA InterPro:IPR013019 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Smad2 Rat transcription regulator complex part_of ISO RGD:736957 1624291 PMID:17568773, PMID:9702197 RGD PMID:17568773|PMID:9702197 Smad2 Rat transcription regulator complex part_of IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat transcription regulator complex part_of ISO RGD:1347299 1624291 PMID:17438144 RGD PMID:17438144 Smad2 Rat transcription regulator complex part_of ISS UniProtKB:Q62432 1600115 GO_REF:0000024 UniProt GO_REF:0000024
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Smad2 Rat chromatin binding enables ISO RGD:736957 1624291 PMID:15657445, PMID:16619037 RGD PMID:15657445|PMID:16619037 Smad2 Rat co-SMAD binding enables ISO RGD:1347299 1624291 UniProtKB:Q13485 PMID:9111321, PMID:9311995 RGD PMID:9111321|PMID:9311995 Smad2 Rat co-SMAD binding enables IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat disordered domain specific binding enables ISO RGD:1347299 1624291 UniProtKB:O95405 PMID:15231848 RGD PMID:15231848 Smad2 Rat disordered domain specific binding enables IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat DNA binding contributes_to ISO RGD:1347299 1624291 PMID:9389648 RGD PMID:9389648 Smad2 Rat DNA binding enables IEA UniProtKB-KW:KW-0238 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Smad2 Rat DNA binding contributes_to IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat DNA binding enables ISO RGD:736957 1624291 PMID:27336669 RGD PMID:27336669 Smad2 Rat DNA-binding transcription activator activity, RNA polymerase II-specific enables ISO RGD:1347299 1624291 PMID:31582430, PMID:9389648 RGD PMID:31582430|PMID:9389648 Smad2 Rat DNA-binding transcription activator activity, RNA polymerase II-specific enables ISO RGD:736957 1624291 ENSEMBL_GeneID:ENSG00000127445 PMID:24964035 RGD PMID:24964035 Smad2 Rat DNA-binding transcription activator activity, RNA polymerase II-specific enables IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat DNA-binding transcription factor activity contributes_to ISO RGD:1347299 1624291 PMID:17438144 RGD PMID:17438144 Smad2 Rat DNA-binding transcription factor activity enables IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat DNA-binding transcription factor activity enables ISO RGD:1347299 1624291 PMID:9389648 RGD PMID:9389648 Smad2 Rat DNA-binding transcription factor activity, RNA polymerase II-specific enables IBA FB:FBgn0011648|FB:FBgn0288966|MGI:108051|MGI:109452|MGI:1201674|MGI:1328787|MGI:894293|PANTHER:PTN000344419|UniProtKB:P84022|UniProtKB:Q13485|UniProtKB:Q15796|UniProtKB:Q15797|ZFIN:ZDB-GENE-990603-7 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Smad2 Rat DNA-binding transcription factor binding enables ISO RGD:736957 1624291 UniProtKB:O88621 PMID:9702197 RGD PMID:9702197 Smad2 Rat DNA-binding transcription factor binding enables IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat DNA-binding transcription factor binding enables ISO RGD:1347299 1624291 UniProtKB:O75593|UniProtKB:Q02078 PMID:11160896, PMID:9702198 RGD PMID:11160896|PMID:9702198 Smad2 Rat double-stranded DNA binding enables ISS UniProtKB:Q62432 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Smad2 Rat double-stranded DNA binding enables ISO RGD:736957 1624291 PMID:15282343 RGD PMID:15282343 Smad2 Rat I-SMAD binding enables ISO RGD:1347299 1624291 UniProtKB:O43541 PMID:9256479 RGD PMID:9256479 Smad2 Rat I-SMAD binding enables IBA PANTHER:PTN000344419|UniProtKB:O15105|UniProtKB:O43541|UniProtKB:Q13485|UniProtKB:Q15796|UniProtKB:Q15797 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Smad2 Rat I-SMAD binding enables IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat identical protein binding enables ISO RGD:1347299 1624291 UniProtKB:Q15796 PMID:11779503 RGD PMID:11779503 Smad2 Rat identical protein binding enables IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat identical protein binding enables ISO RGD:736957 1624291 PR:Q62432 PMID:21724602 RGD PMID:21724602 Smad2 Rat metal ion binding enables IEA UniProtKB-KW:KW-0479 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Smad2 Rat phosphatase binding enables ISO RGD:1347299 1624291 UniProtKB:P35813 PMID:16751101 RGD PMID:16751101 Smad2 Rat phosphatase binding enables IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat protein binding IPI RGD:2401 1599906 RGD Smad2 Rat protein binding enables ISO RGD:736957 1624291 MGI:2441856|PR:O35295|PR:O35740|PR:O70477|PR:O88621|PR:P41778|PR:P42669|PR:P97471|PR:Q8CHP0|PR:Q99LC9|PR:Q9CU65|PR:Q9EST3|UniProtKB:P46938|UniProtKB:P97471|UniProtKB:Q9EPL8 PMID:14651998, PMID:14764653, PMID:15282343, PMID:16115198, PMID:16619037, PMID:21145499, PMID:21724602, PMID:33548622, PMID:9702197 RGD PMID:14651998|PMID:14764653|PMID:15282343|PMID:16115198|PMID:16619037|PMID:21145499|PMID:21724602|PMID:33548622|PMID:9702197 Smad2 Rat protein binding enables IPI UniProtKB:P47196 8553856 PMID:16362038 IntAct Smad2 Rat protein binding enables IPI UniProtKB:O35740 8554622 PMID:16619037 UniProt Smad2 Rat protein binding enables ISO RGD:1347299 1624291 UniProtKB:O00308|UniProtKB:O15111|UniProtKB:O15165|UniProtKB:O75593|UniProtKB:O95405|UniProtKB:P04637|UniProtKB:P05060|UniProtKB:P05412|UniProtKB:P07197|UniProtKB:P12755|UniProtKB:P12757|UniProtKB:P12757-1|UniProtKB:P35813|UniProtKB:P36896|UniProtKB:P52926|UniProtKB:P61586|UniProtKB:P70056|UniProtKB:P84022|UniProtKB:P84550|UniProtKB:P98082|UniProtKB:Q12955|UniProtKB:Q13485|UniProtKB:Q13526|UniProtKB:Q13573|UniProtKB:Q2VWA4|UniProtKB:Q8TAK6|UniProtKB:Q93062|UniProtKB:Q969W9|UniProtKB:Q96KR1|UniProtKB:Q9BZ29|UniProtKB:Q9GZV5|UniProtKB:Q9H3D4|UniProtKB:Q9H6Z4|UniProtKB:Q9HAU4|UniProtKB:Q9HAZ2|UniProtKB:Q9NYA4|UniProtKB:Q9UK33|UniProtKB:Q9UPN9|UniProtKB:Q9Y2U8|UniProtKB:Q9Y4E8 PMID:10615055, PMID:11278756, PMID:11387212, PMID:11779503, PMID:12764135, PMID:15107821, PMID:15231748, PMID:15350224, PMID:15647271, PMID:16200078, PMID:16751101, PMID:17099224, PMID:17292623, more ... RGD PMID:10615055|PMID:11278756|PMID:11387212|PMID:11779503|PMID:12764135|PMID:15107821|PMID:15231748|PMID:15350224|PMID:15647271|PMID:16200078|PMID:16751101|PMID:17099224|PMID:17292623|PMID:18268325|PMID:18511908|PMID:18568018|PMID:18729074|PMID:18832382|PMID:18923419|PMID:19032343|PMID:19049980|PMID:19122240|PMID:19135894|PMID:19289081|PMID:19345189|PMID:20061380|PMID:20129061|PMID:20195357|PMID:20211142|PMID:20603019|PMID:20937913|PMID:21258410|PMID:21297662|PMID:21532621|PMID:21599657|PMID:21741598|PMID:21947082|PMID:21960005|PMID:21988832|PMID:22045334|PMID:22442258|PMID:24627487|PMID:25241761|PMID:25609649|PMID:25670079|PMID:26977879|PMID:32296183|PMID:33961781|PMID:9389648|PMID:9702198|PMID:9865696|PMID:9892009 Smad2 Rat R-SMAD binding enables ISO RGD:1347299 1624291 UniProtKB:P84022 PMID:9311995 RGD PMID:9311995 Smad2 Rat R-SMAD binding enables IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables ISO RGD:1347299 1624291 PMID:31582430, PMID:9389648 RGD PMID:31582430|PMID:9389648 Smad2 Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables IBA FB:FBgn0011648|MGI:109452|MGI:1328787|MGI:894293|PANTHER:PTN000344419|UniProtKB:P84022|UniProtKB:Q13485|UniProtKB:Q15796|UniProtKB:Q15797|UniProtKB:Q99717|ZFIN:ZDB-GENE-990603-7 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Smad2 Rat RNA polymerase II-specific DNA-binding transcription factor binding enables ISS UniProtKB:Q62432 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Smad2 Rat RNA polymerase II-specific DNA-binding transcription factor binding enables ISO RGD:736957 1624291 UniProtKB:B7ZQJ9 PMID:11937490 RGD PMID:11937490 Smad2 Rat SMAD binding enables ISO RGD:1347299 1624291 UniProtKB:Q06413 PMID:11160896 RGD PMID:11160896 Smad2 Rat SMAD binding enables IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat SMAD binding enables ISO RGD:736957 1624291 UniProtKB:Q60929 PMID:11160896 RGD PMID:11160896 Smad2 Rat tau protein binding enables ISO RGD:736957 1624291 PMID:24964035 RGD PMID:24964035 Smad2 Rat transcription factor binding IPI RGD:620036 2301880 RGD Smad2 Rat transforming growth factor beta receptor binding enables ISO RGD:1347299 1624291 UniProtKB:P36897 PMID:9311995 RGD PMID:9311995 Smad2 Rat transforming growth factor beta receptor binding enables IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat type I transforming growth factor beta receptor binding enables ISO RGD:1347299 1624291 UniProtKB:P36897 PMID:8980228 RGD PMID:8980228 Smad2 Rat type I transforming growth factor beta receptor binding enables IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Smad2 Rat ubiquitin protein ligase binding enables ISO RGD:1347299 1624291 UniProtKB:Q9HAU4 PMID:19122240 RGD PMID:19122240 Smad2 Rat ubiquitin protein ligase binding enables IEA UniProtKB:Q15796|ensembl:ENSP00000262160 1600115 GO_REF:0000107 Ensembl GO_REF:0000107
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(20S)-ginsenoside Rg3 (ISO) (R)-lipoic acid (ISO) (S)-nicotine (EXP) 1,2-dimethylhydrazine (EXP,ISO) 1-naphthyl isothiocyanate (ISO) 15-deoxy-Delta(12,14)-prostaglandin J2 (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile (ISO) 2-acetamidofluorene (EXP) 2-amino-2-deoxy-D-galactopyranose (EXP) 2-amino-2-deoxy-D-glucopyranose (ISO) 2-hydroxypropanoic acid (ISO) 2-methoxy-17beta-estradiol (EXP) 2-methoxyethanol (EXP) 3,4-dihydroxybenzaldehyde (ISO) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO) 3-phenylprop-2-enal (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 4-nitrophenol (ISO) 5-aza-2'-deoxycytidine (EXP,ISO) 6-propyl-2-thiouracil (EXP) 7,9-dihydro-1H-purine-2,6,8(3H)-trione (ISO) aconitic acid (ISO) acteoside (ISO) aldehydo-D-glucosamine (ISO) aldehydo-D-glucose (EXP,ISO) all-trans-retinoic acid (ISO) amitrole (EXP) amlodipine (ISO) ammonium chloride (EXP) Ammothamnine (ISO) andrographolide (ISO) anthocyanin (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (EXP,ISO) arsenic atom (EXP,ISO) arsenite(3-) (ISO) arsenous acid (ISO) asbestos (ISO) atrazine (ISO) bellidifolin (EXP) benazepril (EXP) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-aminopropionitrile (EXP) beta-D-glucosamine (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) bleomycin A2 (ISO) butanal (ISO) cadmium dichloride (ISO) caffeine (EXP) camostat (ISO) carbofuran (EXP) carnosine (EXP) ceruletide (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) chromium atom (EXP) chrysin (ISO) cisplatin (EXP,ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) corticosterone (EXP) coumestrol (ISO) crocidolite asbestos (ISO) crocin-1 (EXP) curcumin (EXP) cyclosporin A (ISO) cytochalasin D (ISO) D-glucose (EXP,ISO) dexamethasone (ISO) diarsenic trioxide (ISO) dibenziodolium (EXP) diethylstilbestrol (ISO) dimethyl sulfoxide (ISO) diminazene diaceturate (ISO) dioxygen (ISO) disodium selenite (ISO) dorsomorphin (ISO) doxorubicin (EXP,ISO) enalapril (EXP) endosulfan (ISO) Enterolactone (ISO) entinostat (ISO) ethanol (EXP) etoposide (ISO) Evodiamine (EXP,ISO) farrerol (EXP) flutamide (EXP) folic acid (ISO) FR900359 (ISO) galangin (ISO) genistein (EXP) gentamycin (EXP) glucose (EXP,ISO) glycerol 2-phosphate (ISO) heptachlor (ISO) hispidin (ISO) Honokiol (EXP,ISO) hyaluronic acid (ISO) hydrogen peroxide (ISO) irbesartan (EXP) Isoangustone A (ISO) isoprenaline (EXP) isorhamnetin (ISO) ivermectin (ISO) L-ascorbic acid (ISO) leptomycin B (ISO) lipoic acid (ISO) lipopolysaccharide (EXP,ISO) LY-2157299 (ISO) LY294002 (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) melphalan (ISO) mercury atom (ISO) mercury(0) (ISO) methimazole (EXP) methoxychlor (EXP) methyl beta-cyclodextrin (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) microcystin-LR (ISO) mitoxantrone (ISO) mono(2-ethylhexyl) phthalate (EXP) N(gamma)-nitro-L-arginine methyl ester (ISO) N-acetyl-L-cysteine (ISO) N-ethyl-N-nitrosourea (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (EXP) nickel atom (ISO) nickel dichloride (ISO) niclosamide (ISO) nicotine (EXP) nitrates (ISO) nitrofen (ISO) ochratoxin A (ISO) oridonin (ISO) osthole (ISO) ozone (ISO) panobinostat (ISO) paracetamol (EXP) paraquat (EXP,ISO) paricalcitol (EXP) patulin (EXP) phenobarbital (ISO) phenylephrine (EXP) phenylmercury acetate (ISO) phloroglucinol (ISO) phorbol 13-acetate 12-myristate (ISO) Phyllanthin (ISO) platycodin D (ISO) procymidone (EXP) progesterone (ISO) propiconazole (ISO) propofol (ISO) quercetin (EXP,ISO) rac-lactic acid (ISO) raloxifene (ISO) ramipril (EXP) resveratrol (EXP,ISO) rutin (EXP) salubrinal (ISO) SB 203580 (EXP) SB 431542 (EXP,ISO) serpentine asbestos (ISO) sevoflurane (ISO) silver(1+) nitrate (ISO) simvastatin (EXP,ISO) sodium arsenite (EXP,ISO) sodium nitrite (EXP) Soman (EXP) sorafenib (ISO) streptozocin (EXP,ISO) sulfadimethoxine (EXP) sunitinib (ISO) tamibarotene (ISO) tamoxifen (ISO) testosterone enanthate (EXP) tetrachloromethane (EXP,ISO) tetramethylpyrazine (ISO) theobromine (IEP) theophylline (ISO) thioacetamide (EXP) Thrombin (ISO) titanium dioxide (ISO) tolfenamic acid (ISO) trichloroethene (ISO) trichostatin A (ISO) troglitazone (ISO) valproic acid (ISO) vancomycin (ISO) verapamil (ISO) vinclozolin (EXP) vincristine (ISO) vorinostat (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
activin receptor signaling pathway (IBA,IEA,ISO) adrenal gland development (IDA) anatomical structure morphogenesis (IBA) anterior/posterior pattern specification (ISO,ISS) aortic valve morphogenesis (ISO) cell differentiation (IBA) cell fate commitment (ISO,ISS) cell population proliferation (ISO) cellular response to glucose stimulus (IEP) cellular response to transforming growth factor beta stimulus (IEP) determination of left/right asymmetry in lateral mesoderm (IEA,ISO) developmental growth (ISO) embryonic cranial skeleton morphogenesis (ISO) embryonic foregut morphogenesis (ISO) embryonic pattern specification (ISO) endocardial cushion morphogenesis (ISO) endoderm development (ISO) endoderm formation (ISO) gastrulation (ISO) heart development (ISO) in utero embryonic development (ISO) insulin secretion (ISO) intracellular signal transduction (ISO,ISS) lung development (ISO) mesoderm formation (ISO,ISS) negative regulation of cell population proliferation (IMP) negative regulation of DNA-templated transcription (IEA,ISO) negative regulation of gene expression (ISO) negative regulation of ossification (IEA,ISO) nodal signaling pathway (IEA,ISO) odontoblast differentiation (ISO,ISS) organ growth (ISO) pancreas development (ISO) paraxial mesoderm morphogenesis (ISO,ISS) pattern specification process (ISO) pericardium development (ISO) positive regulation of BMP signaling pathway (IEA,ISO) positive regulation of DNA-templated transcription (IEA,ISO,ISS) positive regulation of epithelial to mesenchymal transition (ISO) positive regulation of gene expression (ISO) positive regulation of transcription by RNA polymerase II (IBA,IEA,IMP,ISO,ISS) post-embryonic development (ISO) protein phosphorylation (ISO) pulmonary valve morphogenesis (ISO) regulation of DNA-templated transcription (IEA) regulation of transforming growth factor beta receptor signaling pathway (IEA,ISO) response to cholesterol (IEA,ISO) response to glucose (ISO) response to transforming growth factor beta (ISO) secondary palate development (ISO) signal transduction involved in regulation of gene expression (IMP) SMAD protein signal transduction (IBA,IEA,IMP,ISO) transforming growth factor beta receptor signaling pathway (IBA,IEA,IMP,ISO,ISS) trophoblast cell migration (IEA,ISO) ureteric bud development (ISO) zygotic specification of dorsal/ventral axis (IEA,ISO)
Cellular Component
activin responsive factor complex (IEA,ISO) chromatin (IEA,ISO) cytoplasm (IEA,ISO,ISS) heteromeric SMAD protein complex (IBA,IEA,ISO) homomeric SMAD protein complex (IEA,ISO) membrane (IEA) nucleoplasm (IEA,ISO) nucleus (IEA,ISO,ISS) protein-containing complex (IDA,IEA,ISO) SMAD protein complex (IEA,ISO) transcription regulator complex (IEA,ISO,ISS)
Molecular Function
chromatin binding (ISO) co-SMAD binding (IEA,ISO) disordered domain specific binding (IEA,ISO) DNA binding (IEA,ISO) DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO) DNA-binding transcription factor activity (IEA,ISO) DNA-binding transcription factor activity, RNA polymerase II-specific (IBA) DNA-binding transcription factor binding (IEA,ISO) double-stranded DNA binding (ISO,ISS) I-SMAD binding (IBA,IEA,ISO) identical protein binding (IEA,ISO) metal ion binding (IEA) phosphatase binding (IEA,ISO) protein binding (IPI,ISO) R-SMAD binding (IEA,ISO) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA,ISO) RNA polymerase II-specific DNA-binding transcription factor binding (ISO,ISS) SMAD binding (IEA,ISO) tau protein binding (ISO) transcription factor binding (IPI) transforming growth factor beta receptor binding (IEA,ISO) type I transforming growth factor beta receptor binding (IEA,ISO) ubiquitin protein ligase binding (IEA,ISO)
1.
Molecular mechanisms of TGF beta receptor-triggered signaling cascades rapidly induced by the calcineurin inhibitors cyclosporin A and FK506.
Akool el-S, etal., J Immunol. 2008 Aug 15;181(4):2831-45.
2.
Gene expression correlating with response to paclitaxel in ovarian carcinoma xenografts.
Bani MR, etal., Mol Cancer Ther. 2004 Feb;3(2):111-21.
3.
Cardioprotective role of growth/differentiation factor 1 in post-infarction left ventricular remodelling and dysfunction.
Bao MW, etal., J Pathol. 2015 Jul;236(3):360-72. doi: 10.1002/path.4523. Epub 2015 Mar 30.
4.
The development of a mouse model of ovarian endosalpingiosis.
Bristol-Gould SK, etal., Endocrinology. 2005 Dec;146(12):5228-36. Epub 2005 Sep 1.
5.
Transforming growth factor-beta pathway in human renal cell carcinoma and surrounding normal-appearing renal parenchyma.
Cardillo MR, etal., Anal Quant Cytol Histol. 2001 Apr;23(2):109-17.
6.
Cited2 modulates TGF-beta-mediated upregulation of MMP9.
Chou YT, etal., Oncogene. 2006 Sep 7;25(40):5547-60. Epub 2006 Apr 17.
7.
Ovarian follicle populations of the rat express TGF-beta signalling pathways.
Drummond AE, etal., Mol Cell Endocrinol. 2003 Apr 28;202(1-2):53-7.
8.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.
Pharmacological application of caffeine inhibits TGF-beta-stimulated connective tissue growth factor expression in hepatocytes via PPARgamma and SMAD2/3-dependent pathways.
Gressner OA, etal., J Hepatol. 2008 Nov;49(5):758-67. Epub 2008 Apr 30.
10.
Interaction between angiotensin II and Smad proteins in fibroblasts in failing heart and in vitro.
Hao J, etal., Am J Physiol Heart Circ Physiol. 2000 Dec;279(6):H3020-30.
11.
[Changes in TGF-beta1/Smads signaling pathway in rats with chemical hepatocarcinogenesis].
Hua YP, etal., Nan Fang Yi Ke Da Xue Xue Bao. 2008 Oct;28(10):1848-52.
12.
Poly(ADP-ribose) polymerase 1 is indispensable for transforming growth factor-beta Induced Smad3 activation in vascular smooth muscle cell.
Huang D, etal., PLoS One. 2011;6(10):e27123. doi: 10.1371/journal.pone.0027123. Epub 2011 Oct 31.
13.
Effect of wound type on Smad 2 and 4 translocation.
Hutcheon AE, etal., Invest Ophthalmol Vis Sci. 2005 Jul;46(7):2362-8.
14.
Overexpression of Smad2 and colocalization with TGF-beta1 in human pancreatic cancer.
Kleeff J, etal., Dig Dis Sci. 1999 Sep;44(9):1793-802.
15.
Lefty1 Ameliorates Post-infarction Fibrosis by Suppressing p-Smad2 and p-ERK1/2 Signaling Pathways.
Li CY, etal., J Cardiovasc Transl Res. 2021 Aug;14(4):636-646. doi: 10.1007/s12265-020-10089-2. Epub 2021 Jan 6.
16.
Expression of Smad2 and Smad4, transforming growth factor-beta signal transducers in rat endometrium during the estrous cycle, pre-, and peri-implantation.
Lin HY, etal., Anim Reprod Sci 2004 Feb;80(3-4):303-16.
17.
cAMP inhibits transforming growth factor-beta-stimulated collagen synthesis via inhibition of extracellular signal-regulated kinase 1/2 and Smad signaling in cardiac fibroblasts.
Liu X, etal., Mol Pharmacol. 2006 Dec;70(6):1992-2003. Epub 2006 Sep 7.
18.
Expression and location of Smad2, 4 mRNAs during and after liver fibrogenesis of rats.
Liu Y, etal., World J Gastroenterol. 2006 Mar 14;12(10):1577-82.
19.
Loss of expression, and mutations of Smad 2 and Smad 4 in human cervical cancer.
Maliekal TT, etal., Oncogene. 2003 Jul 31;22(31):4889-97.
20.
TGFbeta in Cancer.
Massagué J, Cell. 2008 Jul 25;134(2):215-30. doi: 10.1016/j.cell.2008.07.001.
21.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
22.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
23.
Altered expression of Smad family members in injured motor neurons of rat.
Okuyama N, etal., Brain Res. 2007 Feb 9;1132(1):36-41. Epub 2006 Dec 12.
24.
Expression and localization of the transforming growth factor-beta type I receptor and Smads in preneoplastic lesions during chemical hepatocarcinogenesis in rats.
Park do Y, etal., J Korean Med Sci 2003 Aug;18(4):510-9.
25.
Expression and intracellular localization of Smad proteins in human endometrial cancer.
Piestrzeniewicz-Ulanska D, etal., Oncol Rep. 2003 Sep-Oct;10(5):1539-44.
26.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
27.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
28.
GOA pipeline
RGD automated data pipeline
29.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
30.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
31.
Mutation analysis of SMAD2, SMAD3, and SMAD4 genes in hereditary non-polyposis colorectal.
Roth S, etal., J Med Genet. 2000 Apr;37(4):298-300.
32.
Mechanisms of TGF-beta signaling from cell membrane to the nucleus.
Shi Y and Massague J, Cell. 2003 Jun 13;113(6):685-700.
33.
Oncopreventive effects of theanine and theobromine on dimethylhydrazine-induced colon cancer model.
Shojaei-Zarghani S, etal., Biomed Pharmacother. 2021 Feb;134:111140. doi: 10.1016/j.biopha.2020.111140. Epub 2020 Dec 24.
34.
Novel roles of Akt and mTOR in suppressing TGF-beta/ALK5-mediated Smad3 activation.
Song K, etal., EMBO J. 2006 Jan 11;25(1):58-69. Epub 2005 Dec 15.
35.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
36.
Smad2 and Smad3 play different roles in rat hepatic stellate cell function and alpha-smooth muscle actin organization.
Uemura M, etal., Mol Biol Cell. 2005 Sep;16(9):4214-24. Epub 2005 Jun 29.
37.
MicroRNA-323-3p inhibits cell invasion and metastasis in pancreatic ductal adenocarcinoma via direct suppression of SMAD2 and SMAD3.
Wang C, etal., Oncotarget. 2016 Mar 22;7(12):14912-24. doi: 10.18632/oncotarget.7482.
38.
MicroRNA-31/184 is involved in transforming growth factor-β-induced apoptosis in A549 human alveolar adenocarcinoma cells.
Wang CJ, etal., Life Sci. 2020 Feb 1;242:117205. doi: 10.1016/j.lfs.2019.117205. Epub 2019 Dec 23.
39.
Analysis of specific gene mutations in the transforming growth factor-beta signal transduction pathway in human ovarian cancer.
Wang D, etal., Cancer Res. 2000 Aug 15;60(16):4507-12.
40.
Activin signal transduction in the fetal rat adrenal gland and in human H295R cells.
Wang EY, etal., J Endocrinol 2003 Jul;178(1):137-48.
41.
Alterations of Smad signaling in human breast carcinoma are associated with poor outcome: a tissue microarray study.
Xie W, etal., Cancer Res. 2002 Jan 15;62(2):497-505.
42.
Stage-specific expression of Smad2 and Smad3 during folliculogenesis.
Xu J, etal., Biol Reprod 2002 Jun;66(6):1571-8.
43.
TGF-beta signaling alterations and susceptibility to colorectal cancer.
Xu Y and Pasche B, Hum Mol Genet. 2007 Apr 15;16 Spec No 1:R14-20.
44.
Altered gene expression profile in mouse bladder cancers induced by hydroxybutyl(butyl)nitrosamine.
Yao R, etal., Neoplasia. 2004 Sep-Oct;6(5):569-77.
45.
Lefty-1 inhibits renal epithelial-mesenchymal transition by antagonizing the TGF-β/Smad signaling pathway.
Zhang L, etal., J Mol Histol. 2020 Feb;51(1):77-87. doi: 10.1007/s10735-020-09859-8. Epub 2020 Feb 17.
46.
Involvement of Smad proteins in the differentiation of pancreatic AR42J cells induced by activin A.
Zhang YQ, etal., Diabetologia 1999 Jun;42(6):719-27.
47.
Regulation of Smad3 expression in bleomycin-induced pulmonary fibrosis: a negative feedback loop of TGF-beta signaling.
Zhao Y and Geverd DA, Biochem Biophys Res Commun 2002 Jun 7;294(2):319-23.
Smad2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 72,124,792 - 72,193,345 (+) NCBI GRCr8 mRatBN7.2 18 69,849,884 - 69,918,926 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 69,850,377 - 69,912,323 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 71,959,978 - 72,021,908 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 72,629,252 - 72,691,176 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 70,485,797 - 70,547,727 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 72,550,107 - 72,612,078 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 72,550,219 - 72,612,078 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 71,672,879 - 71,735,128 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 73,180,520 - 73,241,707 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 73,253,792 - 73,314,980 (+) NCBI Celera 18 68,381,756 - 68,443,610 (+) NCBI Celera Cytogenetic Map 18 q12.3 NCBI
SMAD2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 18 47,808,957 - 47,930,872 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 18 47,808,957 - 47,931,146 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 18 45,335,328 - 45,457,243 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 18 43,613,464 - 43,711,510 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 18 43,618,434 - 43,710,924 NCBI Celera 18 42,208,816 - 42,306,655 (-) NCBI Celera Cytogenetic Map 18 q21.1 NCBI HuRef 18 42,208,822 - 42,306,925 (-) NCBI HuRef CHM1_1 18 45,354,416 - 45,452,506 (-) NCBI CHM1_1 T2T-CHM13v2.0 18 47,999,960 - 48,121,861 (-) NCBI T2T-CHM13v2.0
Smad2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 76,369,898 - 76,444,819 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 76,374,651 - 76,444,034 (+) Ensembl GRCm39 Ensembl GRCm38 18 76,241,090 - 76,311,748 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 76,241,580 - 76,310,963 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 76,401,579 - 76,465,385 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 76,367,290 - 76,431,096 (+) NCBI MGSCv36 mm8 Celera 18 77,499,761 - 77,546,271 (+) NCBI Celera Cytogenetic Map 18 E3 NCBI cM Map 18 51.42 NCBI
Smad2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955402 33,136,778 - 33,216,844 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955402 33,131,760 - 33,217,144 (-) NCBI ChiLan1.0 ChiLan1.0
SMAD2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 17 65,367,623 - 65,457,402 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 18 51,053,093 - 51,150,005 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 18 41,213,001 - 41,309,902 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 18 44,572,213 - 44,669,008 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 18 44,580,905 - 44,668,530 (-) Ensembl panpan1.1 panPan2
SMAD2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 43,696,883 - 43,778,063 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 43,700,445 - 43,769,983 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 43,181,631 - 43,262,778 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 43,649,238 - 43,731,066 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 43,649,269 - 43,723,505 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 43,350,952 - 43,432,066 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 43,405,083 - 43,486,241 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 43,688,637 - 43,769,813 (+) NCBI UU_Cfam_GSD_1.0
Smad2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404944 39,484,164 - 39,562,655 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936497 14,723,199 - 14,801,697 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936497 14,723,199 - 14,812,160 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SMAD2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 97,415,716 - 97,511,357 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 97,415,360 - 97,511,388 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 106,898,131 - 106,991,500 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SMAD2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 18 33,017,138 - 33,105,320 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 18 33,017,492 - 33,104,606 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 7,285,525 - 7,381,371 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Smad2
.
Predicted Target Of
Count of predictions: 352 Count of miRNA genes: 210 Interacting mature miRNAs: 238 Transcripts: ENSRNOT00000046847 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1331733 Bp233 Blood pressure QTL 233 3.97196 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 24796977 79788953 Rat 12904069 Cm123 Cardiac mass QTL 123 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 18 52539763 76104388 Rat 12904070 Cm124 Cardiac mass QTL 124 0.01 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 18 52539763 76104388 Rat 2303584 Gluco55 Glucose level QTL 55 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 18 48520044 83828827 Rat 12904071 Am18 Aortic mass QTL 18 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 18 52539763 76104388 Rat 12904067 Cm122 Cardiac mass QTL 122 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 18 52539763 76104388 Rat 61384 Bp48 Blood pressure QTL 48 19.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 60622311 77209844 Rat 1331741 Bp232 Blood pressure QTL 232 3.59112 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 21372893 83213037 Rat 2301417 Bp319 Blood pressure QTL 319 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 52539763 76104388 Rat 1298072 Cia26 Collagen induced arthritis QTL 26 3.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 54709769 83828827 Rat 12904073 Kidm71 Kidney mass QTL 71 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 18 52539763 76104388 Rat 6903353 Bp353 Blood pressure QTL 353 2.8 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 59796478 83828827 Rat 738008 Hcar14 Hepatocarcinoma resistance QTL 14 4.3 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion number (CMO:0001462) 18 51464733 83218561 Rat 6903356 Bp354 Blood pressure QTL 354 4.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 59796478 83828827 Rat 631518 Bw11 Body weight QTL 11 2.8 body mass (VT:0001259) body weight (CMO:0000012) 18 35870723 80870723 Rat 6893683 Bw110 Body weight QTL 110 2.7 0.002 body mass (VT:0001259) body weight (CMO:0000012) 18 43345022 83828827 Rat 8694366 Abfw8 Abdominal fat weight QTL 8 6.38 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 18 46640675 83828827 Rat 2300157 Bmd66 Bone mineral density QTL 66 13.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 738005 Anxrr11 Anxiety related response QTL 11 3.4 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 18 30039813 75039813 Rat 631274 Sprol1 Serum protein level QTL 1 5.3 blood total protein amount (VT:0005567) serum total protein level (CMO:0000661) 18 31393320 77209694 Rat 9589041 Epfw12 Epididymal fat weight QTL 12 17.08 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 18 46640675 83828827 Rat 8694432 Bw165 Body weight QTL 165 3.81 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 46640675 83828827 Rat 70185 BpQTLcluster15 Blood pressure QTL cluster 15 4.61 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 18 59712417 76477814 Rat 2293704 Bss35 Bone structure and strength QTL 35 4.59 0.0002 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 18 28964853 73964853 Rat 9589816 Gluco68 Glucose level QTL 68 7.25 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 29792965 74792965 Rat 2325839 Bp348 Blood pressure QTL 348 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 25570985 70570985 Rat 1600373 Mamtr6 Mammary tumor resistance QTL 6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 18 19278901 83218561 Rat 8694378 Bw157 Body weight QTL 157 3.59 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 29792965 74792965 Rat 1331770 Bp234 Blood pressure QTL 234 3.807 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 59796478 71893566 Rat 2303571 Bw92 Body weight QTL 92 3 body mass (VT:0001259) body weight (CMO:0000012) 18 48520044 83828827 Rat 2300177 Bmd65 Bone mineral density QTL 65 19.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 1598826 Anxrr20 Anxiety related response QTL 20 3.04 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 18 41432971 83828827 Rat 2301969 Bp324 Blood pressure QTL 324 4.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 59712417 76477814 Rat 631675 Iddm15 Insulin dependent diabetes mellitus QTL 15 urine glucose amount (VT:0001758) percentage of study population developing diabetes mellitus during a period of time (CMO:0001114) 18 60622311 77209844 Rat 1578667 Bss21 Bone structure and strength QTL 21 3.5 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 18 11791518 83218561 Rat 2303120 Mamtr8 Mammary tumor resistance QTL 8 0.001 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 18 31359408 83218561 Rat 12880368 Bw187 Body weight QTL 187 0.045 body mass (VT:0001259) body weight (CMO:0000012) 18 52539763 76104388 Rat 61429 Cia17 Collagen induced arthritis QTL 17 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 31359408 70263868 Rat 724542 Kidm2 Kidney mass QTL 2 2.6 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 18 59172115 83828827 Rat 61367 Iddm4 Insulin dependent diabetes mellitus QTL 4 2.33 0.0074 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 38192455 83192455 Rat 1359020 Ppulsi2 Prepulse inhibition QTL 2 2.71 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 18 52292875 73997283 Rat 2312600 Bp341 Blood pressure QTL 341 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 59330409 70263868 Rat 9590318 Scort22 Serum corticosterone level QTL 22 7.64 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 18 29792965 74792965 Rat 1578661 Bss20 Bone structure and strength QTL 20 3.7 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 18 11791518 83218561 Rat 1331754 Bp230 Blood pressure QTL 230 4.61609 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 29792965 74792965 Rat
D18Rat7
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 69,876,866 - 69,877,088 (+) MAPPER mRatBN7.2 Rnor_6.0 18 72,576,791 - 72,577,012 NCBI Rnor6.0 Rnor_5.0 18 71,699,554 - 71,699,775 UniSTS Rnor5.0 RGSC_v3.4 18 73,206,755 - 73,206,977 RGD RGSC3.4 RGSC_v3.4 18 73,206,756 - 73,206,977 UniSTS RGSC3.4 RGSC_v3.1 18 73,280,029 - 73,280,250 RGD Celera 18 68,408,328 - 68,408,547 UniSTS RH 3.4 Map 18 735.2 RGD RH 3.4 Map 18 735.2 UniSTS RH 2.0 Map 18 195.4 RGD SHRSP x BN Map 18 44.4299 RGD Cytogenetic Map 18 q12.3 UniSTS
RH127384
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 69,911,949 - 69,912,169 (+) MAPPER mRatBN7.2 Rnor_6.0 18 72,611,835 - 72,612,054 NCBI Rnor6.0 Rnor_5.0 18 71,734,740 - 71,734,959 UniSTS Rnor5.0 RGSC_v3.4 18 73,241,884 - 73,242,103 UniSTS RGSC3.4 Celera 18 68,443,367 - 68,443,586 UniSTS RH 3.4 Map 18 730.7 UniSTS Cytogenetic Map 18 q12.3 UniSTS
PMC324399P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 69,911,181 - 69,911,594 (+) MAPPER mRatBN7.2 Rnor_6.0 18 72,611,067 - 72,611,479 NCBI Rnor6.0 Rnor_5.0 18 71,733,972 - 71,734,384 UniSTS Rnor5.0 RGSC_v3.4 18 73,241,116 - 73,241,528 UniSTS RGSC3.4 Celera 18 68,442,599 - 68,443,011 UniSTS Cytogenetic Map 18 q12.3 UniSTS
AA858489
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 69,911,339 - 69,911,533 (+) MAPPER mRatBN7.2 Rnor_6.0 18 72,611,225 - 72,611,418 NCBI Rnor6.0 Rnor_5.0 18 71,734,130 - 71,734,323 UniSTS Rnor5.0 RGSC_v3.4 18 73,241,274 - 73,241,467 UniSTS RGSC3.4 Celera 18 68,442,757 - 68,442,950 UniSTS RH 3.4 Map 18 723.3 UniSTS Cytogenetic Map 18 q12.3 UniSTS
MADH2_1658
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 69,911,154 - 69,911,762 (+) MAPPER mRatBN7.2 Rnor_6.0 18 72,611,040 - 72,611,647 NCBI Rnor6.0 Rnor_5.0 18 71,733,945 - 71,734,552 UniSTS Rnor5.0 RGSC_v3.4 18 73,241,089 - 73,241,696 UniSTS RGSC3.4 Celera 18 68,442,572 - 68,443,179 UniSTS Cytogenetic Map 18 q12.3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000046847 ⟹ ENSRNOP00000048329
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 69,850,398 - 69,912,323 (+) Ensembl Rnor_6.0 Ensembl 18 72,550,219 - 72,612,078 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000089468 ⟹ ENSRNOP00000071524
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 69,850,390 - 69,911,740 (+) Ensembl Rnor_6.0 Ensembl 18 72,571,327 - 72,611,291 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000092173 ⟹ ENSRNOP00000075341
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 69,850,536 - 69,912,193 (+) Ensembl Rnor_6.0 Ensembl 18 72,550,454 - 72,612,078 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000109129 ⟹ ENSRNOP00000097880
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 69,850,377 - 69,908,841 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000110593 ⟹ ENSRNOP00000080684
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 69,870,327 - 69,912,193 (+) Ensembl
RefSeq Acc Id:
NM_001277450 ⟹ NP_001264379
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 72,125,344 - 72,187,240 (+) NCBI mRatBN7.2 18 69,850,301 - 69,912,193 (+) NCBI Rnor_6.0 18 72,550,219 - 72,612,078 (+) NCBI Rnor_5.0 18 71,672,879 - 71,735,128 (+) NCBI Celera 18 68,381,756 - 68,443,610 (+) NCBI
Sequence:
GGGCGCCAATCAGCGGGCGGCAGGGTGCCAGCCCGGGGCTGCGCCGGCGAATCGGCGGGGCCCGCGGCTCGGGGAGGGAGGCGGGGCTACCGCGCGCGGCGGTGGAGGAGCAGCTCGCTCGCCTGCAG
hide sequence
RefSeq Acc Id:
NM_019191 ⟹ NP_062064
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 72,125,579 - 72,187,240 (+) NCBI mRatBN7.2 18 69,850,536 - 69,912,193 (+) NCBI Rnor_6.0 18 72,550,454 - 72,612,078 (+) NCBI Rnor_5.0 18 71,672,879 - 71,735,128 (+) NCBI RGSC_v3.4 18 73,180,520 - 73,241,707 (+) RGD Celera 18 68,381,991 - 68,443,610 (+) NCBI
Sequence:
TGGAGCAGGCGGCTCCCTCCCCAGCCGGCCGCGGTGAGCGCGGGCCTGGGGGCGGGGCGGGGGC
hide sequence
RefSeq Acc Id:
XM_006254945 ⟹ XP_006255007
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 72,124,926 - 72,193,345 (+) NCBI mRatBN7.2 18 69,849,884 - 69,918,926 (+) NCBI Rnor_6.0 18 72,550,107 - 72,612,078 (+) NCBI Rnor_5.0 18 71,672,879 - 71,735,128 (+) NCBI
Sequence:
CGGCCCCCGGCCCTGCCCGCGGCGCCCGGCCTCCTTCCGTCCCTGCCGTGCTCCCTCCGTCTTC
hide sequence
RefSeq Acc Id:
XM_006254946 ⟹ XP_006255008
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 72,146,597 - 72,193,345 (+) NCBI mRatBN7.2 18 69,871,537 - 69,918,926 (+) NCBI Rnor_6.0 18 72,571,530 - 72,612,078 (+) NCBI Rnor_5.0 18 71,672,879 - 71,735,128 (+) NCBI
Sequence:
CTAAAGAAAACAGGACGATTAGATGAGCTTGAGAAAGCCATCACCACTCAGAATTGCAATACTAAGTGTGTCACCATACCAAGTTGAACAAGGATGGCAAAACAGACCGCTCTACTGATCTCACGTGT
hide sequence
RefSeq Acc Id:
XM_063277279 ⟹ XP_063133349
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 72,124,792 - 72,193,345 (+) NCBI
RefSeq Acc Id:
XM_063277280 ⟹ XP_063133350
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 72,125,626 - 72,193,345 (+) NCBI
RefSeq Acc Id:
NP_062064 ⟸ NM_019191
- UniProtKB:
A0JPM1 (UniProtKB/Swiss-Prot), O70436 (UniProtKB/Swiss-Prot), A6KMS7 (UniProtKB/TrEMBL), A0A8L2QQK5 (UniProtKB/TrEMBL)
- Sequence:
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTANTVDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIY
hide sequence
RefSeq Acc Id:
NP_001264379 ⟸ NM_001277450
- UniProtKB:
A0JPM1 (UniProtKB/Swiss-Prot), O70436 (UniProtKB/Swiss-Prot), A6KMS7 (UniProtKB/TrEMBL), A0A8L2QQK5 (UniProtKB/TrEMBL)
- Sequence:
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTANTVDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIY
hide sequence
RefSeq Acc Id:
XP_006255007 ⟸ XM_006254945
- Peptide Label:
isoform X2
- UniProtKB:
A0A0G2K0P2 (UniProtKB/TrEMBL), A6KMS9 (UniProtKB/TrEMBL), A0A8I6ASQ0 (UniProtKB/TrEMBL)
- Sequence:
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFSLKKD
hide sequence
RefSeq Acc Id:
XP_006255008 ⟸ XM_006254946
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I5ZQC4 (UniProtKB/TrEMBL), A0A8I5ZS20 (UniProtKB/TrEMBL)
- Sequence:
MQSTDANCSSLFKESPSNCCRTSTCSEIWGLSTANTVDQWDTTGLYSFSEQTRSLDGRLQVSHR
hide sequence
Ensembl Acc Id:
ENSRNOP00000075341 ⟸ ENSRNOT00000092173
Ensembl Acc Id:
ENSRNOP00000071524 ⟸ ENSRNOT00000089468
Ensembl Acc Id:
ENSRNOP00000048329 ⟸ ENSRNOT00000046847
Ensembl Acc Id:
ENSRNOP00000080684 ⟸ ENSRNOT00000110593
Ensembl Acc Id:
ENSRNOP00000097880 ⟸ ENSRNOT00000109129
RefSeq Acc Id:
XP_063133349 ⟸ XM_063277279
- Peptide Label:
isoform X1
- UniProtKB:
O70436 (UniProtKB/Swiss-Prot), A0JPM1 (UniProtKB/Swiss-Prot), A0A8L2QQK5 (UniProtKB/TrEMBL), A6KMS7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133350 ⟸ XM_063277280
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6ASQ0 (UniProtKB/TrEMBL), A0A0G2K0P2 (UniProtKB/TrEMBL), A6KMS9 (UniProtKB/TrEMBL)
RGD ID: 13700873 Promoter ID: EPDNEW_R11396 Type: initiation region Name: Smad2_1 Description: SMAD family member 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 18 72,550,297 - 72,550,357 EPDNEW
BioCyc Gene G2FUF-6961 BioCyc
Ensembl Genes ENSRNOG00000018140 Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript ENSRNOT00000046847 ENTREZGENE
ENSRNOT00000089468 ENTREZGENE
ENSRNOT00000092173 ENTREZGENE
ENSRNOT00000092173.2 UniProtKB/Swiss-Prot
ENSRNOT00000109129 ENTREZGENE
ENSRNOT00000122336 ENTREZGENE
Gene3D-CATH 2.60.200.10 UniProtKB/Swiss-Prot
3.90.520.10 UniProtKB/Swiss-Prot
IMAGE_CLONE IMAGE:8364718 IMAGE-MGC_LOAD
InterPro Dwarfin UniProtKB/Swiss-Prot
MAD_homology1_Dwarfin-type UniProtKB/Swiss-Prot
MAD_homology_MH1 UniProtKB/Swiss-Prot
SMAD-like_dom_sf UniProtKB/Swiss-Prot
SMAD_dom_Dwarfin-type UniProtKB/Swiss-Prot
SMAD_FHA_dom_sf UniProtKB/Swiss-Prot
SMAD_MH1_sf UniProtKB/Swiss-Prot
KEGG Report rno:29357 UniProtKB/Swiss-Prot
MGC_CLONE MGC:156656 IMAGE-MGC_LOAD
NCBI Gene 29357 ENTREZGENE
PANTHER MOTHERS AGAINST DECAPENTAPLEGIC HOMOLOG 2 UniProtKB/Swiss-Prot
PTHR13703 UniProtKB/Swiss-Prot
Pfam MH1 UniProtKB/Swiss-Prot
MH2 UniProtKB/Swiss-Prot
PhenoGen Smad2 PhenoGen
PROSITE MH1 UniProtKB/Swiss-Prot
MH2 UniProtKB/Swiss-Prot
RatGTEx ENSRNOG00000018140 RatGTEx
SMART DWA UniProtKB/Swiss-Prot
DWB UniProtKB/Swiss-Prot
Superfamily-SCOP SSF49879 UniProtKB/Swiss-Prot
SSF56366 UniProtKB/Swiss-Prot
TIGR TC217521
UniProt A0A0G2K0P2 ENTREZGENE, UniProtKB/TrEMBL
A0A8I5ZQC4 ENTREZGENE, UniProtKB/TrEMBL
A0A8I5ZS20 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6ASQ0 ENTREZGENE, UniProtKB/TrEMBL
A0A8L2QQK5 ENTREZGENE, UniProtKB/TrEMBL
A0JPM1 ENTREZGENE
A6KMS7 ENTREZGENE, UniProtKB/TrEMBL
A6KMS9 ENTREZGENE, UniProtKB/TrEMBL
O70436 ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary A0JPM1 UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-10-23
Smad2
SMAD family member 2
Smad2
MAD homolog 2 (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-11-17
Smad2
MAD homolog 2 (Drosophila)
Symbol updated
1299863 APPROVED
2002-06-10
Madh2
MAD homolog 2 (Drosophila)
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_disease
may be involved in pulmonary fibrosis
625421
gene_drugs
bleomycin at a dose of 9U/kg body weight causes no significant change in the expression of the protein
625421
gene_process
an essential downstream intracellular target of the TGF-beta receptor signaling pathway
625421
gene_process
involved in folliculogenesis
727374
gene_process
activation induces apoptosis in pancreatic AR42J cells induced by activin A
69876
gene_product
member of the family of Smad proteins
625421
gene_regulation
phosphorylated by activated TGF-beta type 1 receptor
625421
