Symbol:
Lepr
Name:
leptin receptor
RGD ID:
3001
Description:
Enables peptide hormone binding activity and protein-hormone receptor activity. Involved in several processes, including gonad development; negative regulation of behavior; and positive regulation of cell communication. Located in extracellular space. Used to study several diseases, including chronic kidney disease; congestive heart failure (multiple); glucose metabolism disease (multiple); obesity; and renal fibrosis. Biomarker of pre-eclampsia and short bowel syndrome. Human ortholog(s) of this gene implicated in several diseases, including artery disease (multiple); liver disease (multiple); obesity; obstructive sleep apnea; and type 2 diabetes mellitus. Orthologous to human LEPR (leptin receptor); PARTICIPATES IN leptin system pathway; altered leptin system pathway; obesity pathway; INTERACTS WITH (S)-nicotine; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Fa; LEP-R; Leptin receptor (fatty); OB receptor; OB-R
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
LEPR (leptin receptor) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Lepr (leptin receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Lepr (leptin receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LEPR (leptin receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
LEPR (leptin receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Lepr (leptin receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LEPR (leptin receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LEPR (leptin receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Lepr (leptin receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Lepr (leptin receptor)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
LEPR (leptin receptor)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
lepr (leptin receptor)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
lepr
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Allele / Splice:
Lepr_v2
Lepr_v1
Leprem2Mcwi
Leprm1Rll
Leprcp
Leprem1
Leprem2
Leprem3
Leprfa
Leprem4Lizh
Genetic Models:
BN.ZUC-Leprfa
LA-cp /NRll
ZUC-Lepr fa
ZUC-Lepr faSte-/-
SS-Leprem2Mcwi
WDF-Leprm1Rll
ZDF-Leprm1Rll
SD-Leprem3
SD-Leprem2
SD-Leprem1
Is Marker For:
Strains:
ZUC-Lepr +Ste
KZ-Lepr faTky
F344.ZUC-Leprfa /Tj
ZDF-Leprfa CrlCrlj
ZDF-Leprfa /Crl
F344.ZUC-(Leprfa ),OLETF-(D14Rat23-D14Rat12 )/Tj
Slc:ZUC-Leprfa-/-
Ho:ZFDM-Leprfa
ZDF-Leprfa /Drt
SS.ZUC-Leprfa-/+ /Slc
SS.ZUC-Leprfa+/+ /Slc
Slc:ZUC-Leprfa+
Candidate Gene For:
Bss4 Bw146
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 121,409,735 - 121,593,201 (+) NCBI GRCr8 mRatBN7.2 5 116,294,409 - 116,477,904 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 116,289,823 - 116,475,908 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 118,847,763 - 119,019,098 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 120,573,106 - 120,744,441 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 120,624,429 - 120,795,760 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 120,503,475 - 120,682,281 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 120,564,645 - 120,682,221 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 124,380,327 - 124,525,200 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 5 124,555,678 - 124,556,585 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 122,320,075 - 122,503,449 NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 114,817,255 - 114,982,861 (+) NCBI Celera RH 3.4 Map 5 RGD Cytogenetic Map 5 q33 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Lepr Rat (1->4)-beta-D-glucan multiple interactions ISO Lepr (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of LEPR mRNA CTD PMID:36331819 Lepr Rat (N(omega)-L-arginino)succinic acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of Argininosuccinic Acid CTD PMID:20567778 Lepr Rat (R)-carnitine affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of Carnitine CTD PMID:20567778 Lepr Rat (R)-pantothenic acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of Pantothenic Acid CTD PMID:20567778 Lepr Rat (S)-nicotine increases expression EXP 6480464 Nicotine results in increased expression of LEPR mRNA CTD PMID:22265867 Lepr Rat (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of LEPR mRNA CTD PMID:29155039 Lepr Rat 1,2-dichloroethane increases expression ISO Lepr (Mus musculus) 6480464 ethylene dichloride results in increased expression of LEPR mRNA CTD PMID:28960355 Lepr Rat 1-methylnicotinamide affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of N(1)-methylnicotinamide CTD PMID:20567778 Lepr Rat 17alpha-ethynylestradiol multiple interactions ISO Lepr (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of LEPR mRNA and ESR1 gene mutant form inhibits the reaction [Ethinyl Estradiol results in increased expression of LEPR mRNA] CTD PMID:17942748 and PMID:29112739 Lepr Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of LEPR mRNA CTD PMID:26865667 Lepr Rat 17alpha-ethynylestradiol increases expression ISO Lepr (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of LEPR mRNA CTD PMID:17942748 and PMID:29112739 Lepr Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of LEPR mRNA CTD PMID:17351261 Lepr Rat 17beta-estradiol affects abundance EXP 6480464 LEPR protein affects the abundance of Estradiol CTD PMID:15093691 Lepr Rat 17beta-estradiol increases expression ISO Lepr (Mus musculus) 6480464 Estradiol results in increased expression of LEPR mRNA CTD PMID:39298647 Lepr Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of LEPR mRNA CTD PMID:32145629 Lepr Rat 17beta-estradiol affects expression EXP 1581837 17beta-estradiol affects expression of Lepr protein in adipose tissue and serum of ovarectomized rats RGD Lepr Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of LEPR mRNA and [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in decreased expression of LEPR mRNA CTD PMID:26496021 and PMID:32741896 Lepr Rat 17beta-estradiol decreases expression ISO LEPR (Homo sapiens) 6480464 Estradiol results in decreased expression of LEPR mRNA CTD PMID:19167446 Lepr Rat 17beta-estradiol decreases expression ISO Lepr (Mus musculus) 6480464 Estradiol results in decreased expression of LEPR mRNA CTD PMID:14664709 Lepr Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in decreased expression of LEPR mRNA CTD PMID:32741896 Lepr Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Lepr (Mus musculus) 6480464 [2 more ... CTD PMID:24978599 and PMID:25510870 Lepr Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO Lepr (Mus musculus) 6480464 2 more ... CTD PMID:29112739 Lepr Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Lepr (Mus musculus) 6480464 ESR1 gene mutant form inhibits the reaction [2 more ... CTD PMID:29112739 Lepr Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Lepr (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Lepr Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO LEPR (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of LEPR mRNA CTD PMID:20106945 Lepr Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of LEPR mRNA CTD PMID:34747641 Lepr Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Lepr (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of LEPR mRNA CTD PMID:26290441 and PMID:33956508 Lepr Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Lepr (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of LEPR mRNA CTD PMID:26377647 and PMID:28922406 Lepr Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of LEPR mRNA CTD PMID:20959002 and PMID:21724226 Lepr Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO LEPR (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of LEPR mRNA CTD PMID:22298810 Lepr Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of LEPR mRNA CTD PMID:15977195 and PMID:22298810 Lepr Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Lepr (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of LEPR mRNA CTD PMID:17942748 Lepr Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of LEPR mRNA CTD PMID:21346803 Lepr Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of LEPR mRNA CTD PMID:21346803 Lepr Rat 2-amino-2-deoxy-D-galactopyranose increases response to substance ISO Lepr (Mus musculus) 6480464 LEPR gene mutant form results in increased susceptibility to Galactosamine CTD PMID:19913045 Lepr Rat 2-amino-2-deoxy-D-galactopyranose multiple interactions ISO Lepr (Mus musculus) 6480464 [LEPR gene mutant form results in increased susceptibility to Galactosamine] which results in increased expression of IL12B mRNA more ... CTD PMID:19913045 Lepr Rat 2-amino-2-deoxy-D-glucopyranose affects response to substance EXP 6480464 LEPR protein affects the susceptibility to Glucosamine CTD PMID:33345901 Lepr Rat 2-amino-2-deoxy-D-glucopyranose multiple interactions EXP 6480464 [LEPR protein affects the susceptibility to Glucosamine] which affects the expression of ALB protein CTD PMID:33345901 Lepr Rat 2-hydroxy-4-methylvaleric acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of alpha-hydroxyisocaproic acid CTD PMID:20567778 Lepr Rat 2-hydroxyisobutyric acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of 2-hydroxyisobutyric acid CTD PMID:20567778 Lepr Rat 2-hydroxypropanoic acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of Lactic Acid CTD PMID:20567778 Lepr Rat 2-methyl-4-chlorophenoxybutyric acid multiple interactions EXP 6480464 [2-amino-3-chloro-1 and 4-naphthoquinone co-treated with Ziram co-treated with cyromazine co-treated with 2-methyl-4-chlorophenoxy gamma-butyric acid co-treated with pirimicarb co-treated with Thiram] results in decreased expression of LEPR mRNA CTD PMID:29321614 Lepr Rat 2-oxoadipic acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of alpha-ketoadipic acid CTD PMID:20567778 Lepr Rat 3-methyl-2-oxobutanoic acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of alpha-ketoisovalerate CTD PMID:20567778 Lepr Rat 3-methyl-2-oxovaleric acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of alpha-keto-beta-methylvaleric acid CTD PMID:20567778 Lepr Rat 4,4'-diaminodiphenylmethane affects expression ISO Lepr (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of LEPR mRNA CTD PMID:18648102 Lepr Rat 4,4'-sulfonyldiphenol increases expression ISO Lepr (Mus musculus) 6480464 bisphenol S results in increased expression of LEPR mRNA CTD PMID:30951980 Lepr Rat 4,4'-sulfonyldiphenol decreases expression ISO Lepr (Mus musculus) 6480464 bisphenol S results in decreased expression of LEPR mRNA CTD PMID:39298647 Lepr Rat 4-hydroxy-TEMPO multiple interactions ISO Lepr (Mus musculus) 6480464 tempol inhibits the reaction [LEPR gene mutant form results in decreased susceptibility to Acetylcholine] CTD PMID:19478208 Lepr Rat 4-phenylbutyric acid multiple interactions ISO Lepr (Mus musculus) 6480464 4-phenylbutyric acid affects the reaction [LEPR gene mutant form affects the splicing of XBP1 mRNA] more ... CTD PMID:23274897 Lepr Rat 5-aza-2'-deoxycytidine decreases expression ISO LEPR (Homo sapiens) 6480464 Decitabine results in decreased expression of LEPR CTD PMID:22560341 Lepr Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of LEPR mRNA CTD PMID:24780913 Lepr Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione multiple interactions ISO Lepr (Mus musculus) 6480464 swietenine inhibits the reaction [LEPR gene mutant form results in increased abundance of Uric Acid] CTD PMID:36066211 Lepr Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione increases abundance ISO Lepr (Mus musculus) 6480464 LEPR gene mutant form results in increased abundance of Uric Acid CTD PMID:36066211 Lepr Rat 8-Br-cAMP multiple interactions ISO LEPR (Homo sapiens) 6480464 LEPR protein affects the reaction [LEP protein inhibits the reaction [8-Bromo Cyclic Adenosine Monophosphate results in increased chemical synthesis of Progesterone]] and LEPR protein affects the reaction [LEP protein inhibits the reaction [8-Bromo Cyclic Adenosine Monophosphate results in increased expression of STAR protein]] CTD PMID:19849856 Lepr Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of LEPR mRNA CTD PMID:31881176 Lepr Rat acetohydrazide decreases expression ISO Lepr (Mus musculus) 6480464 acetylhydrazine results in decreased expression of LEPR mRNA CTD PMID:15282401 Lepr Rat acetylcholine decreases response to substance ISO Lepr (Mus musculus) 6480464 LEPR gene mutant form results in decreased susceptibility to Acetylcholine CTD PMID:19478208 Lepr Rat acetylcholine multiple interactions ISO Lepr (Mus musculus) 6480464 acetovanillone inhibits the reaction [LEPR gene mutant form results in decreased susceptibility to Acetylcholine] more ... CTD PMID:19478208 Lepr Rat acrolein multiple interactions ISO LEPR (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of and results in increased oxidation of LEPR mRNA more ... CTD PMID:32699268 and PMID:32845096 Lepr Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of LEPR mRNA CTD PMID:23630614 more ... Lepr Rat aflatoxin B1 decreases expression ISO LEPR (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of LEPR mRNA CTD PMID:27153756 Lepr Rat aldehydo-D-glucosamine multiple interactions EXP 6480464 [LEPR protein affects the susceptibility to Glucosamine] which affects the expression of ALB protein CTD PMID:33345901 Lepr Rat aldehydo-D-glucosamine affects response to substance EXP 6480464 LEPR protein affects the susceptibility to Glucosamine CTD PMID:33345901 Lepr Rat aldehydo-D-glucose affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of Glucose and LEPR protein affects the abundance of Glucose CTD PMID:16427799 and PMID:20567778 Lepr Rat aldehydo-D-glucose increases expression EXP 6480464 Glucose results in increased expression of LEPR protein CTD PMID:24399619 Lepr Rat aldehydo-D-glucose multiple interactions ISO Lepr (Mus musculus) 6480464 Hesperidin affects the reaction [LEPR protein affects the abundance of Glucose] and naringin affects the reaction [LEPR protein affects the abundance of Glucose] CTD PMID:16427799 Lepr Rat aldehydo-D-glucose multiple interactions EXP 6480464 naringin inhibits the reaction [Glucose results in increased expression of LEPR protein] CTD PMID:24399619 Lepr Rat aldehydo-D-glucose decreases response to substance ISO Lepr (Mus musculus) 6480464 LEPR results in decreased susceptibility to Glucose CTD PMID:20567778 Lepr Rat all-trans-retinoic acid increases expression ISO Lepr (Mus musculus) 6480464 Tretinoin results in increased expression of LEPR mRNA CTD PMID:36189433 Lepr Rat all-trans-retinoic acid multiple interactions ISO Lepr (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of LEPR mRNA CTD PMID:36189433 Lepr Rat allantoin affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of Allantoin CTD PMID:20567778 Lepr Rat allethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of LEPR protein CTD PMID:34896426 Lepr Rat allopurinol multiple interactions EXP 6480464 Allopurinol inhibits the reaction [Fructose results in increased expression of and results in increased phosphorylation of LEPR protein] CTD PMID:22426011 Lepr Rat alpha-pinene multiple interactions ISO LEPR (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of and results in increased oxidation of LEPR mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of and results in increased oxidation of LEPR mRNA CTD PMID:32699268 Lepr Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of LEPR mRNA CTD PMID:35163327 Lepr Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of LEPR mRNA CTD PMID:16483693 Lepr Rat anthra[1,9-cd]pyrazol-6(2H)-one affects response to substance ISO Lepr (Mus musculus) 6480464 LEPR protein affects the susceptibility to pyrazolanthrone CTD PMID:22933112 Lepr Rat apocynin multiple interactions ISO Lepr (Mus musculus) 6480464 acetovanillone inhibits the reaction [LEPR gene mutant form results in decreased susceptibility to Acetylcholine] and acetovanillone inhibits the reaction [LEPR gene mutant form results in increased abundance of Superoxides] CTD PMID:19478208 Lepr Rat aristolochic acid A decreases expression ISO LEPR (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of LEPR mRNA CTD PMID:33212167 Lepr Rat arsane decreases expression ISO Lepr (Mus musculus) 6480464 Arsenic results in decreased expression of LEPR mRNA CTD PMID:19654921 Lepr Rat arsane decreases expression ISO LEPR (Homo sapiens) 6480464 Arsenic results in decreased expression of LEPR mRNA CTD PMID:38036231 Lepr Rat arsane affects methylation ISO LEPR (Homo sapiens) 6480464 Arsenic affects the methylation of LEPR gene CTD PMID:25304211 Lepr Rat arsenic atom decreases expression ISO Lepr (Mus musculus) 6480464 Arsenic results in decreased expression of LEPR mRNA CTD PMID:19654921 Lepr Rat arsenic atom decreases expression ISO LEPR (Homo sapiens) 6480464 Arsenic results in decreased expression of LEPR mRNA CTD PMID:38036231 Lepr Rat arsenic atom affects methylation ISO LEPR (Homo sapiens) 6480464 Arsenic affects the methylation of LEPR gene CTD PMID:25304211 Lepr Rat astaxanthin multiple interactions ISO Lepr (Mus musculus) 6480464 astaxanthine inhibits the reaction [LEPR gene mutant form results in increased expression of AIFM1 mRNA] more ... CTD PMID:16964424 Lepr Rat benzo[a]pyrene decreases expression ISO Lepr (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of LEPR mRNA CTD PMID:19770486 Lepr Rat benzo[a]pyrene affects methylation ISO LEPR (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of LEPR 5' UTR CTD PMID:27901495 Lepr Rat benzo[a]pyrene multiple interactions ISO Lepr (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of LEPR mRNA CTD PMID:27858113 Lepr Rat benzo[a]pyrene decreases expression ISO LEPR (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of LEPR mRNA CTD PMID:22316170 Lepr Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of LEPR mRNA CTD PMID:21839799 Lepr Rat benzo[b]fluoranthene multiple interactions ISO Lepr (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of LEPR mRNA CTD PMID:27858113 Lepr Rat beta-D-glucosamine affects response to substance EXP 6480464 LEPR protein affects the susceptibility to Glucosamine CTD PMID:33345901 Lepr Rat beta-D-glucosamine multiple interactions EXP 6480464 [LEPR protein affects the susceptibility to Glucosamine] which affects the expression of ALB protein CTD PMID:33345901 Lepr Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of LEPR mRNA CTD PMID:18164116 Lepr Rat bis(2-ethylhexyl) phthalate increases expression ISO Lepr (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of LEPR mRNA CTD PMID:35550907 Lepr Rat bisphenol A increases expression ISO LEPR (Homo sapiens) 6480464 bisphenol A results in increased expression of LEPR mRNA and bisphenol A results in increased expression of LEPR protein CTD PMID:22343039 Lepr Rat bisphenol A decreases methylation ISO LEPR (Homo sapiens) 6480464 bisphenol A results in decreased methylation of LEPR gene CTD PMID:31601247 Lepr Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of LEPR mRNA CTD PMID:32145629 and PMID:39307384 Lepr Rat bisphenol A increases expression ISO Lepr (Mus musculus) 6480464 bisphenol A results in increased expression of LEPR mRNA CTD PMID:30951980 Lepr Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of LEPR mRNA CTD PMID:25181051 Lepr Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of LEPR mRNA CTD PMID:26496021 Lepr Rat bisphenol F increases expression ISO Lepr (Mus musculus) 6480464 bisphenol F results in increased expression of LEPR mRNA CTD PMID:30951980 Lepr Rat bromodichloromethane multiple interactions ISO Lepr (Mus musculus) 6480464 LEPR protein affects the reaction [[Dietary Fats co-treated with bromodichloromethane] affects the localization of NCF2 protein] and LEPR protein results in decreased susceptibility to [Dietary Fats co-treated with bromodichloromethane] CTD PMID:23438451 Lepr Rat butanal decreases expression ISO LEPR (Homo sapiens) 6480464 butyraldehyde results in decreased expression of LEPR mRNA CTD PMID:26079696 Lepr Rat butyric acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of Butyric Acid CTD PMID:20567778 Lepr Rat cadmium atom multiple interactions ISO Lepr (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of LEPR mRNA CTD PMID:37325564 Lepr Rat cadmium dichloride decreases expression ISO LEPR (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of LEPR mRNA CTD PMID:38568856 Lepr Rat cadmium dichloride multiple interactions ISO Lepr (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of LEPR mRNA CTD PMID:37325564 Lepr Rat caffeine increases expression EXP 6480464 Caffeine results in increased expression of LEPR mRNA CTD PMID:22583948 Lepr Rat caffeine decreases expression EXP 6480464 Caffeine results in decreased expression of LEPR mRNA CTD PMID:26367767 Lepr Rat calcium atom affects expression EXP 6480464 Calcium affects the expression of LEPR mRNA CTD PMID:15913539 Lepr Rat calcium(0) affects expression EXP 6480464 Calcium affects the expression of LEPR mRNA CTD PMID:15913539 Lepr Rat captopril multiple interactions ISO Lepr (Mus musculus) 6480464 Captopril inhibits the reaction [LEPR protein affects the expression of AGT protein] more ... CTD PMID:28130181 Lepr Rat captopril affects response to substance ISO Lepr (Mus musculus) 6480464 LEPR protein affects the susceptibility to Captopril CTD PMID:28130181 Lepr Rat carbon nanotube decreases expression ISO Lepr (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Lepr Rat carbon nanotube increases expression ISO Lepr (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of LEPR mRNA CTD PMID:25620056 Lepr Rat CGP 52608 multiple interactions ISO LEPR (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to LEPR gene] CTD PMID:28238834 Lepr Rat chloroquine increases expression ISO Lepr (Mus musculus) 6480464 Chloroquine results in increased expression of LEPR protein CTD PMID:31199479 Lepr Rat chlorpyrifos increases expression ISO Lepr (Mus musculus) 6480464 Chlorpyrifos results in increased expression of LEPR mRNA CTD PMID:37019170 Lepr Rat cholesterol increases abundance ISO Lepr (Mus musculus) 6480464 LEPR gene mutant form results in increased abundance of Cholesterol CTD PMID:29988851 Lepr Rat cholesterol multiple interactions ISO Lepr (Mus musculus) 6480464 Glucagon analog inhibits the reaction [LEPR gene mutant form results in increased abundance of Cholesterol] CTD PMID:29988851 Lepr Rat choline affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of Choline CTD PMID:20567778 Lepr Rat choline multiple interactions ISO Lepr (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of LEPR mRNA more ... CTD PMID:20938992 more ... Lepr Rat chromium atom multiple interactions ISO Lepr (Mus musculus) 6480464 LEPR gene mutant form promotes the reaction [[Niacin binds to Chromium] which results in decreased expression of BTC mRNA] more ... CTD PMID:16940432 Lepr Rat chrysene multiple interactions ISO Lepr (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of LEPR mRNA CTD PMID:27858113 Lepr Rat ciguatoxin CTX1B affects expression ISO Lepr (Mus musculus) 6480464 Ciguatoxins affects the expression of LEPR mRNA CTD PMID:18353800 Lepr Rat cisplatin multiple interactions ISO LEPR (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of LEPR mRNA CTD PMID:27392435 Lepr Rat citric acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of Citric Acid CTD PMID:20567778 Lepr Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of LEPR mRNA CTD PMID:22008536 Lepr Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of LEPR mRNA CTD PMID:17602206 Lepr Rat coumestrol decreases expression ISO LEPR (Homo sapiens) 6480464 Coumestrol results in decreased expression of LEPR mRNA CTD PMID:19167446 Lepr Rat coumestrol multiple interactions ISO LEPR (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of LEPR mRNA CTD PMID:19167446 Lepr Rat creatinine affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of Creatinine CTD PMID:20567778 Lepr Rat creatinine multiple interactions ISO Lepr (Mus musculus) 6480464 Glucagon analog inhibits the reaction [LEPR gene mutant form results in increased abundance of Creatinine] and swietenine inhibits the reaction [LEPR gene mutant form results in increased abundance of Creatinine] CTD PMID:29988851 and PMID:36066211 Lepr Rat creatinine increases abundance ISO Lepr (Mus musculus) 6480464 LEPR gene mutant form results in increased abundance of Creatinine CTD PMID:29988851 and PMID:36066211 Lepr Rat crocidolite asbestos decreases expression ISO Lepr (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of LEPR mRNA CTD PMID:29279043 Lepr Rat cyanocob(III)alamin multiple interactions ISO Lepr (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of LEPR mRNA CTD PMID:33549593 Lepr Rat cycloheximide decreases expression ISO Lepr (Mus musculus) 6480464 Cycloheximide results in decreased expression of LEPR protein CTD PMID:31199479 Lepr Rat cycloheximide multiple interactions ISO Lepr (Mus musculus) 6480464 LEP protein inhibits the reaction [Cycloheximide results in decreased expression of LEPR protein] CTD PMID:31199479 Lepr Rat cyclosporin A decreases expression ISO LEPR (Homo sapiens) 6480464 Cyclosporine results in decreased expression of LEPR mRNA CTD PMID:27989131 Lepr Rat cyhalothrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of LEPR protein CTD PMID:34896426 Lepr Rat cypermethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of LEPR protein CTD PMID:34896426 Lepr Rat cyromazine multiple interactions EXP 6480464 [2-amino-3-chloro-1 and 4-naphthoquinone co-treated with Ziram co-treated with cyromazine co-treated with 2-methyl-4-chlorophenoxy gamma-butyric acid co-treated with pirimicarb co-treated with Thiram] results in decreased expression of LEPR mRNA CTD PMID:29321614 Lepr Rat cytarabine decreases expression ISO LEPR (Homo sapiens) 6480464 Cytarabine results in decreased expression of LEPR mRNA CTD PMID:21198554 Lepr Rat D-glucose decreases response to substance ISO Lepr (Mus musculus) 6480464 LEPR results in decreased susceptibility to Glucose CTD PMID:20567778 Lepr Rat D-glucose increases expression EXP 6480464 Glucose results in increased expression of LEPR protein CTD PMID:24399619 Lepr Rat D-glucose multiple interactions EXP 6480464 naringin inhibits the reaction [Glucose results in increased expression of LEPR protein] CTD PMID:24399619 Lepr Rat D-glucose multiple interactions ISO Lepr (Mus musculus) 6480464 Hesperidin affects the reaction [LEPR protein affects the abundance of Glucose] and naringin affects the reaction [LEPR protein affects the abundance of Glucose] CTD PMID:16427799 Lepr Rat D-glucose affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of Glucose and LEPR protein affects the abundance of Glucose CTD PMID:16427799 and PMID:20567778 Lepr Rat dactolisib multiple interactions ISO Lepr (Mus musculus) 6480464 LEPR affects the reaction [dactolisib results in decreased phosphorylation of AKT1 protein] CTD PMID:22949526 Lepr Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of LEPR mRNA CTD PMID:23640034 Lepr Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of LEPR mRNA CTD PMID:23640034 and PMID:23914054 Lepr Rat dexamethasone decreases expression EXP 10412034 Dexamthasone decreases Lepr mRNA and protein expression in placenta RGD Lepr Rat dibenz[a,h]anthracene increases expression ISO Lepr (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Lepr Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of LEPR mRNA CTD PMID:21266533 Lepr Rat dichloroacetic acid increases expression ISO Lepr (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of LEPR mRNA CTD PMID:28962523 Lepr Rat diclofenac increases expression ISO Lepr (Mus musculus) 6480464 Diclofenac results in increased expression of LEPR protein CTD PMID:26934552 Lepr Rat diclofenac affects expression ISO Lepr (Mus musculus) 6480464 Diclofenac affects the expression of LEPR mRNA CTD PMID:26934552 Lepr Rat dicrotophos increases expression ISO LEPR (Homo sapiens) 6480464 dicrotophos results in increased expression of LEPR mRNA CTD PMID:28302478 Lepr Rat diethyl maleate decreases expression EXP 6480464 diethyl maleate results in decreased expression of LEPR mRNA CTD PMID:21161181 Lepr Rat dioxygen increases expression ISO LEPR (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of LEPR mRNA CTD PMID:26516004 Lepr Rat dioxygen multiple interactions ISO Lepr (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of LEPR mRNA CTD PMID:30529165 Lepr Rat diquat decreases expression ISO Lepr (Mus musculus) 6480464 Diquat results in decreased expression of LEPR mRNA CTD PMID:36851058 Lepr Rat dobutamine affects response to substance ISO Lepr (Mus musculus) 6480464 LEPR protein affects the susceptibility to Dobutamine CTD PMID:20175764 Lepr Rat dorsomorphin multiple interactions ISO LEPR (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LEPR mRNA CTD PMID:27188386 Lepr Rat doxorubicin decreases expression ISO LEPR (Homo sapiens) 6480464 Doxorubicin results in decreased expression of LEPR mRNA CTD PMID:29803840 Lepr Rat Enterolactone multiple interactions ISO LEPR (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of LEPR mRNA CTD PMID:19167446 Lepr Rat epoxiconazole decreases expression ISO Lepr (Mus musculus) 6480464 epoxiconazole results in decreased expression of LEPR mRNA CTD PMID:35436446 Lepr Rat estrone multiple interactions ISO Lepr (Mus musculus) 6480464 Estrone inhibits the reaction [LEPR gene mutant form inhibits the reaction [EGFR protein results in increased phosphorylation of EGFR protein]] and Estrone inhibits the reaction [LEPR gene mutant form results in decreased expression of EGFR mRNA] CTD PMID:1753381 Lepr Rat ethanol multiple interactions EXP 6480464 [LEPR gene mutant form results in increased susceptibility to Ethanol] which results in decreased abundance of Zinc more ... CTD PMID:15475485 and PMID:18227024 Lepr Rat ethanol multiple interactions ISO Lepr (Mus musculus) 6480464 [lard co-treated with Ethanol co-treated with High Fructose Corn Syrup] results in decreased expression of LEPR protein more ... CTD PMID:24155903 and PMID:37023972 Lepr Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of LEPR mRNA CTD PMID:16098508 Lepr Rat ethanol increases response to substance EXP 6480464 LEPR gene mutant form results in increased susceptibility to Ethanol CTD PMID:15475485 Lepr Rat ethylmalonic acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of Methylmalonic Acid CTD PMID:20567778 Lepr Rat fentin chloride increases expression EXP 6480464 triphenyltin chloride results in increased expression of LEPR mRNA CTD PMID:37156404 Lepr Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of LEPR mRNA CTD PMID:30307764 Lepr Rat fenvalerate multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of LEPR protein CTD PMID:34896426 Lepr Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of LEPR mRNA CTD PMID:24136188 Lepr Rat folic acid multiple interactions ISO Lepr (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of LEPR mRNA more ... CTD PMID:20938992 more ... Lepr Rat folic acid decreases expression ISO Lepr (Mus musculus) 6480464 Folic Acid results in decreased expression of LEPR mRNA CTD PMID:25629700 Lepr Rat formic acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of formic acid CTD PMID:20567778 Lepr Rat fructose multiple interactions EXP 6480464 Allopurinol inhibits the reaction [Fructose results in increased expression of and results in increased phosphorylation of LEPR protein] more ... CTD PMID:22426011 Lepr Rat fumaric acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of fumaric acid CTD PMID:20567778 Lepr Rat furan increases methylation EXP 6480464 furan results in increased methylation of LEPR gene CTD PMID:22079235 Lepr Rat galactaric acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of galactaric acid CTD PMID:20567778 Lepr Rat gefitinib decreases expression ISO LEPR (Homo sapiens) 6480464 gefitinib results in decreased expression of LEPR mRNA CTD PMID:16685379 Lepr Rat genistein decreases expression ISO LEPR (Homo sapiens) 6480464 Genistein results in decreased expression of LEPR mRNA CTD PMID:26865667 Lepr Rat glucagon multiple interactions ISO Lepr (Mus musculus) 6480464 Glucagon analog inhibits the reaction [[LEPR gene mutant form results in increased oxidation of Lipids] which results in increased abundance of Thiobarbituric Acid Reactive Substances] more ... CTD PMID:29988851 Lepr Rat glucose decreases response to substance ISO Lepr (Mus musculus) 6480464 LEPR results in decreased susceptibility to Glucose CTD PMID:20567778 Lepr Rat glucose increases expression EXP 6480464 Glucose results in increased expression of LEPR protein CTD PMID:24399619 Lepr Rat glucose multiple interactions EXP 6480464 naringin inhibits the reaction [Glucose results in increased expression of LEPR protein] CTD PMID:24399619 Lepr Rat glucose multiple interactions ISO Lepr (Mus musculus) 6480464 Hesperidin affects the reaction [LEPR protein affects the abundance of Glucose] and naringin affects the reaction [LEPR protein affects the abundance of Glucose] CTD PMID:16427799 Lepr Rat glucose affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of Glucose and LEPR protein affects the abundance of Glucose CTD PMID:16427799 and PMID:20567778 Lepr Rat glutaric acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of glutaric acid CTD PMID:20567778 Lepr Rat glutathione multiple interactions EXP 6480464 LEPR gene mutant form results in increased oxidation of and results in decreased abundance of Glutathione CTD PMID:29743445 Lepr Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of LEPR mRNA CTD PMID:24915197 Lepr Rat glycine betaine multiple interactions ISO Lepr (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of LEPR mRNA CTD PMID:33549593 Lepr Rat glyphosate decreases expression ISO LEPR (Homo sapiens) 6480464 Glyphosate results in decreased expression of LEPR mRNA CTD PMID:31295307 Lepr Rat gypenoside LXXV multiple interactions ISO Lepr (Mus musculus) 6480464 gypenoside LXXV inhibits the reaction [LEPR gene mutant form results in increased expression of CCL2 protein] more ... CTD PMID:35192202 Lepr Rat harmine multiple interactions ISO Lepr (Mus musculus) 6480464 Harmine affects the reaction [LEPR protein affects the susceptibility to INS1 protein] CTD PMID:27805061 Lepr Rat hesperidin multiple interactions ISO Lepr (Mus musculus) 6480464 Hesperidin affects the reaction [LEPR protein affects the abundance of Glucose] more ... CTD PMID:16427799 Lepr Rat hexanoic acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of hexanoic acid CTD PMID:20567778 Lepr Rat high-density lipoprotein cholesterol affects abundance ISO LEPR (Homo sapiens) 6480464 LEPR polymorphism affects the abundance of Cholesterol and HDL CTD PMID:14625131 Lepr Rat hydrazine increases expression EXP 6480464 hydrazine results in increased expression of LEPR mRNA CTD PMID:15370871 Lepr Rat hydrochlorothiazide increases response to substance ISO Lepr (Mus musculus) 6480464 LEPR mutant form results in increased susceptibility to Hydrochlorothiazide CTD PMID:22949526 Lepr Rat hydrogen peroxide increases response to substance ISO Lepr (Mus musculus) 6480464 LEPR mutant form results in increased susceptibility to Hydrogen Peroxide CTD PMID:27151219 Lepr Rat indoxyl sulfate affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of Indican CTD PMID:20567778 Lepr Rat isobutyric acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of isobutyric acid CTD PMID:20567778 Lepr Rat isocaproic acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of isocaproic acid CTD PMID:20567778 Lepr Rat isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of LEPR mRNA and Isoproterenol results in increased expression of LEPR protein CTD PMID:20307649 Lepr Rat isoprenaline affects response to substance ISO Lepr (Mus musculus) 6480464 LEPR protein affects the susceptibility to Isoproterenol CTD PMID:36776448 Lepr Rat isoprenaline multiple interactions EXP 6480464 CPU0213 inhibits the reaction [Isoproterenol results in increased expression of LEPR mRNA] and CPU0213 inhibits the reaction [Isoproterenol results in increased expression of LEPR protein] CTD PMID:20307649 Lepr Rat isovaleric acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of isovaleric acid CTD PMID:20567778 Lepr Rat Jujuboside A multiple interactions ISO Lepr (Mus musculus) 6480464 jujuboside A inhibits the reaction [LEPR mutant form results in decreased expression of ACOX1 protein] more ... CTD PMID:39059604 Lepr Rat ketamine multiple interactions ISO LEPR (Homo sapiens) 6480464 lipoxin A4 methyl ester inhibits the reaction [Ketamine results in decreased expression of LEPR protein] CTD PMID:36907275 Lepr Rat ketamine decreases expression ISO LEPR (Homo sapiens) 6480464 Ketamine results in decreased expression of LEPR protein CTD PMID:36907275 Lepr Rat L-methionine affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of Methionine CTD PMID:20567778 Lepr Rat L-methionine multiple interactions ISO Lepr (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of LEPR mRNA more ... CTD PMID:20938992 more ... Lepr Rat lead diacetate decreases expression ISO LEPR (Homo sapiens) 6480464 lead acetate results in decreased expression of LEPR mRNA CTD PMID:38568856 Lepr Rat lipopolysaccharide multiple interactions EXP 6480464 Lipopolysaccharides inhibits the reaction [Thioacetamide results in decreased expression of LEPR mRNA] CTD PMID:17621560 Lepr Rat LY294002 multiple interactions ISO Lepr (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [LEPR gene mutant form results in decreased expression of SOD2 protein] more ... CTD PMID:23159718 Lepr Rat malonic acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of malonic acid CTD PMID:20567778 Lepr Rat mercury atom decreases expression ISO LEPR (Homo sapiens) 6480464 Mercury results in decreased expression of LEPR mRNA CTD PMID:16823088 Lepr Rat mercury(0) decreases expression ISO LEPR (Homo sapiens) 6480464 Mercury results in decreased expression of LEPR mRNA CTD PMID:16823088 Lepr Rat methylmalonic acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of Methylmalonic Acid CTD PMID:20567778 Lepr Rat methylmercury chloride decreases expression ISO LEPR (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of LEPR mRNA CTD PMID:23179753 Lepr Rat methylmercury chloride affects expression ISO Lepr (Mus musculus) 6480464 methylmercuric chloride affects the expression of LEPR mRNA CTD PMID:33338554 Lepr Rat methylmercury chloride increases expression ISO LEPR (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of LEPR mRNA CTD PMID:28001369 Lepr Rat metyrapone increases expression EXP 10412034 Metyrapone increases Lepr mRNA expression in placenta RGD Lepr Rat mifepristone decreases expression EXP 6480464 Mifepristone results in decreased expression of LEPR mRNA CTD PMID:25972201 Lepr Rat MK-2206 multiple interactions ISO Lepr (Mus musculus) 6480464 LEPR affects the reaction [MK 2206 results in decreased phosphorylation of AKT1 protein] CTD PMID:22949526 Lepr Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Lepr (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of LEPR mRNA CTD PMID:36189433 Lepr Rat morphine increases expression ISO Lepr (Mus musculus) 6480464 Morphine results in increased expression of LEPR mRNA CTD PMID:20144693 Lepr Rat N-[3-(aminomethyl)benzyl]acetamidine increases response to substance EXP 6480464 LEPR gene mutant form results in increased susceptibility to N-(3-(aminomethyl)benzyl)acetamidine CTD PMID:30689673 Lepr Rat N-ethyl-N-nitrosourea increases mutagenesis ISO Lepr (Mus musculus) 6480464 Ethylnitrosourea results in increased mutagenesis of LEPR gene CTD PMID:16724327 Lepr Rat N-methyl-6-pyridone-3-carboxamide affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of N'-methyl-2-pyridone-5-carboxamide CTD PMID:20567778 Lepr Rat N-methylnicotinate affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of trigonelline CTD PMID:20567778 Lepr Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of LEPR mRNA and [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of LEPR mRNA CTD PMID:17602206 and PMID:18164116 Lepr Rat N-nitrosodiethylamine multiple interactions ISO Lepr (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in decreased expression of LEPR mRNA CTD PMID:24535843 Lepr Rat N-nitrosodiethylamine increases expression ISO Lepr (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of LEPR mRNA CTD PMID:24535843 Lepr Rat naringin multiple interactions ISO Lepr (Mus musculus) 6480464 naringin affects the reaction [LEPR protein affects the abundance of Glucose] more ... CTD PMID:16427799 Lepr Rat naringin multiple interactions EXP 6480464 naringin inhibits the reaction [Glucose results in increased expression of LEPR protein] CTD PMID:24399619 Lepr Rat nickel atom decreases expression ISO LEPR (Homo sapiens) 6480464 Nickel results in decreased expression of LEPR mRNA CTD PMID:24768652 Lepr Rat nickel atom multiple interactions EXP 6480464 [nickel sulfate results in increased abundance of Nickel] which results in increased expression of LEPR mRNA CTD PMID:31734292 Lepr Rat nickel sulfate multiple interactions EXP 6480464 [nickel sulfate results in increased abundance of Nickel] which results in increased expression of LEPR mRNA CTD PMID:31734292 Lepr Rat Nicotinamide N-oxide affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of nicotinamide N-oxide CTD PMID:20567778 Lepr Rat nicotine increases expression EXP 6480464 Nicotine results in increased expression of LEPR mRNA CTD PMID:22265867 Lepr Rat nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of LEPR mRNA CTD PMID:29155039 Lepr Rat nicotinic acid multiple interactions ISO Lepr (Mus musculus) 6480464 LEPR gene mutant form promotes the reaction [[Niacin binds to Chromium] which results in decreased expression of BTC mRNA] more ... CTD PMID:16940432 Lepr Rat orotic acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of Orotic Acid CTD PMID:20567778 Lepr Rat ozone multiple interactions ISO Lepr (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of LEPR mRNA more ... CTD PMID:16373670 more ... Lepr Rat ozone multiple interactions ISO LEPR (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of and results in increased oxidation of LEPR mRNA more ... CTD PMID:32699268 and PMID:32845096 Lepr Rat ozone decreases expression EXP 6480464 Ozone results in decreased expression of LEPR mRNA CTD PMID:26667333 Lepr Rat ozone increases response to substance ISO Lepr (Mus musculus) 6480464 LEPR gene mutant form results in increased susceptibility to Ozone CTD PMID:16373670 Lepr Rat paracetamol decreases expression ISO Lepr (Mus musculus) 6480464 Acetaminophen results in decreased expression of LEPR mRNA CTD PMID:29246445 Lepr Rat paracetamol multiple interactions ISO Lepr (Mus musculus) 6480464 PANX1 gene mutant form inhibits the reaction [Acetaminophen results in decreased expression of LEPR mRNA] CTD PMID:29246445 Lepr Rat PCB138 multiple interactions ISO Lepr (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Lepr Rat pentanal decreases expression ISO LEPR (Homo sapiens) 6480464 pentanal results in decreased expression of LEPR mRNA CTD PMID:26079696 Lepr Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Lepr (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of LEPR mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of LEPR mRNA CTD PMID:36331819 Lepr Rat perfluorooctanoic acid increases expression ISO Lepr (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of LEPR mRNA CTD PMID:17681415 Lepr Rat perfluorooctanoic acid increases expression ISO LEPR (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of LEPR mRNA CTD PMID:36326898 Lepr Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of LEPR mRNA CTD PMID:35163327 Lepr Rat phenformin increases response to substance EXP 6480464 LEPR gene mutant form results in increased susceptibility to Phenformin CTD PMID:29743445 Lepr Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of LEPR mRNA CTD PMID:22008536 Lepr Rat phenobarbital affects expression ISO Lepr (Mus musculus) 6480464 Phenobarbital affects the expression of LEPR mRNA CTD PMID:23091169 Lepr Rat phenobarbital multiple interactions ISO Lepr (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in decreased expression of LEPR mRNA CTD PMID:24535843 Lepr Rat phenylmercury acetate increases expression ISO LEPR (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of LEPR mRNA CTD PMID:26272509 Lepr Rat phenylmercury acetate multiple interactions ISO LEPR (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LEPR mRNA CTD PMID:27188386 Lepr Rat pioglitazone increases response to substance EXP 6480464 LEPR gene mutant form results in increased susceptibility to Pioglitazone CTD PMID:29743445 Lepr Rat pioglitazone multiple interactions ISO Lepr (Mus musculus) 6480464 Pioglitazone inhibits the reaction [LEPR protein affects the expression of OGG1 protein] and Pioglitazone inhibits the reaction [LEPR protein affects the expression of XRCC1 protein] CTD PMID:35472412 Lepr Rat pirimicarb multiple interactions EXP 6480464 [2-amino-3-chloro-1 and 4-naphthoquinone co-treated with Ziram co-treated with cyromazine co-treated with 2-methyl-4-chlorophenoxy gamma-butyric acid co-treated with pirimicarb co-treated with Thiram] results in decreased expression of LEPR mRNA CTD PMID:29321614 Lepr Rat pirinixic acid multiple interactions ISO LEPR (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of LEPR mRNA CTD PMID:19710929 Lepr Rat pirinixic acid increases expression ISO Lepr (Mus musculus) 6480464 pirinixic acid results in increased expression of LEPR mRNA CTD PMID:18301758 more ... Lepr Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of LEPR mRNA CTD PMID:19162173 Lepr Rat progesterone multiple interactions ISO LEPR (Homo sapiens) 6480464 LEPR protein affects the reaction [LEP protein inhibits the reaction [8-Bromo Cyclic Adenosine Monophosphate results in increased chemical synthesis of Progesterone]] CTD PMID:19849856 Lepr Rat propranolol increases expression EXP 6480464 Propranolol results in increased expression of LEPR mRNA CTD PMID:24250662 Lepr Rat pyrethrins decreases expression EXP 6480464 Pyrethrins results in decreased expression of LEPR protein CTD PMID:34896426 Lepr Rat quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [Fructose results in increased expression of and results in increased phosphorylation of LEPR protein] CTD PMID:22426011 Lepr Rat quercetin increases expression ISO LEPR (Homo sapiens) 6480464 Quercetin results in increased expression of LEPR mRNA and Quercetin results in increased expression of LEPR protein CTD PMID:22230496 Lepr Rat rac-lactic acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of Lactic Acid CTD PMID:20567778 Lepr Rat raloxifene affects expression EXP 1581837 Raloxifene decreases Lepr protein expression in adipose tissue at 7 weeks and increases it at 22 weeks RGD Lepr Rat razoxane decreases expression EXP 6480464 Razoxane results in decreased expression of LEPR mRNA CTD PMID:19915844 Lepr Rat resveratrol multiple interactions ISO Lepr (Mus musculus) 6480464 Resveratrol inhibits the reaction [Dietary Fats results in increased expression of LEPR mRNA] more ... CTD PMID:19478208 and PMID:31881177 Lepr Rat riddelliine increases expression EXP 6480464 riddelliine results in increased expression of LEPR mRNA CTD PMID:18047727 Lepr Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of LEPR mRNA CTD PMID:28374803 Lepr Rat rutin multiple interactions EXP 6480464 Rutin inhibits the reaction [Fructose results in increased expression of and results in increased phosphorylation of LEPR protein] CTD PMID:22426011 Lepr Rat SB 203580 affects response to substance ISO Lepr (Mus musculus) 6480464 LEPR protein affects the susceptibility to SB 203580 CTD PMID:22933112 Lepr Rat SB 431542 multiple interactions ISO LEPR (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LEPR mRNA CTD PMID:27188386 Lepr Rat SB 431542 multiple interactions ISO Lepr (Mus musculus) 6480464 4-(5-benzo(1 more ... CTD PMID:23159718 Lepr Rat silicon dioxide decreases expression ISO LEPR (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of LEPR mRNA CTD PMID:25895662 Lepr Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of LEPR mRNA CTD PMID:32721576 Lepr Rat simvastatin affects response to substance ISO LEPR (Homo sapiens) 6480464 LEPR polymorphism affects the susceptibility to Simvastatin CTD PMID:14625131 and PMID:18854995 Lepr Rat sodium arsenite multiple interactions ISO Lepr (Mus musculus) 6480464 LEPR gene mutant form inhibits the reaction [sodium arsenite results in increased abundance of Blood Glucose] more ... CTD PMID:25367288 Lepr Rat sodium arsenite increases expression ISO Lepr (Mus musculus) 6480464 sodium arsenite results in increased expression of LEPR mRNA CTD PMID:37682722 Lepr Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of LEPR mRNA CTD PMID:25993096 Lepr Rat streptozocin multiple interactions ISO Lepr (Mus musculus) 6480464 [Streptozocin co-treated with Dietary Fats] results in increased expression of LEPR mRNA CTD PMID:29127188 Lepr Rat succinic acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of Succinic Acid CTD PMID:20567778 Lepr Rat sucrose affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of Sucrose CTD PMID:20567778 Lepr Rat sulforaphane decreases expression ISO Lepr (Mus musculus) 6480464 sulforaphane results in decreased expression of LEPR mRNA CTD PMID:30529165 Lepr Rat sulforaphane affects response to substance ISO Lepr (Mus musculus) 6480464 LEPR protein affects the susceptibility to sulforaphane CTD PMID:29143802 Lepr Rat sulforaphane multiple interactions ISO Lepr (Mus musculus) 6480464 [LEPR protein affects the susceptibility to sulforaphane] which affects the expression of CNR2 protein CTD PMID:29143802 Lepr Rat superoxide multiple interactions ISO Lepr (Mus musculus) 6480464 acetovanillone inhibits the reaction [LEPR gene mutant form results in increased abundance of Superoxides] and resveratrol inhibits the reaction [LEPR gene mutant form results in increased abundance of Superoxides] CTD PMID:19478208 Lepr Rat superoxide increases abundance ISO Lepr (Mus musculus) 6480464 LEPR gene mutant form results in increased abundance of Superoxides CTD PMID:19478208 Lepr Rat tacrine increases expression EXP 6480464 Tacrine results in increased expression of LEPR mRNA CTD PMID:12832660 Lepr Rat taurine affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of Taurine CTD PMID:20567778 Lepr Rat telmisartan multiple interactions ISO Lepr (Mus musculus) 6480464 Telmisartan affects the reaction [LEPR protein affects the abundance of ALB protein] and Telmisartan affects the reaction [LEPR protein affects the expression of OCLN mRNA] CTD PMID:34464088 Lepr Rat testosterone affects abundance EXP 6480464 LEPR protein affects the abundance of Testosterone CTD PMID:15093691 Lepr Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in decreased expression of LEPR mRNA CTD PMID:32741896 Lepr Rat tetrachloromethane multiple interactions EXP 6480464 Drugs and Chinese Herbal inhibits the reaction [[Carbon Tetrachloride co-treated with Ethanol] results in increased expression of LEPR protein] CTD PMID:18227024 Lepr Rat tetrachloromethane increases expression ISO Lepr (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of LEPR mRNA CTD PMID:31919559 Lepr Rat tetraphene multiple interactions ISO Lepr (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of LEPR mRNA CTD PMID:27858113 Lepr Rat thioacetamide multiple interactions EXP 6480464 LEPR gene mutant form inhibits the reaction [Thioacetamide results in increased expression of TGFB1 mRNA] more ... CTD PMID:11984526 and PMID:17621560 Lepr Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of LEPR mRNA and Thioacetamide results in decreased expression of LEPR protein CTD PMID:17621560 more ... Lepr Rat thiram multiple interactions EXP 6480464 [2-amino-3-chloro-1 and 4-naphthoquinone co-treated with Ziram co-treated with cyromazine co-treated with 2-methyl-4-chlorophenoxy gamma-butyric acid co-treated with pirimicarb co-treated with Thiram] results in decreased expression of LEPR mRNA CTD PMID:29321614 Lepr Rat titanium dioxide decreases expression ISO Lepr (Mus musculus) 6480464 titanium dioxide results in decreased expression of LEPR mRNA CTD PMID:23557971 Lepr Rat titanium dioxide decreases methylation ISO Lepr (Mus musculus) 6480464 titanium dioxide results in decreased methylation of LEPR gene CTD PMID:35295148 Lepr Rat titanium dioxide increases expression ISO Lepr (Mus musculus) 6480464 titanium dioxide results in increased expression of LEPR mRNA CTD PMID:35295148 Lepr Rat topotecan affects response to substance ISO LEPR (Homo sapiens) 6480464 LEPR protein affects the susceptibility to Topotecan CTD PMID:16217747 Lepr Rat tremolite asbestos decreases expression ISO Lepr (Mus musculus) 6480464 tremolite results in decreased expression of LEPR mRNA CTD PMID:29279043 Lepr Rat tributylstannane decreases expression ISO Lepr (Mus musculus) 6480464 tributyltin results in decreased expression of LEPR mRNA CTD PMID:31939706 Lepr Rat trichloroethene increases expression ISO Lepr (Mus musculus) 6480464 Trichloroethylene results in increased expression of LEPR mRNA CTD PMID:25549359 Lepr Rat trichostatin A decreases expression ISO LEPR (Homo sapiens) 6480464 trichostatin A results in decreased expression of LEPR and trichostatin A results in decreased expression of LEPR mRNA CTD PMID:22560341 and PMID:24935251 Lepr Rat trimellitic anhydride decreases expression ISO Lepr (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of LEPR mRNA CTD PMID:19042947 Lepr Rat triphenyl phosphate multiple interactions ISO Lepr (Mus musculus) 6480464 [tris(1 more ... CTD PMID:29112739 and PMID:32360330 Lepr Rat triphenyl phosphate affects expression ISO LEPR (Homo sapiens) 6480464 triphenyl phosphate affects the expression of LEPR mRNA CTD PMID:37042841 Lepr Rat Triptolide decreases expression ISO Lepr (Mus musculus) 6480464 triptolide results in decreased expression of LEPR mRNA CTD PMID:32835833 Lepr Rat triptonide increases expression ISO Lepr (Mus musculus) 6480464 triptonide results in increased expression of LEPR mRNA CTD PMID:33045310 Lepr Rat troglitazone increases response to substance EXP 6480464 LEPR gene mutant form results in increased susceptibility to Troglitazone CTD PMID:29743445 Lepr Rat urea increases abundance ISO Lepr (Mus musculus) 6480464 LEPR gene mutant form results in increased abundance of Urea CTD PMID:29988851 and PMID:36066211 Lepr Rat urea multiple interactions ISO Lepr (Mus musculus) 6480464 Glucagon analog inhibits the reaction [LEPR gene mutant form results in increased abundance of Urea] and swietenine inhibits the reaction [LEPR gene mutant form results in increased abundance of Urea] CTD PMID:29988851 and PMID:36066211 Lepr Rat valeric acid affects abundance ISO Lepr (Mus musculus) 6480464 LEPR affects the abundance of n-pentanoic acid CTD PMID:20567778 Lepr Rat valproic acid increases expression ISO Lepr (Mus musculus) 6480464 Valproic Acid results in increased expression of LEPR mRNA CTD PMID:24489787 Lepr Rat valproic acid decreases expression ISO LEPR (Homo sapiens) 6480464 Valproic Acid results in decreased expression of LEPR mRNA CTD PMID:23179753 more ... Lepr Rat valproic acid affects expression ISO LEPR (Homo sapiens) 6480464 Valproic Acid affects the expression of LEPR mRNA CTD PMID:25979313 Lepr Rat zinc atom multiple interactions EXP 6480464 [LEPR gene mutant form results in increased susceptibility to Ethanol] which results in decreased abundance of Zinc CTD PMID:15475485 Lepr Rat zinc atom multiple interactions ISO Lepr (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of LEPR mRNA and [Zinc deficiency co-treated with Ethanol] results in increased expression of LEPR mRNA CTD PMID:24155903 and PMID:33549593 Lepr Rat zinc(0) multiple interactions EXP 6480464 [LEPR gene mutant form results in increased susceptibility to Ethanol] which results in decreased abundance of Zinc CTD PMID:15475485 Lepr Rat zinc(0) multiple interactions ISO Lepr (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of LEPR mRNA and [Zinc deficiency co-treated with Ethanol] results in increased expression of LEPR mRNA CTD PMID:24155903 and PMID:33549593 Lepr Rat ziram multiple interactions EXP 6480464 [2-amino-3-chloro-1 and 4-naphthoquinone co-treated with Ziram co-treated with cyromazine co-treated with 2-methyl-4-chlorophenoxy gamma-butyric acid co-treated with pirimicarb co-treated with Thiram] results in decreased expression of LEPR mRNA CTD PMID:29321614
Imported Annotations - KEGG (archival)
Albuminuria (ISO) Animal Disease Models (ISO) arteriosclerosis (ISO) bone disease (ISO) Breast Neoplasms (ISO) cardiomyopathy (ISO) Chronic Hepatitis B (ISO) Chronic Hepatitis C (ISO) chronic kidney disease (IMP) chronic obstructive pulmonary disease (ISO) cognitive disorder (ISO) congenital disorder of glycosylation It (ISO) congenital leptin deficiency (ISO) congestive heart failure (IAGP,ISO) coronary artery disease (ISO) Coronary Disease (ISO) Delayed Puberty (ISO) diabetes mellitus (ISO) Diabetic Cardiomyopathies (ISO) Diabetic Nephropathies (IAGP,ISO) diabetic neuropathy (ISO) Diastolic Dysfunction (IAGP) diastolic heart failure (IAGP) dilated cardiomyopathy (ISO) Dyslipidemias (IMP,ISO) Experimental Diabetes Mellitus (ISO) Experimental Liver Cirrhosis (IEP) familial hyperlipidemia (ISO) Female Infertility (ISO) Fibrosis (ISO) genetic disease (ISO) gestational diabetes (ISO) Gliosis (ISO) glucose intolerance (IMP,ISO) granulosa cell tumor (ISO) hepatocellular carcinoma (ISO) hepatocellular clear cell carcinoma (ISO) Hepatomegaly (ISO) human immunodeficiency virus infectious disease (ISO) Hyperalgesia (ISO) hyperglycemia (IMP,ISO) hyperinsulinism (IMP,ISO) Hyperphagia (IAGP,IMP,ISO) hypertension (IAGP,IMP,ISO) hypogonadism (ISO) infertility (ISO) inherited metabolic disorder (ISO) Insulin Resistance (IAGP,ISO) intellectual disability (ISO) kidney disease (ISO) kidney failure (ISO) Knee Osteoarthritis (ISO) Left Ventricular Hypertrophy (IMP) Leptin Receptor Deficiency (ISO) metabolic dysfunction-associated steatohepatitis (ISO) metabolic dysfunction-associated steatotic liver disease (ISO,ISS) Metabolic Syndrome (IAGP) morbid obesity (ISO) Myocardial Ischemia (ISO) Myocardial Reperfusion Injury (IEP) Nasal Polyps (ISO) nephritis (ISO) obesity (IAGP,IMP,ISO,ISS) obstructive sleep apnea (ISO) osteoporosis (ISO) Overweight (ISO) pancreas disease (ISO) pancreatitis (IAGP) pituitary gland disease (ISO) Pneumococcal Pneumonia (ISO) pre-eclampsia (IEP) Precocious Puberty (ISO) primary biliary cholangitis (ISO) primary immunodeficiency disease (ISO) primary ovarian insufficiency (ISO) proteinuria (IAGP,IMP,ISO) pulmonary fibrosis (ISO) pulmonary hypertension (ISO) renal fibrosis (IMP) Respiratory Tract Infections (ISO) Right Ventricular Hypertrophy (ISO) short bowel syndrome (IEP) sleep apnea (ISO) Spinal Fractures (ISO) steatotic liver disease (ISO) type 2 diabetes mellitus (IAGP,ISO,ISS) Varicose Ulcer (ISO) Ventricular Dysfunction, Left (ISO) Weight Gain (ISO)
(1->4)-beta-D-glucan (ISO) (N(omega)-L-arginino)succinic acid (ISO) (R)-carnitine (ISO) (R)-pantothenic acid (ISO) (S)-nicotine (EXP) 1,2-dichloroethane (ISO) 1-methylnicotinamide (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-amino-2-deoxy-D-galactopyranose (ISO) 2-amino-2-deoxy-D-glucopyranose (EXP) 2-hydroxy-4-methylvaleric acid (ISO) 2-hydroxyisobutyric acid (ISO) 2-hydroxypropanoic acid (ISO) 2-methyl-4-chlorophenoxybutyric acid (EXP) 2-oxoadipic acid (ISO) 3-methyl-2-oxobutanoic acid (ISO) 3-methyl-2-oxovaleric acid (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxy-TEMPO (ISO) 4-phenylbutyric acid (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) 7,9-dihydro-1H-purine-2,6,8(3H)-trione (ISO) 8-Br-cAMP (ISO) acetamide (EXP) acetohydrazide (ISO) acetylcholine (ISO) acrolein (ISO) aflatoxin B1 (EXP,ISO) aldehydo-D-glucosamine (EXP) aldehydo-D-glucose (EXP,ISO) all-trans-retinoic acid (ISO) allantoin (ISO) allethrin (EXP) allopurinol (EXP) alpha-pinene (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) anthra[1,9-cd]pyrazol-6(2H)-one (ISO) apocynin (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) astaxanthin (ISO) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (ISO) beta-D-glucosamine (EXP) beta-naphthoflavone (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bromodichloromethane (ISO) butanal (ISO) butyric acid (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (EXP) calcium atom (EXP) calcium(0) (EXP) captopril (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloroquine (ISO) chlorpyrifos (ISO) cholesterol (ISO) choline (ISO) chromium atom (ISO) chrysene (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) citric acid (ISO) clofibrate (EXP) clofibric acid (EXP) coumestrol (ISO) creatinine (ISO) crocidolite asbestos (ISO) cyanocob(III)alamin (ISO) cycloheximide (ISO) cyclosporin A (ISO) cyhalothrin (EXP) cypermethrin (EXP) cyromazine (EXP) cytarabine (ISO) D-glucose (EXP,ISO) dactolisib (ISO) decabromodiphenyl ether (EXP) dexamethasone (EXP) dibenz[a,h]anthracene (ISO) dibutyl phthalate (EXP) dichloroacetic acid (ISO) diclofenac (ISO) dicrotophos (ISO) diethyl maleate (EXP) dioxygen (ISO) diquat (ISO) dobutamine (ISO) dorsomorphin (ISO) doxorubicin (ISO) Enterolactone (ISO) epoxiconazole (ISO) estrone (ISO) ethanol (EXP,ISO) ethylmalonic acid (ISO) fentin chloride (EXP) fenvalerate (EXP) flutamide (EXP) folic acid (ISO) formic acid (ISO) fructose (EXP) fumaric acid (ISO) furan (EXP) galactaric acid (ISO) gefitinib (ISO) genistein (ISO) glucagon (ISO) glucose (EXP,ISO) glutaric acid (ISO) glutathione (EXP) glycidol (EXP) glycine betaine (ISO) glyphosate (ISO) gypenoside LXXV (ISO) harmine (ISO) hesperidin (ISO) hexanoic acid (ISO) high-density lipoprotein cholesterol (ISO) hydrazine (EXP) hydrochlorothiazide (ISO) hydrogen peroxide (ISO) indoxyl sulfate (ISO) isobutyric acid (ISO) isocaproic acid (ISO) isoprenaline (EXP,ISO) isovaleric acid (ISO) Jujuboside A (ISO) ketamine (ISO) L-methionine (ISO) lead diacetate (ISO) lipopolysaccharide (EXP) LY294002 (ISO) malonic acid (ISO) mercury atom (ISO) mercury(0) (ISO) methylmalonic acid (ISO) methylmercury chloride (ISO) metyrapone (EXP) mifepristone (EXP) MK-2206 (ISO) mono(2-ethylhexyl) phthalate (ISO) morphine (ISO) N-[3-(aminomethyl)benzyl]acetamidine (EXP) N-ethyl-N-nitrosourea (ISO) N-methyl-6-pyridone-3-carboxamide (ISO) N-methylnicotinate (ISO) N-nitrosodiethylamine (EXP,ISO) naringin (EXP,ISO) nickel atom (EXP,ISO) nickel sulfate (EXP) Nicotinamide N-oxide (ISO) nicotine (EXP) nicotinic acid (ISO) orotic acid (ISO) ozone (EXP,ISO) paracetamol (ISO) PCB138 (ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) phenformin (EXP) phenobarbital (EXP,ISO) phenylmercury acetate (ISO) pioglitazone (EXP,ISO) pirimicarb (EXP) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (EXP) progesterone (ISO) propranolol (EXP) pyrethrins (EXP) quercetin (EXP,ISO) rac-lactic acid (ISO) raloxifene (EXP) razoxane (EXP) resveratrol (ISO) riddelliine (EXP) rotenone (EXP) rutin (EXP) SB 203580 (ISO) SB 431542 (ISO) silicon dioxide (EXP,ISO) simvastatin (ISO) sodium arsenite (ISO) sodium dichromate (EXP) streptozocin (ISO) succinic acid (ISO) sucrose (ISO) sulforaphane (ISO) superoxide (ISO) tacrine (EXP) taurine (ISO) telmisartan (ISO) testosterone (EXP) tetrachloromethane (EXP,ISO) tetraphene (ISO) thioacetamide (EXP) thiram (EXP) titanium dioxide (ISO) topotecan (ISO) tremolite asbestos (ISO) tributylstannane (ISO) trichloroethene (ISO) trichostatin A (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) Triptolide (ISO) triptonide (ISO) troglitazone (EXP) urea (ISO) valeric acid (ISO) valproic acid (ISO) zinc atom (EXP,ISO) zinc(0) (EXP,ISO) ziram (EXP)
Biological Process
angiogenesis (IEA,IMP,ISO,ISS) bone growth (IEA,ISO,ISS) cell surface receptor signaling pathway via STAT (IEA,ISO) cellular response to acetate (IEP) cellular response to butyrate (IEP) cholesterol metabolic process (IEA,ISO) cytokine-mediated signaling pathway (IBA,IEA) eating behavior (IMP) energy homeostasis (IEA,ISO,ISS) female pregnancy (IEP) generation of precursor metabolites and energy (NAS) glial cell proliferation (IEA,ISO) gluconeogenesis (IEA,ISO) glucose homeostasis (IEA,ISO,ISS) glycogen metabolic process (IEA,ISO) leptin-mediated signaling pathway (IDA,IEA,ISO) male gonad development (IEP) negative regulation of autophagy (IEA,ISO,ISS) negative regulation of eating behavior (IMP) negative regulation of gluconeogenesis (IEA,ISO) negative regulation of hydrolase activity (ISO) negative regulation of locomotor rhythm (IMP) ovulation from ovarian follicle (IEP) phagocytosis (IEA,ISO,ISS) positive regulation of cell population proliferation (IBA) positive regulation of cold-induced thermogenesis (IEA,ISO,ISS) positive regulation of insulin secretion involved in cellular response to glucose stimulus (IDA) positive regulation of MAPK cascade (IDA) regulation of bone remodeling (IEA,ISO,ISS) regulation of feeding behavior (IEA,ISO,ISS) regulation of transport (IEA,ISO) response to dexamethasone (IEP) response to estrogen (IEP) response to hypoxia (IEP) response to leptin (IEA,IEP,ISO) response to lipid (IEP) response to nicotine (IEP) response to nutrient (IEP) sexual reproduction (IEA,ISO,ISS) T cell differentiation (IEA,ISO,ISS)
Mammalian Phenotype
abnormal aortic valve flow (IAGP) abnormal aortic valve morphology (IAGP) abnormal collagen level (IAGP) abnormal energy expenditure (IAGP) abnormal glomerular filtration barrier morphology (IMP) abnormal heart left ventricle pressure (IAGP) abnormal oxygen consumption (IAGP) abnormal white adipose tissue mass (IAGP) albuminuria (IAGP) arteriosclerosis (IAGP) decreased bone mineral density (IMP) decreased creatinine clearance (IAGP) decreased energy expenditure (IAGP) decreased renal glomerular filtration rate (IAGP) decreased renal plasma flow rate (IAGP) decreased survivor rate (IAGP) decreased trabecular bone volume (IMP) dilated renal tubule (IAGP) expanded mesangial matrix (IAGP,IMP) glomerulosclerosis (IAGP,IMP) heart left ventricle hypertrophy (IAGP) hepatic steatosis (IAGP,IMP) hyperlipidemia (IAGP) hypertension (IAGP,IMP) impaired exercise endurance (IAGP) impaired glucose tolerance (IMP) increased blood urea nitrogen level (IAGP) increased body mass index (IAGP) increased body weight (IAGP,IMP) increased bone trabecular spacing (IMP) increased circulating alanine transaminase level (IAGP,IMP) increased circulating aspartate transaminase level (IMP) increased circulating cholesterol level (IAGP,IMP) increased circulating creatinine level (IMP) increased circulating glucose level (IAGP) increased circulating HDL cholesterol level (IMP) increased circulating insulin level (IAGP,IMP) increased circulating LDL cholesterol level (IMP) increased circulating leptin level (IAGP,IMP) increased circulating triglyceride level (IAGP,IMP) increased collagen deposition in the muscles (IAGP) increased epididymal fat pad weight (IAGP) increased fat cell size (IMP) increased fluid intake (IAGP) increased food intake (IAGP) increased gonadal fat pad weight (IAGP) increased heart left ventricle anterior wall thickness (IAGP) increased heart left ventricle weight (IAGP) increased inguinal fat pad weight (IAGP) increased left ventricle diastolic pressure (IAGP) increased mean systemic arterial blood pressure (IAGP) increased renal glomerulus basement membrane thickness (IAGP) increased renal vascular resistance (IAGP) increased retroperitoneal fat pad weight (IAGP) increased systemic arterial systolic blood pressure (IAGP,IMP) increased triglyceride level (IAGP) increased urine flow rate (IAGP) increased urine lipocalin 2 level (IAGP) increased urine microalbumin level (IAGP) increased urine protein level (IAGP,IMP) increased white adipose tissue mass (IAGP) increased white fat cell number (IAGP) insulin resistance (IMP) muscle weakness (IAGP) obese (IAGP) pancreas fibrosis (IMP) pancreas hyperplasia (IMP) podocyte foot process effacement (IMP) polyphagia (IAGP) pulmonary vascular congestion (IAGP) renal cast (IAGP) renal glomerulus fibrosis (IAGP) renal glomerulus hypertrophy (IAGP) renal interstitial fibrosis (IAGP,IMP) renal tubule atrophy (IAGP)
1.
Nicotinamide for the treatment of heart failure with preserved ejection fraction.
Abdellatif M, etal., Sci Transl Med. 2021 Feb 10;13(580):eabd7064. doi: 10.1126/scitranslmed.abd7064.
2.
Progression of pancreatitis prior to diabetes onset in WBN/Kob-Lepr(fa) rats.
Akimoto T, etal., J Vet Med Sci. 2012 Jan;74(1):65-70. Epub 2011 Aug 12.
3.
Leptin Receptor Gene Polymorphisms and the Risk of Non-Alcoholic Fatty Liver Disease and Coronary Atherosclerosis in the Chinese Han Population.
An BQ, etal., Hepat Mon. 2016 Apr 27;16(4):e35055. doi: 10.5812/hepatmon.35055. eCollection 2016 Apr.
4.
Characterization of changes in leptin and leptin receptors in a rat model of preeclampsia.
Anderson CM, etal., Am J Obstet Gynecol. 2005 Jul;193(1):267-72.
5.
Preliminary Characterization of a Leptin Receptor Knockout Rat Created by CRISPR/Cas9 System.
Bao D, etal., Sci Rep. 2015 Nov 5;5:15942. doi: 10.1038/srep15942.
6.
The genetic association database.
Becker KG, etal., Nat Genet. 2004 May;36(5):431-2.
7.
Association between variants in the genes for leptin, leptin receptor, and proopiomelanocortin with chronic heart failure in the Czech population.
Bienertova-Vasku JA, etal., Heart Vessels. 2009 Mar;24(2):131-7. Epub 2009 Apr 1.
8.
Up-regulation of blood-brain barrier short-form leptin receptor gene products in rats fed a high fat diet.
Boado RJ, etal., J Neurochem. 1998 Oct;71(4):1761-4.
9.
Generation of obese rat model by transcription activator-like effector nucleases targeting the leptin receptor gene.
Chen Y, etal., Sci China Life Sci. 2017 Feb;60(2):152-157. doi: 10.1007/s11427-016-5049-y. Epub 2016 May 25.
10.
Complete rescue of obesity, diabetes, and infertility in db/db mice by neuron-specific LEPR-B transgenes.
de Luca C, etal., J Clin Invest. 2005 Dec;115(12):3484-93. Epub 2005 Nov 10.
11.
Influence of Lys656Asn polymorphism of leptin receptor gene on insulin resistance in patients with diabetes mellitus type 2.
de Luis DA, etal., Diabetes Res Clin Pract. 2008 Sep;81(3):e9-e11. Epub 2008 Jul 15.
12.
Influence of Lys656Asn polymorphism of the leptin receptor gene on insulin resistance in nondiabetic obese patients.
de Luis DA, etal., J Diabetes Complications. 2008 May-Jun;22(3):199-204. Epub 2008 Apr 16.
13.
Leptin receptor blockade reduces intrahepatic vascular resistance and portal pressure in an experimental model of rat liver cirrhosis.
Delgado MG, etal., Am J Physiol Gastrointest Liver Physiol. 2013 Oct 1;305(7):G496-502. doi: 10.1152/ajpgi.00336.2012. Epub 2013 Jul 25.
14.
Leptin modulates the expression of its receptors in the hypothalamic-pituitary-ovarian axis in a differential way.
Di Yorio MP, etal., J Endocrinol. 2008 Aug;198(2):355-66. Epub 2008 May 30.
15.
High resolution molecular and histological analysis of renal disease progression in ZSF1 fa/faCP rats, a model of type 2 diabetic nephropathy.
Dower K, etal., PLoS One. 2017 Jul 26;12(7):e0181861. doi: 10.1371/journal.pone.0181861. eCollection 2017.
16.
Leptin receptor genotype at Gln223Arg is associated with body composition, BMD, and vertebral fracture in postmenopausal Danish women.
Fairbrother UL, etal., J Bone Miner Res. 2007 Apr;22(4):544-50.
17.
Clinical and molecular genetic spectrum of congenital deficiency of the leptin receptor.
Farooqi IS, etal., N Engl J Med. 2007 Jan 18;356(3):237-47.
18.
Leptin inhibits angiotensin II-induced intracellular calcium increase and vasoconstriction in the rat aorta.
Fortuno A, etal., Endocrinology 2002 Sep;143(9):3555-60.
19.
ObRa and ObRe are differentially expressed in adipose tissue in aged food-restricted rats: effects on circulating soluble leptin receptor levels.
Gallardo N, etal., Endocrinology. 2005 Nov;146(11):4934-42. Epub 2005 Jul 21.
20.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
21.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
22.
Evidence that the caudal brainstem is a target for the inhibitory effect of leptin on food intake.
Grill HJ, etal., Endocrinology 2002 Jan;143(1):239-46.
23.
Leptin receptor polymorphisms and lung function decline in COPD.
Hansel NN, etal., Eur Respir J. 2009 Jul;34(1):103-10. Epub 2009 Feb 5.
24.
Characterization of a new animal model of metabolic syndrome: the DahlS.Z-Lepr(fa)/Lepr(fa) rat.
Hattori T, etal., Nutr Diabetes. 2011 Jan 31;1:e1. doi: 10.1038/nutd.2010.1.
25.
Leptin potentiates thermogenic sympathetic responses to hypothermia: a receptor-mediated effect.
Hausberg M, etal., Diabetes. 2002 Aug;51(8):2434-40.
26.
41-Week Study of Progressive Diabetic Nephropathy in the ZSF1 fa/faCP Rat Model.
Homer BL and Dower K, Toxicol Pathol. 2018 Dec;46(8):976-977. doi: 10.1177/0192623318803278. Epub 2018 Oct 3.
27.
Leptin receptor signaling in midbrain dopamine neurons regulates feeding.
Hommel JD, etal., Neuron. 2006 Sep 21;51(6):801-10.
28.
Attenuation of leptin and insulin signaling by SOCS proteins.
Howard JK and Flier JS, Trends Endocrinol Metab. 2006 Nov;17(9):365-71. Epub 2006 Sep 28.
29.
Modulation of circulating leptin levels by its soluble receptor.
Huang L, etal., J Biol Chem 2001 Mar 2;276(9):6343-9.
30.
Substitution at codon 269 (glutamine --> proline) of the leptin receptor (OB-R) cDNA is the only mutation found in the Zucker fatty (fa/fa) rat.
Iida M, etal., Biochem Biophys Res Commun 1996 Jul 16;224(2):597-604.
31.
Phenotype-linked amino acid alteration in leptin receptor cDNA from Zucker fatty (fa/fa) rat.
Iida M, etal., Biochem Biophys Res Commun 1996 May 6;222(1):19-26.
32.
Altered hypothalamic leptin, insulin, and melanocortin binding associated with moderate-fat diet and predisposition to obesity.
Irani BG, etal., Endocrinology. 2007 Jan;148(1):310-6. Epub 2006 Oct 5.
33.
Prevention of leptin binding to its receptor suppresses rat leukemic cell growth by inhibiting angiogenesis.
Iversen PO, etal., Blood 2002 Dec 1;100(12):4123-8.
34.
Leptin Promotes Fibroproliferative ARDS by Inhibiting Peroxisome Proliferator-activated Receptor-{gamma}
Jain M, etal., Am J Respir Crit Care Med. 2011 Feb 11.
35.
Nicotine administration decreases neuropeptide Y expression and increases leptin receptor expression in the hypothalamus of food-deprived rats.
Jang MH, etal., Brain Res. 2003 Feb 28;964(2):311-5.
36.
Endogenous leptin receptor signaling in the medial nucleus tractus solitarius affects meal size and potentiates intestinal satiation signals.
Kanoski SE, etal., Am J Physiol Endocrinol Metab. 2012 Aug 15;303(4):E496-503. doi: 10.1152/ajpendo.00205.2012. Epub 2012 Jun 12.
37.
Diet-induced obesity in mice reduces the maintenance of influenza-specific CD8+ memory T cells.
Karlsson EA, etal., J Nutr. 2010 Sep;140(9):1691-7. Epub 2010 Jun 30.
38.
Genes unlinked to the leptin receptor influence urinary albumin excretion in obese Zucker rats.
Kim K, etal., Physiol Genomics. 2010 Feb 16.
39.
Immunohistochemical analysis of tau phosphorylation and astroglial activation with enhanced leptin receptor expression in diet-induced obesity mouse hippocampus.
Koga S, etal., Neurosci Lett. 2014 Jun 13;571:11-6. doi: 10.1016/j.neulet.2014.04.028. Epub 2014 Apr 28.
40.
Fat diet affects leptin receptor levels in the rat cerebellum.
Koros C, etal., Nutrition. 2009 Jan;25(1):85-7. Epub 2008 Aug 27.
41.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
42.
Suppression of leptin receptor messenger ribonucleic acid and leptin responsiveness in the ventromedial nucleus of the hypothalamus during pregnancy in the rat.
Ladyman SR and Grattan DR, Endocrinology. 2005 Sep;146(9):3868-74. Epub 2005 May 19.
43.
Liporegulation in diet-induced obesity. The antisteatotic role of hyperleptinemia.
Lee Y, etal., J Biol Chem 2001 Feb 23;276(8):5629-35.
44.
Leptin receptor isoform expression in rat osteoblasts and their functional analysis.
Lee YJ, etal., FEBS Lett 2002 Sep 25;528(1-3):43-7.
45.
Role of leptin receptor (LEPR) gene polymorphisms and haplotypes in susceptibility to hepatocellular carcinoma in subjects with chronic hepatitis B virus infection.
Li Z, etal., Mol Diagn Ther. 2012 Dec;16(6):383-8. doi: 10.1007/s40291-012-0008-1.
46.
A possible role of neuropeptide Y, agouti-related protein and leptin receptor isoforms in hypothalamic programming by perinatal feeding in the rat.
Lopez M, etal., Diabetologia. 2005 Jan;48(1):140-8. Epub 2004 Dec 23.
47.
Polymorphism of human leptin receptor gene is associated with type 2 diabetic patients complicated with non-alcoholic fatty liver disease in China.
Lu H, etal., J Gastroenterol Hepatol. 2009 Feb;24(2):228-32. Epub 2008 Aug 17.
48.
[Association of single nucleotide polymorphisms (SNPs) in leptin receptor gene with knee osteoarthritis in the Ningxia Hui population].
Ma XJ, etal., Yi Chuan. 2013 Mar;35(3):359-64.
49.
Disruption of leptin receptor-STAT3 signaling enhances leukotriene production and pulmonary host defense against pneumococcal pneumonia.
Mancuso P, etal., J Immunol. 2011 Jan 15;186(2):1081-90. Epub 2010 Dec 10.
50.
Soluble leptin receptor and insulin resistance as determinant of sleep apnea.
Manzella D, etal., Int J Obes Relat Metab Disord. 2002 Mar;26(3):370-5.
51.
Association of fat cell size and paracrine growth factors in development of hyperplastic obesity.
Marques BG, etal., Am J Physiol 1998 Dec;275(6 Pt 2):R1898-908.
52.
Impaired response of UCP family to cold exposure in diabetic (db/db) mice.
Masaki T, etal., Am J Physiol Regul Integr Comp Physiol. 2000 Oct;279(4):R1305-9. doi: 10.1152/ajpregu.2000.279.4.R1305.
53.
Ischemia/reperfusion in rat heart induces leptin and leptin receptor gene expression.
Matsui H, etal., Life Sci. 2007 Jan 23;80(7):672-80. Epub 2006 Nov 10.
54.
Leptin signalling reduces the severity of cardiac dysfunction and remodelling after chronic ischaemic injury.
McGaffin KR, etal., Cardiovasc Res. 2008 Jan;77(1):54-63. Epub 2007 Sep 20.
55.
Early development of podocyte injury independently of hyperglycemia and elevations in arterial pressure in nondiabetic obese Dahl SS leptin receptor mutant rats.
McPherson KC, etal., Am J Physiol Renal Physiol. 2016 Oct 1;311(4):F793-F804. doi: 10.1152/ajprenal.00590.2015. Epub 2016 Jul 27.
56.
Estrogen and raloxifene modulate leptin and its receptor in hypothalamus and adipose tissue from ovariectomized rats.
Meli R, etal., Endocrinology. 2004 Jul;145(7):3115-21. Epub 2004 Apr 1.
57.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
58.
Leptin receptors are developmentally regulated in rat pituitary and hypothalamus.
Morash BA, etal., Mol Cell Endocrinol. 2003 Nov 28;210(1-2):1-8.
59.
A short form of leptin receptor performs signal transduction.
Murakami T, etal., Biochem Biophys Res Commun. 1997 Feb 3;231(1):26-9.
60.
Polymorphism of the 3'-untranslated region of the leptin receptor gene, but not the adiponectin SNP45 polymorphism, predicts type 2 diabetes: a population-based study.
Nannipieri M, etal., Diabetes Care. 2006 Nov;29(11):2509-11.
61.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
62.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
63.
Potential role of leptin in angiogenesis: leptin induces endothelial cell proliferation and expression of matrix metalloproteinases in vivo and in vitro.
Park HY, etal., Exp Mol Med. 2001 Jun 30;33(2):95-102.
64.
Induction of specific microRNAs inhibits cutaneous wound healing.
Pastar I, etal., J Biol Chem. 2012 Aug 24;287(35):29324-35. doi: 10.1074/jbc.M112.382135. Epub 2012 Jul 6.
65.
Leptin receptor missense mutation in the fatty Zucker rat.
Phillips MS, etal., Nat Genet 1996 May;13(1):18-9.
66.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
67.
Frequency of distribution of leptin receptor gene polymorphism in obstructive sleep apnea patients.
Popko K, etal., J Physiol Pharmacol. 2007 Nov;58 Suppl 5(Pt 2):551-61.
68.
Depletion of macrophages slows the early progression of renal injury in obese Dahl salt-sensitive leptin receptor mutant rats.
Poudel B, etal., Am J Physiol Renal Physiol. 2020 Jun 1;318(6):F1489-F1499. doi: 10.1152/ajprenal.00100.2020. Epub 2020 May 11.
69.
Rat heart is a site of leptin production and action.
Purdham DM, etal., Am J Physiol Heart Circ Physiol. 2004 Dec;287(6):H2877-84. Epub 2004 Jul 29.
70.
A neutralizing leptin receptor antibody mitigates hypertrophy and hemodynamic dysfunction in the postinfarcted rat heart.
Purdham DM, etal., Am J Physiol Heart Circ Physiol. 2008 Jul;295(1):H441-6. Epub 2008 May 9.
71.
The haplotype identified in LEPR gene is associated with type 2 diabetes mellitus in Northern Chinese.
Qu Y, etal., Diabetes Res Clin Pract. 2008 Jul;81(1):33-7. Epub 2008 Apr 24.
72.
GOA pipeline
RGD automated data pipeline
73.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
74.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
75.
Leptin receptor gene in a large cohort of massively obese subjects: no indication of the fa/fa rat mutation. Detection of an intronic variant with no association with obesity.
Rolland V, etal., Obes Res. 1998 Mar;6(2):122-7.
76.
Hypertension in obesity and the leptin receptor gene locus.
Rosmond R, etal., J Clin Endocrinol Metab. 2000 Sep;85(9):3126-31.
77.
Leptin and leptin receptor expression in the rat ovary.
Ryan NK, etal., Endocrinology. 2003 Nov;144(11):5006-13. Epub 2003 Aug 14.
78.
ZSF1 rat as animal model for HFpEF: Development of reduced diastolic function and skeletal muscle dysfunction.
Schauer A, etal., ESC Heart Fail. 2020 Oct;7(5):2123-2134. doi: 10.1002/ehf2.12915. Epub 2020 Jul 25.
79.
Differential role of leptin receptors at the hypothalamic paraventricular nucleus in tonic regulation of food intake and cardiovascular functions.
Shih CD, etal., J Biomed Sci. 2003 Jul-Aug;10(4):367-78.
80.
Leptin receptor expression in the rat placenta: changes in ob-ra, ob-rb, and ob-re with gestational age and suppression by glucocorticoids.
Smith JT and Waddell BJ, Biol Reprod. 2002 Oct;67(4):1204-10.
81.
Expression of leptin receptor in nasal polyps: leptin as a mucosecretagogue.
Song SY, etal., Laryngoscope. 2010 May;120(5):1046-50.
82.
Leptin as a critical regulator of hepatocellular carcinoma development through modulation of human telomerase reverse transcriptase.
Stefanou N, etal., BMC Cancer. 2010 Aug 19;10:442. doi: 10.1186/1471-2407-10-442.
83.
Leptin receptor isoforms mRNA expression in peripheral blood mononuclear cells from patients with chronic viral hepatitis.
Stefanou N, etal., Exp Biol Med (Maywood). 2006 Nov;231(10):1653-63. doi: 10.1177/153537020623101011.
84.
Hyperphagia as a mediator of renal disease initiation in obese Zucker rats.
Stevenson FT, etal., Obes Res 2001 Aug;9(8):492-9.
85.
Leptin affects intestinal epithelial cell turnover in correlation with leptin receptor expression along the villus-crypt axis after massive small bowel resection in a rat.
Sukhotnik I, etal., Pediatr Res. 2009 Dec;66(6):648-53.
86.
Association of nonalcoholic fatty liver disease with a single nucleotide polymorphism on the gene encoding leptin receptor.
Swellam M and Hamdy N, IUBMB Life. 2012 Feb;64(2):180-6. doi: 10.1002/iub.597. Epub 2012 Jan 3.
87.
Serum leptin, soluble leptin receptor, free leptin index and bone mineral density in patients with primary biliary cirrhosis.
Szalay F, etal., Eur J Gastroenterol Hepatol. 2005 Sep;17(9):923-8.
88.
Leptin receptor (Ob-R) expression is induced in peripheral blood mononuclear cells by in vitro activation and in vivo in HIV-infected patients.
Sánchez-Margalet V, etal., Clin Exp Immunol. 2002 Jul;129(1):119-24. doi: 10.1046/j.1365-2249.2002.01900.x.
89.
Nonsense mutation of leptin receptor in the obese spontaneously hypertensive Koletsky rat.
Takaya K, etal., Nat Genet. 1996 Oct;14(2):130-1.
90.
Characterization of bone structure in leptin receptor-deficient Zucker (fa/fa) rats.
Tamasi JA, etal., J Bone Miner Res. 2003 Sep;18(9):1605-11.
91.
Developmental and hormonal regulation of leptin receptor (Ob-R) messenger ribonucleic acid expression in rat testis.
Tena-Sempere M, etal., Biol Reprod. 2001 Feb;64(2):634-43.
92.
Renal function and structure in diabetic, hypertensive, obese ZDFxSHHF-hybrid rats.
Tofovic SP, etal., Ren Fail. 2000;22(4):387-406. doi: 10.1081/jdi-100100882.
93.
Specific increase in leptin production in obese (falfa) rat adipose cells.
Turban S, etal., Biochem J 2002 Feb 15;362(Pt 1):113-8.
94.
Overexpression of leptin receptors in pancreatic islets of Zucker diabetic fatty rats restores GLUT-2, glucokinase, and glucose-stimulated insulin secretion.
Wang MY, etal., Proc Natl Acad Sci U S A. 1998 Sep 29;95(20):11921-6.
95.
Study of the association of 17 lipid-related gene polymorphisms with coronary heart disease.
Wu N, etal., Anatol J Cardiol. 2018 Jun;19(6):360-367. doi: 10.14744/AnatolJCardiol.2018.23682.
96.
Phenotype of the obese Koletsky (f) rat due to Tyr763Stop mutation in the extracellular domain of the leptin receptor (Lepr): evidence for deficient plasma-to-CSF transport of leptin in both the Zucker and Koletsky obese rat.
Wu-Peng XS, etal., Diabetes. 1997 Mar;46(3):513-8.
97.
Leptin receptor signal transduction: OBRa and OBRb of fa type.
Yamashita T, etal., Biochem Biophys Res Commun. 1998 May 29;246(3):752-9.
98.
Association of polymorphisms in the leptin and leptin receptor genes with inflammatory mediators in patients with osteoporosis.
Ye XL and Lu CF, Endocrine. 2013 Oct;44(2):481-8. doi: 10.1007/s12020-013-9899-9. Epub 2013 Mar 5.
99.
Effects of acetate and butyrate on the expression of leptin and short-form leptin receptor in bovine and rat anterior pituitary cells.
Yonekura S, etal., Gen Comp Endocrinol. 2003 Sep;133(2):165-72.
100.
Impact of leptin receptor gene variants on risk of non-alcoholic fatty liver disease and its interaction with adiponutrin gene.
Zain SM, etal., J Gastroenterol Hepatol. 2013 May;28(5):873-9. doi: 10.1111/jgh.12104.
Lepr Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 121,409,735 - 121,593,201 (+) NCBI GRCr8 mRatBN7.2 5 116,294,409 - 116,477,904 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 116,289,823 - 116,475,908 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 118,847,763 - 119,019,098 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 120,573,106 - 120,744,441 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 120,624,429 - 120,795,760 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 120,503,475 - 120,682,281 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 120,564,645 - 120,682,221 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 124,380,327 - 124,525,200 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 5 124,555,678 - 124,556,585 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 122,320,075 - 122,503,449 NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 114,817,255 - 114,982,861 (+) NCBI Celera RH 3.4 Map 5 RGD Cytogenetic Map 5 q33 NCBI
LEPR Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 65,420,652 - 65,641,559 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 65,420,652 - 65,641,559 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 65,886,335 - 66,107,242 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 65,658,906 - 65,875,410 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 65,598,338 - 65,814,843 NCBI Celera 1 64,176,916 - 64,393,787 (+) NCBI Celera Cytogenetic Map 1 p31.3 NCBI HuRef 1 63,995,123 - 64,212,195 (+) NCBI HuRef CHM1_1 1 66,002,606 - 66,219,234 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 65,298,629 - 65,519,352 (+) NCBI T2T-CHM13v2.0
Lepr Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 101,574,393 - 101,676,375 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 101,574,601 - 101,672,549 (+) Ensembl GRCm39 Ensembl GRCm38 4 101,717,137 - 101,815,352 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 101,717,404 - 101,815,352 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 101,390,012 - 101,487,959 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 101,215,371 - 101,313,237 (+) NCBI MGSCv36 mm8 Celera 4 100,061,452 - 100,155,523 (+) NCBI Celera Cytogenetic Map 4 C6 NCBI cM Map 4 46.96 NCBI
Lepr Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955423 25,111,266 - 25,185,407 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955423 25,108,897 - 25,185,315 (-) NCBI ChiLan1.0 ChiLan1.0
LEPR Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 161,226,191 - 161,441,177 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 160,386,446 - 160,592,001 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 64,772,612 - 64,881,886 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 66,651,994 - 66,764,768 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 66,693,926 - 66,764,768 (+) Ensembl panpan1.1 panPan2
LEPR Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 44,684,118 - 44,775,626 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 44,688,109 - 44,775,636 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 44,745,719 - 44,810,649 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 44,870,825 - 44,963,640 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 44,875,468 - 44,963,183 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 44,840,852 - 44,906,048 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 44,786,008 - 44,851,055 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 45,029,763 - 45,094,688 (-) NCBI UU_Cfam_GSD_1.0
Lepr Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 78,634,973 - 78,718,201 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936591 5,774,326 - 5,836,444 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936591 5,771,371 - 5,846,177 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
LEPR
LEPR Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 67,454,205 - 67,567,524 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 67,454,334 - 67,524,229 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 49,988,602 - 50,125,048 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Lepr
.
Predicted Target Of
Count of predictions: 104 Count of miRNA genes: 96 Interacting mature miRNAs: 99 Transcripts: ENSRNOT00000044131, ENSRNOT00000050597 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1298070 Scl18 Serum cholesterol level QTL 18 3.7 blood LDL cholesterol amount (VT:0000181) calculated plasma low density lipoprotein cholesterol level (CMO:0001245) 5 79584860 124584860 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 7411582 Foco3 Food consumption QTL 3 7.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 1598859 Cm66 Cardiac mass QTL 66 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 79584860 124584860 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 1582212 Livw2 Liver weight QTL 2 3.5 0.0004 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 5 99016066 119085810 Rat 7411564 Bw135 Body weight QTL 135 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 87468046 132468046 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 7411601 Foco12 Food consumption QTL 12 19.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 1598846 Bp293 Blood pressure QTL 293 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 79584860 124584860 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 1358909 Kidm25 Kidney mass QTL 25 1.87 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 90067849 128034027 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 631527 Tls1 T-lymphoma susceptibility QTL 1 0 0.001 thymus integrity trait (VT:0010555) post-insult time to onset of T-cell lymphoma (CMO:0001907) 5 90450144 135450144 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298086 Bp156 Blood pressure QTL 156 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 84132602 129132602 Rat 2306971 Anxrr21 Anxiety related response QTL 21 9.47 fear/anxiety-related behavior trait (VT:1000241) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 5 66174080 124160948 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1358895 Bp254 Blood pressure QTL 254 3.6 0.0003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 58829236 128034027 Rat 6903316 Bw113 Body weight QTL 113 2 0.0103 body mass (VT:0001259) body weight (CMO:0000012) 5 87765973 132765973 Rat 1358889 Bp261 Blood pressure QTL 261 2.86 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 90067849 128034027 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
D5Wox38
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 116,360,112 - 116,360,293 (+) MAPPER mRatBN7.2 Rnor_6.0 5 120,569,168 - 120,569,348 NCBI Rnor6.0 Rnor_5.0 5 124,446,252 - 124,446,432 UniSTS Rnor5.0 RGSC_v3.4 5 122,386,495 - 122,386,675 UniSTS RGSC3.4 Celera 5 114,882,835 - 114,883,015 UniSTS Cytogenetic Map 5 q33 UniSTS
D5Wox37
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 121,472,814 - 121,473,106 (+) Marker Load Pipeline Rnor_6.0 5 120,566,555 - 120,566,842 NCBI Rnor6.0 Rnor_5.0 5 124,443,639 - 124,443,926 UniSTS Rnor5.0 RGSC_v3.4 5 122,383,882 - 122,384,169 UniSTS RGSC3.4 Celera 5 114,880,222 - 114,880,509 UniSTS Cytogenetic Map 5 q33 UniSTS
D5Wox39
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 116,368,606 - 116,368,754 (+) MAPPER mRatBN7.2 Rnor_6.0 5 120,577,662 - 120,577,809 NCBI Rnor6.0 Rnor_5.0 5 124,454,745 - 124,454,892 UniSTS Rnor5.0 RGSC_v3.4 5 122,394,986 - 122,395,133 UniSTS RGSC3.4 Celera 5 114,891,327 - 114,891,474 UniSTS Cytogenetic Map 5 q33 UniSTS
D5Rhw23
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 116,292,445 - 116,292,656 (+) MAPPER mRatBN7.2 Rnor_6.0 5 120,501,513 - 120,501,723 NCBI Rnor6.0 Rnor_5.0 5 124,378,365 - 124,378,575 UniSTS Rnor5.0 RGSC_v3.4 5 122,318,113 - 122,318,323 UniSTS RGSC3.4 Celera 5 114,815,293 - 114,815,503 UniSTS Cytogenetic Map 5 q33 UniSTS
RH129126
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 121,416,748 - 121,417,251 (+) Marker Load Pipeline mRatBN7.2 5 116,301,426 - 116,301,929 (+) MAPPER mRatBN7.2 Rnor_6.0 5 120,510,487 - 120,510,989 NCBI Rnor6.0 Rnor_5.0 5 124,387,687 - 124,388,189 UniSTS Rnor5.0 RGSC_v3.4 5 122,327,396 - 122,327,898 UniSTS RGSC3.4 Celera 5 114,824,241 - 114,824,743 UniSTS RH 3.4 Map 5 787.8 UniSTS Cytogenetic Map 5 q33 UniSTS
RH94807
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 116,403,395 - 116,403,535 (+) MAPPER mRatBN7.2 Rnor_6.0 5 120,612,273 - 120,612,412 NCBI Rnor6.0 Rnor_5.0 5 124,488,768 - 124,488,907 UniSTS Rnor5.0 RGSC_v3.4 5 122,433,750 - 122,433,889 UniSTS RGSC3.4 Celera 5 114,926,233 - 114,926,372 UniSTS RH 3.4 Map 5 803.7 UniSTS Cytogenetic Map 5 q33 UniSTS
AU048762
Rat Assembly Chr Position (strand) Source JBrowse Celera 5 114,903,630 - 114,903,747 UniSTS Cytogenetic Map 5 q33 UniSTS
This gene Lepr is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
89
88
57
25
57
6
216
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000044131
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 116,294,409 - 116,475,908 (+) Ensembl Rnor_6.0 Ensembl 5 120,577,975 - 120,682,221 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000050597 ⟹ ENSRNOP00000045398
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 116,359,187 - 116,450,411 (+) Ensembl Rnor_6.0 Ensembl 5 120,568,242 - 120,652,220 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000093171
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 120,646,516 - 120,680,609 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000093218
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 120,567,822 - 120,581,390 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000093574
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 116,289,823 - 116,472,969 (+) Ensembl Rnor_6.0 Ensembl 5 120,568,020 - 120,652,253 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000093648
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 120,564,645 - 120,585,228 (+) Ensembl
RefSeq Acc Id:
NM_012596 ⟹ NP_036728
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 121,409,735 - 121,591,213 (+) NCBI mRatBN7.2 5 116,294,409 - 116,475,906 (+) NCBI Rnor_6.0 5 120,503,475 - 120,682,281 (+) NCBI Rnor_5.0 5 124,380,327 - 124,525,200 (+) NCBI Rnor_5.0 5 124,555,678 - 124,556,585 (+) NCBI RGSC_v3.4 5 122,320,075 - 122,503,449 (+) RGD Celera 5 114,817,255 - 114,982,861 (+) RGD
Sequence:
TGGGGCAATTGGGCTGACCTTTCTTATGCTGGGATGTGCCTTGGAGGACTATGGGTGTCTATCTCTGAAGTAAGATGACGTGTCAGAAATTCTATGTGGTTTTGTTACACTGGGAATTTCTGTATGTG
hide sequence
RefSeq Acc Id:
XM_039109264 ⟹ XP_038965192
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 121,473,931 - 121,593,201 (+) NCBI mRatBN7.2 5 116,358,875 - 116,477,904 (+) NCBI
RefSeq Acc Id:
XM_039109265 ⟹ XP_038965193
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 121,473,930 - 121,593,201 (+) NCBI mRatBN7.2 5 116,358,603 - 116,477,904 (+) NCBI
RefSeq Acc Id:
XM_039109266 ⟹ XP_038965194
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 121,473,954 - 121,565,752 (+) NCBI mRatBN7.2 5 116,358,879 - 116,451,540 (+) NCBI
RefSeq Acc Id:
XM_039109267 ⟹ XP_038965195
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 121,473,953 - 121,589,539 (+) NCBI mRatBN7.2 5 116,358,879 - 116,474,232 (+) NCBI
RefSeq Acc Id:
XM_063287157 ⟹ XP_063143227
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 121,473,953 - 121,565,752 (+) NCBI
RefSeq Acc Id:
XM_063287158 ⟹ XP_063143228
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 121,473,953 - 121,589,539 (+) NCBI
RefSeq Acc Id:
NP_036728 ⟸ NM_012596
- Peptide Label:
precursor
- UniProtKB:
A0A8I5ZQD9 (UniProtKB/TrEMBL), A6JRP2 (UniProtKB/TrEMBL)
- Sequence:
MTCQKFYVVLLHWEFLYVITALNLAYPTSPWRFKLFCAPPSTTDDSFLSPAGVPNNTSSLKGASEALVEAKFNSTGIYVSELSKTIFHCCFGNEQGQNCSALTGNTEGKTLASVVKPLVFRQLGVNWD
hide sequence
Ensembl Acc Id:
ENSRNOP00000045398 ⟸ ENSRNOT00000050597
RefSeq Acc Id:
XP_038965193 ⟸ XM_039109265
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZQD9 (UniProtKB/TrEMBL), A6JRP2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038965192 ⟸ XM_039109264
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038965195 ⟸ XM_039109267
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038965194 ⟸ XM_039109266
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063143228 ⟸ XM_063287158
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063143227 ⟸ XM_063287157
- Peptide Label:
isoform X2
RGD ID: 13693869 Promoter ID: EPDNEW_R4386 Type: initiation region Name: Lepr_2 Description: leptin receptor SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R4387 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 120,567,819 - 120,567,879 EPDNEW
RGD ID: 13693862 Promoter ID: EPDNEW_R4387 Type: initiation region Name: Lepr_1 Description: leptin receptor SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R4386 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 120,568,306 - 120,568,366 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-02-26
Lepr
leptin receptor
leptin receptor
Symbol and Name status set to approved
625702 APPROVED
2002-06-10
Lepr
leptin receptor
Name updated
70585 PROVISIONAL
Note Type
Note
Reference
gene_expression
expressed in the endothelial cells of the vascular wall
625675
gene_function
receptor for obesity factor (leptin)
61790
gene_process
protects nonadipocytes from the adverse consequences of lipid overaccumulation
62400
gene_product
member of the gp130 family of cytokine receptors that stimulate gene transcription via activation of cytosolic STAT proteins
61790
gene_protein
an isoform exists with a short intracellular domain
729196
gene_transcript
two isoforms of the mRNA were detected
625675
