Symbol:
Bdkrb2
Name:
bradykinin receptor B2
RGD ID:
2201
Description:
Enables beta-2 adrenergic receptor binding activity and bradykinin receptor activity. Involved in several processes, including acute inflammatory response to antigenic stimulus; cellular response to hypoxia; and maintenance of blood-brain barrier. Predicted to be located in endosome. Predicted to be active in plasma membrane. Used to study several diseases, including asthma; pancreatitis; pleurisy; portal hypertension; and pulmonary hypertension. Biomarker of high grade glioma; hypertension; myocardial infarction; and sciatic neuropathy. Human ortholog(s) of this gene implicated in asthma; chronic obstructive pulmonary disease; hypertension; and rhinitis. Orthologous to human BDKRB2 (bradykinin receptor B2); PARTICIPATES IN G protein mediated signaling pathway via Galphai family; G protein mediated signaling pathway via Galphaq family; kallikrein-kinin cascade pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3',5'-cyclic GMP; 4-amino-2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
B2 bradykinin receptor; B2BKR; B2BRA; B2R; BK-2 receptor; bradykinin receptor, beta 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
BDKRB2 (bradykinin receptor B2) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Bdkrb2 (bradykinin receptor, beta 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Bdkrb2 (bradykinin receptor B2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
BDKRB2 (bradykinin receptor B2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
BDKRB2 (bradykinin receptor B2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Bdkrb2 (bradykinin receptor B2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
BDKRB2 (bradykinin receptor B2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
BDKRB2 (bradykinin receptor B2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Bdkrb2 (bradykinin receptor B2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Bdkrb2 (bradykinin receptor, beta 2)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
BDKRB2 (bradykinin receptor B2)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
si:dkey-63b1.1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
npr-30
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus tropicalis (tropical clawed frog):
bdkrb2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Allele / Splice:
Bdkrb2m1Mcwi
Bdkrb2m2Mcwi
Genetic Models:
FHH-Bdkrb2m1Mcwi
SS-Bdkrb2m2Mcwi
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 130,237,055 - 130,267,205 (+) NCBI GRCr8 mRatBN7.2 6 124,472,317 - 124,502,497 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 124,472,566 - 124,502,497 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 124,593,665 - 124,623,640 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 124,888,932 - 124,918,906 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 124,250,138 - 124,280,235 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 129,399,468 - 129,429,676 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 129,399,468 - 129,429,676 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 138,615,812 - 138,622,272 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 129,744,781 - 129,748,851 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 129,748,527 - 129,752,598 (+) NCBI Celera 6 122,039,524 - 122,069,422 (+) NCBI Celera RH 3.4 Map 6 815.41 RGD Cytogenetic Map 6 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Bdkrb2 Rat (+)-pilocarpine increases response to substance ISO Bdkrb2 (Mus musculus) 6480464 BDKRB2 protein mutant form results in increased susceptibility to Pilocarpine CTD PMID:15196965 Bdkrb2 Rat (R)-noradrenaline affects response to substance ISO Bdkrb2 (Mus musculus) 6480464 BDKRB2 affects the susceptibility to Norepinephrine CTD PMID:12105144 Bdkrb2 Rat 1,2-dichloroethane increases expression ISO Bdkrb2 (Mus musculus) 6480464 ethylene dichloride results in increased expression of BDKRB2 mRNA CTD PMID:28960355 Bdkrb2 Rat 15-acetyldeoxynivalenol increases expression ISO BDKRB2 (Homo sapiens) 6480464 15-acetyldeoxynivalenol results in increased expression of BDKRB2 mRNA CTD PMID:23792671 Bdkrb2 Rat 17beta-estradiol multiple interactions ISO BDKRB2 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of BDKRB2 mRNA CTD PMID:19619570 Bdkrb2 Rat 17beta-estradiol increases expression ISO BDKRB2 (Homo sapiens) 6480464 Estradiol results in increased expression of BDKRB2 mRNA CTD PMID:19619570 Bdkrb2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO BDKRB2 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of BDKRB2 mRNA CTD PMID:19619570 Bdkrb2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of BDKRB2 mRNA CTD PMID:32109520 Bdkrb2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of BDKRB2 mRNA CTD PMID:22298810 Bdkrb2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO BDKRB2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of BDKRB2 mRNA CTD PMID:22298810 Bdkrb2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO BDKRB2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of BDKRB2 mRNA CTD PMID:11489354 Bdkrb2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO BDKRB2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of BDKRB2 mRNA CTD PMID:19619570 Bdkrb2 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO BDKRB2 (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 Bdkrb2 Rat 3',5'-cyclic GMP multiple interactions EXP 6480464 [icatibant results in decreased activity of BDKRB2 protein] inhibits the reaction [Valsartan results in increased abundance of Cyclic GMP] CTD PMID:16982965 Bdkrb2 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO Bdkrb2 (Mus musculus) 6480464 tetrabromobisphenol A results in increased expression of BDKRB2 mRNA CTD PMID:25172293 Bdkrb2 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of BDKRB2 mRNA CTD PMID:21346803 Bdkrb2 Rat 4-hydroxycyclophosphamide multiple interactions EXP 6480464 [afimoxifene co-treated with 4-hydroxycyclophosphamide] affects the expression of BDKRB2 mRNA CTD PMID:25833159 Bdkrb2 Rat 5-fluorouracil multiple interactions ISO BDKRB2 (Homo sapiens) 6480464 TP53 protein affects the reaction [Fluorouracil results in increased expression of BDKRB2 mRNA] CTD PMID:15016801 Bdkrb2 Rat 6-oxoprostaglandin F1alpha affects abundance ISO Bdkrb2 (Mus musculus) 6480464 BDKRB2 affects the abundance of 6-Ketoprostaglandin F1 alpha CTD PMID:16514058 Bdkrb2 Rat 6-oxoprostaglandin F1alpha multiple interactions EXP 6480464 [kallidin more ... CTD PMID:29775649 Bdkrb2 Rat 6-oxoprostaglandin F1alpha multiple interactions ISO Bdkrb2 (Mus musculus) 6480464 PD 123319 affects the reaction [BDKRB2 affects the abundance of 6-Ketoprostaglandin F1 alpha] CTD PMID:16514058 Bdkrb2 Rat 8-Br-cAMP increases expression ISO BDKRB2 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of BDKRB2 mRNA CTD PMID:20147733 Bdkrb2 Rat afimoxifene multiple interactions EXP 6480464 [afimoxifene co-treated with 4-hydroxycyclophosphamide] affects the expression of BDKRB2 mRNA CTD PMID:25833159 Bdkrb2 Rat aflatoxin B1 increases methylation ISO BDKRB2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of BDKRB2 intron CTD PMID:30157460 Bdkrb2 Rat all-trans-retinoic acid increases expression ISO BDKRB2 (Homo sapiens) 6480464 Tretinoin results in increased expression of BDKRB2 mRNA CTD PMID:23724009 and PMID:23830798 Bdkrb2 Rat allyl isothiocyanate multiple interactions ISO BDKRB2 (Homo sapiens) 6480464 BDKRB2 protein promotes the reaction [allyl isothiocyanate results in increased activity of TRPA1 protein] CTD PMID:17571167 Bdkrb2 Rat amlodipine increases response to substance ISO Bdkrb2 (Mus musculus) 6480464 BDKRB2 results in increased susceptibility to Amlodipine CTD PMID:10523327 Bdkrb2 Rat aristolochic acid A decreases expression ISO BDKRB2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of BDKRB2 mRNA CTD PMID:33212167 Bdkrb2 Rat atenolol affects response to substance ISO BDKRB2 (Homo sapiens) 6480464 BDKRB2 exon polymorphism affects the susceptibility to Atenolol CTD PMID:12640257 Bdkrb2 Rat atropine multiple interactions ISO Bdkrb2 (Mus musculus) 6480464 BDKRB2 affects the susceptibility to [Propranolol co-treated with Atropine] CTD PMID:10614985 Bdkrb2 Rat Azoxymethane multiple interactions ISO Bdkrb2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of BDKRB2 mRNA CTD PMID:29950665 Bdkrb2 Rat benazepril multiple interactions EXP 6480464 [icatibant results in decreased activity of BDKRB2 protein] which results in decreased susceptibility to benazepril CTD PMID:16982965 Bdkrb2 Rat benazepril increases activity ISO Bdkrb2 (Mus musculus) 6480464 benazepril results in increased activity of BDKRB2 protein CTD PMID:15339989 Bdkrb2 Rat benzo[a]pyrene multiple interactions ISO Bdkrb2 (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to BDKRB2 promoter] CTD PMID:19654925 Bdkrb2 Rat benzo[a]pyrene increases expression ISO BDKRB2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of BDKRB2 mRNA CTD PMID:32234424 Bdkrb2 Rat benzo[a]pyrene affects methylation ISO BDKRB2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of BDKRB2 5' UTR more ... CTD PMID:27901495 and PMID:30157460 Bdkrb2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of BDKRB2 mRNA CTD PMID:25181051 and PMID:30816183 Bdkrb2 Rat cadmium dichloride increases expression ISO BDKRB2 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of BDKRB2 mRNA CTD PMID:38382870 Bdkrb2 Rat cadmium dichloride decreases expression ISO BDKRB2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of BDKRB2 mRNA CTD PMID:38568856 Bdkrb2 Rat calcium atom multiple interactions ISO BDKRB2 (Homo sapiens) 6480464 BDKRB2 protein affects the reaction [KNG1 protein affects the abundance of Calcium] CTD PMID:18054572 Bdkrb2 Rat calcium atom multiple interactions ISO Bdkrb2 (Mus musculus) 6480464 BDKRB2 protein affects the reaction [pyranoprofen inhibits the reaction [KNG1 protein affects the transport of and affects the localization of Calcium]] CTD PMID:16473424 Bdkrb2 Rat calcium(0) multiple interactions ISO BDKRB2 (Homo sapiens) 6480464 BDKRB2 protein affects the reaction [KNG1 protein affects the abundance of Calcium] CTD PMID:18054572 Bdkrb2 Rat calcium(0) multiple interactions ISO Bdkrb2 (Mus musculus) 6480464 BDKRB2 protein affects the reaction [pyranoprofen inhibits the reaction [KNG1 protein affects the transport of and affects the localization of Calcium]] CTD PMID:16473424 Bdkrb2 Rat candesartan decreases expression EXP 6480464 candesartan results in decreased expression of BDKRB2 mRNA CTD PMID:18796534 Bdkrb2 Rat capsaicin multiple interactions EXP 6480464 Capsaicin inhibits the reaction [[KNG1 protein alternative form binds to and results in increased activity of BDKRB2 protein] which results in increased abundance of Inositol Phosphates] CTD PMID:17347322 Bdkrb2 Rat capsaicin multiple interactions ISO BDKRB2 (Homo sapiens) 6480464 BDKRB2 affects the reaction [Capsaicin results in increased activity of TRPV1 protein] and BDKRB2 affects the reaction [KNG1 protein promotes the reaction [Capsaicin results in increased activity of TRPV1 protein]] CTD PMID:15363968 Bdkrb2 Rat captopril multiple interactions ISO Bdkrb2 (Mus musculus) 6480464 Captopril inhibits the reaction [LEPR protein affects the expression of BDKRB2 protein] CTD PMID:28130181 Bdkrb2 Rat carbon nanotube increases expression ISO Bdkrb2 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of BDKRB2 mRNA CTD PMID:25554681 Bdkrb2 Rat carbon nanotube affects expression ISO Bdkrb2 (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of BDKRB2 mRNA CTD PMID:23845593 Bdkrb2 Rat ceruletide increases expression ISO Bdkrb2 (Mus musculus) 6480464 Ceruletide results in increased expression of BDKRB2 mRNA CTD PMID:21484880 Bdkrb2 Rat CGP 52608 multiple interactions ISO BDKRB2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to BDKRB2 gene] CTD PMID:28238834 Bdkrb2 Rat chondroitin sulfate multiple interactions EXP 6480464 [icatibant binds to and results in decreased activity of BDKRB2 protein] which results in decreased susceptibility to Chondroitin Sulfates CTD PMID:21436127 Bdkrb2 Rat cisplatin increases response to substance ISO Bdkrb2 (Mus musculus) 6480464 BDKRB2 gene results in increased susceptibility to Cisplatin CTD PMID:24975837 Bdkrb2 Rat cisplatin increases expression ISO Bdkrb2 (Mus musculus) 6480464 Cisplatin results in increased expression of BDKRB2 protein CTD PMID:31874189 Bdkrb2 Rat cisplatin multiple interactions ISO BDKRB2 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of BDKRB2 mRNA CTD PMID:27392435 Bdkrb2 Rat cisplatin decreases expression ISO BDKRB2 (Homo sapiens) 6480464 Cisplatin results in decreased expression of BDKRB2 mRNA CTD PMID:27392435 Bdkrb2 Rat cisplatin decreases response to substance ISO Bdkrb2 (Mus musculus) 6480464 BDKRB2 gene mutant form results in decreased susceptibility to Cisplatin CTD PMID:24975837 Bdkrb2 Rat cisplatin multiple interactions ISO Bdkrb2 (Mus musculus) 6480464 BDKRB2 gene mutant form inhibits the reaction [Cisplatin results in increased expression of IL1B mRNA] and BDKRB2 gene mutant form inhibits the reaction [Cisplatin results in increased expression of TNF mRNA] CTD PMID:24975837 Bdkrb2 Rat copper(II) chloride decreases expression ISO BDKRB2 (Homo sapiens) 6480464 cupric chloride results in decreased expression of BDKRB2 mRNA CTD PMID:38568856 Bdkrb2 Rat copper(II) sulfate increases expression ISO BDKRB2 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of BDKRB2 mRNA CTD PMID:19549813 Bdkrb2 Rat cyclophosphamide affects expression EXP 6480464 Cyclophosphamide affects the expression of BDKRB2 mRNA CTD PMID:15576455 Bdkrb2 Rat dextran sulfate multiple interactions ISO Bdkrb2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of BDKRB2 mRNA CTD PMID:29950665 Bdkrb2 Rat diallyl trisulfide decreases expression ISO BDKRB2 (Homo sapiens) 6480464 diallyl trisulfide results in decreased expression of BDKRB2 mRNA CTD PMID:34995734 Bdkrb2 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of BDKRB2 mRNA CTD PMID:21266533 Bdkrb2 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of BDKRB2 mRNA CTD PMID:18636392 Bdkrb2 Rat dioxygen multiple interactions ISO Bdkrb2 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of BDKRB2 mRNA CTD PMID:30529165 Bdkrb2 Rat diquat increases expression ISO Bdkrb2 (Mus musculus) 6480464 Diquat results in increased expression of BDKRB2 mRNA CTD PMID:36851058 Bdkrb2 Rat dorsomorphin multiple interactions ISO BDKRB2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of BDKRB2 mRNA CTD PMID:27188386 Bdkrb2 Rat doxorubicin decreases expression ISO BDKRB2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of BDKRB2 mRNA CTD PMID:29803840 Bdkrb2 Rat doxorubicin increases expression ISO Bdkrb2 (Mus musculus) 6480464 Doxorubicin results in increased expression of BDKRB2 mRNA CTD PMID:37409694 Bdkrb2 Rat doxorubicin multiple interactions ISO Bdkrb2 (Mus musculus) 6480464 BDKRB2 protein affects the reaction [Doxorubicin results in decreased expression of NOS3 protein] more ... CTD PMID:37409694 Bdkrb2 Rat enalapril increases expression EXP 6480464 Enalapril results in increased expression of BDKRB2 mRNA and Enalapril results in increased expression of BDKRB2 protein CTD PMID:18190998 Bdkrb2 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of BDKRB2 mRNA CTD PMID:30307764 Bdkrb2 Rat fonofos increases methylation ISO BDKRB2 (Homo sapiens) 6480464 Fonofos results in increased methylation of BDKRB2 promoter CTD PMID:22847954 Bdkrb2 Rat formaldehyde decreases expression ISO BDKRB2 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of BDKRB2 mRNA CTD PMID:20655997 Bdkrb2 Rat genistein multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in increased expression of BDKRB2 mRNA CTD PMID:21782745 Bdkrb2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of BDKRB2 mRNA CTD PMID:33387578 Bdkrb2 Rat Hexamethonium affects response to substance ISO Bdkrb2 (Mus musculus) 6480464 BDKRB2 affects the susceptibility to Hexamethonium CTD PMID:10614985 Bdkrb2 Rat icatibant multiple interactions ISO BDKRB2 (Homo sapiens) 6480464 icatibant binds to and results in decreased activity of BDKRB2 protein more ... CTD PMID:10666510 and PMID:15140628 Bdkrb2 Rat icatibant multiple interactions ISO Bdkrb2 (Mus musculus) 6480464 icatibant binds to and results in decreased activity of BDKRB2 protein and icatibant inhibits the reaction [KNG1 protein modified form binds to BDKRB2 protein] CTD PMID:24975837 and PMID:30685357 Bdkrb2 Rat icatibant multiple interactions EXP 6480464 [icatibant binds to and results in decreased activity of BDKRB2 protein] which results in decreased susceptibility to Chondroitin Sulfates more ... CTD PMID:10666510 more ... Bdkrb2 Rat irbesartan affects response to substance ISO BDKRB2 (Homo sapiens) 6480464 BDKRB2 exon polymorphism affects the susceptibility to irbesartan CTD PMID:12640257 Bdkrb2 Rat lipopolysaccharide multiple interactions ISO BDKRB2 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of BDKRB2 mRNA] CTD PMID:35811015 Bdkrb2 Rat lipopolysaccharide increases expression ISO BDKRB2 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of BDKRB2 mRNA CTD PMID:35811015 Bdkrb2 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of BDKRB2 mRNA CTD PMID:28801915 Bdkrb2 Rat methoxychlor multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in increased expression of BDKRB2 mRNA CTD PMID:21782745 Bdkrb2 Rat methoxychlor increases expression EXP 6480464 Methoxychlor results in increased expression of BDKRB2 mRNA CTD PMID:21782745 Bdkrb2 Rat microcystin-LR multiple interactions EXP 6480464 [Dietary Fats co-treated with Cholesterol and Dietary co-treated with cyanoginosin LR] results in increased expression of BDKRB2 mRNA CTD PMID:34740672 Bdkrb2 Rat microcystin-LR increases expression EXP 6480464 cyanoginosin LR results in increased expression of BDKRB2 mRNA CTD PMID:34740672 Bdkrb2 Rat N-methyl-4-phenylpyridinium increases expression ISO BDKRB2 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of BDKRB2 mRNA CTD PMID:24810058 Bdkrb2 Rat N-Nitrosopyrrolidine increases expression ISO BDKRB2 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in increased expression of BDKRB2 mRNA CTD PMID:32234424 Bdkrb2 Rat nickel atom increases expression ISO BDKRB2 (Homo sapiens) 6480464 Nickel results in increased expression of BDKRB2 mRNA CTD PMID:25583101 Bdkrb2 Rat nitric oxide multiple interactions EXP 6480464 [kallidin more ... CTD PMID:29775649 Bdkrb2 Rat nitroprusside affects response to substance ISO Bdkrb2 (Mus musculus) 6480464 BDKRB2 affects the susceptibility to Nitroprusside CTD PMID:10614985 Bdkrb2 Rat O-methyleugenol increases expression ISO BDKRB2 (Homo sapiens) 6480464 methyleugenol results in increased expression of BDKRB2 mRNA CTD PMID:32234424 Bdkrb2 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of BDKRB2 mRNA CTD PMID:18636392 Bdkrb2 Rat ozone multiple interactions ISO Bdkrb2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of BDKRB2 mRNA CTD PMID:34911549 Bdkrb2 Rat paracetamol increases expression ISO BDKRB2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of BDKRB2 mRNA CTD PMID:29067470 Bdkrb2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of BDKRB2 mRNA CTD PMID:33387578 Bdkrb2 Rat parathion increases methylation ISO BDKRB2 (Homo sapiens) 6480464 Parathion results in increased methylation of BDKRB2 promoter CTD PMID:22847954 Bdkrb2 Rat PD123319 multiple interactions ISO Bdkrb2 (Mus musculus) 6480464 PD 123319 affects the reaction [BDKRB2 affects the abundance of 6-Ketoprostaglandin F1 alpha] CTD PMID:16514058 Bdkrb2 Rat perfluorohexanesulfonic acid decreases expression ISO Bdkrb2 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of BDKRB2 mRNA CTD PMID:37995155 Bdkrb2 Rat perindopril affects expression EXP 6480464 Perindopril affects the expression of BDKRB2 protein CTD PMID:18806609 Bdkrb2 Rat phenobarbital affects expression ISO BDKRB2 (Homo sapiens) 6480464 Phenobarbital affects the expression of BDKRB2 mRNA CTD PMID:19159669 Bdkrb2 Rat phenylephrine affects response to substance ISO Bdkrb2 (Mus musculus) 6480464 BDKRB2 affects the susceptibility to Phenylephrine CTD PMID:10614985 Bdkrb2 Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of BDKRB2 mRNA CTD PMID:18158353 Bdkrb2 Rat potassium dichromate increases expression ISO Bdkrb2 (Mus musculus) 6480464 Potassium Dichromate results in increased expression of BDKRB2 mRNA CTD PMID:23608068 Bdkrb2 Rat Pranoprofen multiple interactions ISO Bdkrb2 (Mus musculus) 6480464 BDKRB2 protein affects the reaction [pyranoprofen inhibits the reaction [KNG1 protein affects the transport of and affects the localization of Calcium]] CTD PMID:16473424 Bdkrb2 Rat propranolol multiple interactions ISO Bdkrb2 (Mus musculus) 6480464 BDKRB2 affects the susceptibility to [Propranolol co-treated with Atropine] CTD PMID:10614985 Bdkrb2 Rat ramiprilat increases response to substance ISO Bdkrb2 (Mus musculus) 6480464 BDKRB2 results in increased susceptibility to ramiprilat CTD PMID:10523327 Bdkrb2 Rat resveratrol decreases expression ISO BDKRB2 (Homo sapiens) 6480464 resveratrol results in decreased expression of BDKRB2 mRNA and resveratrol results in decreased expression of BDKRB2 protein CTD PMID:18089832 Bdkrb2 Rat resveratrol multiple interactions ISO BDKRB2 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of BDKRB2 mRNA CTD PMID:23557933 Bdkrb2 Rat rotenone increases expression ISO BDKRB2 (Homo sapiens) 6480464 Rotenone results in increased expression of BDKRB2 mRNA CTD PMID:29955902 Bdkrb2 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO BDKRB2 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of BDKRB2 mRNA CTD PMID:35811015 Bdkrb2 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO BDKRB2 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of BDKRB2 mRNA] CTD PMID:35811015 Bdkrb2 Rat SB 431542 multiple interactions ISO BDKRB2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of BDKRB2 mRNA CTD PMID:27188386 Bdkrb2 Rat silicon dioxide decreases expression ISO BDKRB2 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of BDKRB2 mRNA CTD PMID:25895662 Bdkrb2 Rat sodium arsenite decreases expression ISO BDKRB2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of BDKRB2 mRNA CTD PMID:38568856 Bdkrb2 Rat sodium arsenite increases expression ISO BDKRB2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of BDKRB2 mRNA CTD PMID:34032870 Bdkrb2 Rat streptozocin multiple interactions EXP 6480464 [icatibant binds to and results in decreased activity of BDKRB2 protein] which results in decreased susceptibility to Streptozocin CTD PMID:17989505 Bdkrb2 Rat streptozocin increases expression ISO Bdkrb2 (Mus musculus) 6480464 Streptozocin results in increased expression of BDKRB2 mRNA CTD PMID:19516248 Bdkrb2 Rat sulforaphane decreases expression ISO BDKRB2 (Homo sapiens) 6480464 sulforaphane results in decreased expression of BDKRB2 mRNA CTD PMID:31838189 Bdkrb2 Rat terbufos increases methylation ISO BDKRB2 (Homo sapiens) 6480464 terbufos results in increased methylation of BDKRB2 promoter CTD PMID:22847954 Bdkrb2 Rat tetrachloromethane decreases expression ISO Bdkrb2 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of BDKRB2 mRNA CTD PMID:17484886 Bdkrb2 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of BDKRB2 protein CTD PMID:18054572 Bdkrb2 Rat titanium dioxide affects expression ISO Bdkrb2 (Mus musculus) 6480464 titanium dioxide affects the expression of BDKRB2 mRNA CTD PMID:17656681 Bdkrb2 Rat titanium dioxide multiple interactions ISO Bdkrb2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of BDKRB2 mRNA CTD PMID:29950665 Bdkrb2 Rat trichloroethene multiple interactions ISO Bdkrb2 (Mus musculus) 6480464 BDKRB2 protein results in increased susceptibility to [Trichloroethylene co-treated with Freund's Adjuvant] CTD PMID:30685357 Bdkrb2 Rat triclosan increases expression ISO BDKRB2 (Homo sapiens) 6480464 Triclosan results in increased expression of BDKRB2 mRNA CTD PMID:30510588 Bdkrb2 Rat tropan-3alpha-yl 3-hydroxy-2-phenylpropanoate multiple interactions ISO Bdkrb2 (Mus musculus) 6480464 BDKRB2 affects the susceptibility to [Propranolol co-treated with Atropine] CTD PMID:10614985 Bdkrb2 Rat valproic acid increases methylation ISO BDKRB2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of BDKRB2 gene CTD PMID:29154799 Bdkrb2 Rat valproic acid multiple interactions ISO BDKRB2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of BDKRB2 mRNA CTD PMID:27188386 Bdkrb2 Rat valproic acid increases expression ISO BDKRB2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of BDKRB2 mRNA CTD PMID:24383497 and PMID:26272509 Bdkrb2 Rat valsartan multiple interactions EXP 6480464 [icatibant results in decreased activity of BDKRB2 protein] inhibits the reaction [Valsartan results in increased abundance of Cyclic GMP] and [icatibant results in decreased activity of BDKRB2 protein] which results in decreased susceptibility to Valsartan CTD PMID:16982965 Bdkrb2 Rat vincristine multiple interactions EXP 6480464 [icatibant binds to and results in decreased activity of BDKRB2 protein] which results in decreased susceptibility to Vincristine CTD PMID:17989505 Bdkrb2 Rat zinc atom increases expression EXP 6480464 Zinc deficiency results in increased expression of BDKRB2 mRNA CTD PMID:12672911 Bdkrb2 Rat zinc(0) increases expression EXP 6480464 Zinc deficiency results in increased expression of BDKRB2 mRNA CTD PMID:12672911
Imported Annotations - KEGG (archival)
(+)-pilocarpine (ISO) (R)-noradrenaline (ISO) 1,2-dichloroethane (ISO) 15-acetyldeoxynivalenol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3',5'-cyclic GMP (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxycyclophosphamide (EXP) 5-fluorouracil (ISO) 6-oxoprostaglandin F1alpha (EXP,ISO) 8-Br-cAMP (ISO) afimoxifene (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) allyl isothiocyanate (ISO) amlodipine (ISO) aristolochic acid A (ISO) atenolol (ISO) atropine (ISO) Azoxymethane (ISO) benazepril (EXP,ISO) benzo[a]pyrene (ISO) bisphenol A (EXP) cadmium dichloride (ISO) calcium atom (ISO) calcium(0) (ISO) candesartan (EXP) capsaicin (EXP,ISO) captopril (ISO) carbon nanotube (ISO) ceruletide (ISO) CGP 52608 (ISO) chondroitin sulfate (EXP) cisplatin (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) cyclophosphamide (EXP) dextran sulfate (ISO) diallyl trisulfide (ISO) dibutyl phthalate (EXP) dichlorine (EXP) dioxygen (ISO) diquat (ISO) dorsomorphin (ISO) doxorubicin (ISO) enalapril (EXP) fenvalerate (EXP) fonofos (ISO) formaldehyde (ISO) genistein (EXP) gentamycin (EXP) Hexamethonium (ISO) icatibant (EXP,ISO) irbesartan (ISO) lipopolysaccharide (ISO) manganese(II) chloride (EXP) methoxychlor (EXP) microcystin-LR (EXP) N-methyl-4-phenylpyridinium (ISO) N-Nitrosopyrrolidine (ISO) nickel atom (ISO) nitric oxide (EXP) nitroprusside (ISO) O-methyleugenol (ISO) ozone (EXP,ISO) paracetamol (EXP,ISO) parathion (ISO) PD123319 (ISO) perfluorohexanesulfonic acid (ISO) perindopril (EXP) phenobarbital (ISO) phenylephrine (EXP,ISO) potassium dichromate (ISO) Pranoprofen (ISO) propranolol (ISO) ramiprilat (ISO) resveratrol (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) streptozocin (EXP,ISO) sulforaphane (ISO) terbufos (ISO) tetrachloromethane (EXP,ISO) titanium dioxide (ISO) trichloroethene (ISO) triclosan (ISO) tropan-3alpha-yl 3-hydroxy-2-phenylpropanoate (ISO) valproic acid (ISO) valsartan (EXP) vincristine (EXP) zinc atom (EXP) zinc(0) (EXP)
1.
Angiotensin II type 2 receptor-bradykinin B2 receptor functional heterodimerization.
Abadir PM, etal., Hypertension. 2006 Aug;48(2):316-22. Epub 2006 Jun 5.
2.
Retinal plasma extravasation in streptozotocin-diabetic rats mediated by kinin B(1) and B(2) receptors.
Abdouh M, etal., Br J Pharmacol. 2008 May;154(1):136-43. Epub 2008 Mar 3.
3.
Efficacy and tolerability of Icatibant (Hoe 140) in patients with moderately severe chronic bronchial asthma.
Akbary AM, etal., Immunopharmacology. 1996 Jun;33(1-3):238-42.
4.
The genetic association database.
Becker KG, etal., Nat Genet. 2004 May;36(5):431-2.
5.
Expression of kinin receptors on eosinophils: comparison of asthmatic patients and healthy subjects.
Bertram CM, etal., J Leukoc Biol. 2009 Mar;85(3):544-52. Epub 2008 Nov 26.
6.
Bradykinin receptors antagonists and nitric oxide synthase inhibitors in vincristine and streptozotocin induced hyperalgesia in chemotherapy and diabetic neuropathy rat model.
Bujalska M and Makulska-Nowak H, Neuro Endocrinol Lett. 2009 Mar;30(1):144-52.
7.
Autoradiographic distribution and alterations of kinin B(2) receptors in the brain and spinal cord of streptozotocin-diabetic rats.
Campos MM, etal., Synapse. 2005 Dec 1;58(3):184-92.
8.
Splanchnic hyposensitivity to glypressin in a hemorrhage-transfused common bile duct-ligated rat model of portal hypertension: role of nitric oxide and bradykinin.
Chen CT, etal., Hepatogastroenterology. 2009 Sep-Oct;56(94-95):1261-7.
9.
Expression and function of bradykinin B1 and B2 receptors in normal and inflamed rat urinary bladder urothelium.
Chopra B, etal., J Physiol. 2005 Feb 1;562(Pt 3):859-71. Epub 2004 Dec 2.
10.
Pharmacologic and autoradiographic evidence for an up-regulation of kinin B(2) receptors in the spinal cord of spontaneously hypertensive rats.
Cloutier F, etal., Br J Pharmacol. 2002 Apr;135(7):1641-54.
11.
Selective tumor blood-brain barrier opening with the kinin B2 receptor agonist -BK in a F98 glioma rat model: an MRI study.
Cote J, etal., Neuropeptides. 2010 Apr;44(2):177-85. Epub 2010 Jan 18.
12.
Gene expression of kinin receptors B1 and B2 in PBMC from patients with cardiac syndrome X.
Dabek J, etal., Scand Cardiovasc J. 2007 Dec;41(6):391-6.
13.
Direct protein-protein interaction between PLCgamma1 and the bradykinin B2 receptor--importance of growth conditions.
Duchene J, etal., Biochem Biophys Res Commun. 2005 Jan 28;326(4):894-900.
14.
A novel protein-protein interaction between a G protein-coupled receptor and the phosphatase SHP-2 is involved in bradykinin-induced inhibition of cell proliferation.
Duchene J, etal., J Biol Chem. 2002 Oct 25;277(43):40375-83. Epub 2002 Aug 12.
15.
Role of bradykinin B1 and B2 receptors in normal blood pressure regulation.
Duka A, etal., Am J Physiol Endocrinol Metab. 2006 Aug;291(2):E268-74. Epub 2006 Feb 28.
16.
Airway hyperresponsiveness to bradykinin induced by allergen challenge in actively sensitised Brown Norway rats.
Ellis KM, etal., Naunyn Schmiedebergs Arch Pharmacol. 2004 Feb;369(2):166-78. Epub 2004 Jan 15.
17.
Effects of the bradykinin B2 receptor antagonist S 16118 (p-guanidobenzoyl-[Hyp3,Thi5,D-Tic7,Oic8]bradykinin) in different in vivo animal models of inflammation.
Feletou M, etal., J Pharmacol Exp Ther. 1995 Jun;273(3):1078-84.
18.
Cyclooxygenase inhibitors attenuate bradykinin-induced vasoconstriction in septic isolated rat lungs.
Fischer LG, etal., Anesth Analg. 2000 Mar;90(3):625-31.
19.
Modulation of allergic and immune complex-induced lung inflammation by bradykinin receptor antagonists.
Gama Landgraf R, etal., Inflamm Res. 2004 Feb;53(2):78-83. Epub 2004 Jan 26.
20.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
21.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
22.
Identification of genetic factors associated with susceptibility to angiotensin-converting enzyme inhibitors-induced cough.
Grilo A, etal., Pharmacogenet Genomics. 2011 Jan;21(1):10-7.
23.
A novel bioassay for detecting GPCR heterodimerization: transactivation of beta 2 adrenergic receptor by bradykinin receptor.
Haack KK, etal., J Biomol Screen. 2010 Mar;15(3):251-60. doi: 10.1177/1087057109360254. Epub 2010 Feb 11.
24.
+9/+9 Homozygosity of the bradykinin receptor gene polymorphism is associated with reduced fat-free mass in chronic obstructive pulmonary disease.
Hopkinson NS, etal., Am J Clin Nutr. 2006 Apr;83(4):912-7.
25.
Interleukin-1beta enhanced action of kinins on extracellular matrix of spontaneous hypertensive rat cardiac fibroblasts.
Imai C, etal., Clin Exp Hypertens 2005 Jan;27(1):59-69.
26.
Lack of both bradykinin B1 and B2 receptors enhances nephropathy, neuropathy, and bone mineral loss in Akita diabetic mice.
Kakoki M, etal., Proc Natl Acad Sci U S A. 2010 Jun 1;107(22):10190-5. doi: 10.1073/pnas.1005144107. Epub 2010 May 17.
27.
Polymorphisms in the bradykinin B2 receptor gene and childhood asthma.
Kusser B, etal., Biol Chem. 2001 May;382(5):885-9.
28.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
29.
Angiotensin-converting enzyme gene insertion/deletion, not bradykinin B2 receptor -58T/C gene polymorphism, associated with angiotensin-converting enzyme inhibitor-related cough in Chinese female patients with non-insulin-dependent diabetes mellitus.
Lee YJ and Tsai JC, Metabolism. 2001 Nov;50(11):1346-50.
30.
International union of pharmacology. XLV. Classification of the kinin receptor family: from molecular mechanisms to pathophysiological consequences.
Leeb-Lundberg LM, etal., Pharmacol Rev. 2005 Mar;57(1):27-77.
31.
Hypoxia-induced expression of bradykinin type-2 receptors in endothelial cells triggers NO production, cell migration, and angiogenesis.
Liesmaa I, etal., J Cell Physiol. 2009 Nov;221(2):359-66.
32.
Effects of an orally active non-peptide bradykinin B2 receptor antagonist, FR173657, on plasma exudation in rat carrageenin-induced pleurisy.
Majima M, etal., Br J Pharmacol. 1997 Jun;121(4):723-30.
33.
Expression cloning of a rat B2 bradykinin receptor.
McEachern AE, etal., Proc Natl Acad Sci U S A 1991 Sep 1;88(17):7724-8.
34.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
35.
The kallikrein-kinin system: current and future pharmacological targets.
Moreau ME, etal., J Pharmacol Sci. 2005 Sep;99(1):6-38.
36.
Bradykinin B(2) receptor gene polymorphism is associated with angiotensin-converting enzyme inhibitor-related cough.
Mukae S, etal., Hypertension. 2000 Jul;36(1):127-31.
37.
Association of polymorphisms of the renin-angiotensin system and bradykinin B2 receptor with ACE-inhibitor-related cough.
Mukae S, etal., J Hum Hypertens. 2002 Dec;16(12):857-63.
38.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
39.
Autoradiographic analysis of rat brain kinin B1 and B2 receptors: normal distribution and alterations induced by epilepsy.
Ongali B, etal., J Comp Neurol 2003 Jul 7;461(4):506-19.
40.
Molecular structure and expression of rat bradykinin B2 receptor gene. Evidence for alternative splicing.
Pesquero JB, etal., J Biol Chem 1994 Oct 28;269(43):26920-5.
41.
Role of kinin B1 and B2 receptors in a rat model of neuropathic pain.
Petcu M, etal., Int Immunopharmacol. 2008 Feb;8(2):188-96. Epub 2007 Sep 29.
42.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
43.
Bradykinin B1 and B2 receptors, tumour necrosis factor alpha and inflammatory hyperalgesia.
Poole S, etal., Br J Pharmacol. 1999 Feb;126(3):649-56.
44.
Kinin B1 and B2 receptor mRNA expression in the hypothalamus of spontaneously hypertensive rats.
Qadri F, etal., Can J Physiol Pharmacol 2002 Apr;80(4):258-63.
45.
Comparative nasal effects of bradykinin, kallidin and [Des-Arg9]-bradykinin in atopic rhinitic and normal volunteers.
Rajakulasingam K, etal., J Physiol. 1991 Jun;437:577-87.
46.
Enalapril treatment corrects the reduced response to bradykinin in diabetes increasing the B2 protein expression.
Rastelli VM, etal., Peptides. 2008 Mar;29(3):404-11. Epub 2007 Dec 7.
47.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
48.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
49.
Bradykinin down-regulates LPS-induced eosinophil accumulation in the pleural cavity of mice through type 2-kinin receptor activation: a role for prostaglandins.
Silva AR, etal., Br J Pharmacol. 1999 May;127(2):569-75.
50.
Regulation of cardiac bradykinin B1- and B2-receptor mRNA in experimental ischemic, diabetic, and pressure-overload-induced cardiomyopathy.
Spillmann F, etal., Int Immunopharmacol 2002 Dec;2(13-14):1823-32.
51.
Targeted deletion of B2-kinin receptors protects against the development of diabetic nephropathy.
Tan Y, etal., Am J Physiol Renal Physiol. 2007 Oct;293(4):F1026-35. Epub 2007 Jun 27.
52.
Treatment of severe pulmonary hypertension: a bradykinin receptor 2 agonist B9972 causes reduction of pulmonary artery pressure and right ventricular hypertrophy.
Taraseviciene-Stewart L, etal., Peptides. 2005 Aug;26(8):1292-300.
53.
Role of kinins in seasonal allergic rhinitis: icatibant, a bradykinin B2 receptor antagonist, abolishes the hyperresponsiveness and nasal eosinophilia induced by antigen.
Turner P, etal., J Allergy Clin Immunol. 2001 Jan;107(1):105-13.
54.
Hypotension in transgenic mice overexpressing human bradykinin B2 receptor.
Wang DZ, etal., Hypertension. 1997 Jan;29(1 Pt 2):488-93.
55.
Lack of association between ACE and bradykinin B2 receptor gene polymorphisms and ACE inhibitor-induced coughing in hypertensive Koreans.
Woo SW, etal., J Clin Pharm Ther. 2009 Oct;34(5):561-7.
56.
Prostaglandin receptors EP2, EP3, and IP mediate exudate formation in carrageenin-induced mouse pleurisy.
Yuhki K, etal., J Pharmacol Exp Ther. 2004 Dec;311(3):1218-24. Epub 2004 Aug 17.
Bdkrb2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 130,237,055 - 130,267,205 (+) NCBI GRCr8 mRatBN7.2 6 124,472,317 - 124,502,497 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 124,472,566 - 124,502,497 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 124,593,665 - 124,623,640 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 124,888,932 - 124,918,906 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 124,250,138 - 124,280,235 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 129,399,468 - 129,429,676 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 129,399,468 - 129,429,676 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 138,615,812 - 138,622,272 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 129,744,781 - 129,748,851 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 129,748,527 - 129,752,598 (+) NCBI Celera 6 122,039,524 - 122,069,422 (+) NCBI Celera RH 3.4 Map 6 815.41 RGD Cytogenetic Map 6 q32 NCBI
BDKRB2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 96,204,839 - 96,244,164 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 96,204,679 - 96,244,166 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 96,671,176 - 96,710,501 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 95,740,950 - 95,780,542 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 95,740,949 - 95,780,536 NCBI Celera 14 76,726,862 - 76,766,386 (+) NCBI Celera Cytogenetic Map 14 q32.2 NCBI HuRef 14 76,856,277 - 76,895,774 (+) NCBI HuRef CHM1_1 14 96,610,085 - 96,649,595 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 90,436,088 - 90,475,413 (+) NCBI T2T-CHM13v2.0
Bdkrb2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 105,529,431 - 105,561,503 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 105,529,485 - 105,561,496 (+) Ensembl GRCm39 Ensembl GRCm38 12 105,563,172 - 105,595,244 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 105,563,226 - 105,595,237 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 106,801,382 - 106,831,281 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 105,964,222 - 105,994,121 (+) NCBI MGSCv36 mm8 Celera 12 106,797,782 - 106,827,683 (+) NCBI Celera Cytogenetic Map 12 E NCBI cM Map 12 55.76 NCBI
Bdkrb2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955438 16,511,759 - 16,537,172 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955438 16,514,300 - 16,537,160 (-) NCBI ChiLan1.0 ChiLan1.0
BDKRB2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 97,363,214 - 97,404,173 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 96,579,702 - 96,620,931 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 76,832,833 - 76,873,860 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 96,157,122 - 96,196,253 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 96,156,494 - 96,196,253 (+) Ensembl panpan1.1 panPan2
BDKRB2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 64,974,588 - 65,005,682 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 64,974,997 - 65,003,407 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 64,490,876 - 64,519,295 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 65,246,390 - 65,277,067 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 65,246,390 - 65,274,792 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 64,919,488 - 64,947,871 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 64,980,727 - 65,009,155 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 65,304,383 - 65,332,835 (+) NCBI UU_Cfam_GSD_1.0
Bdkrb2
BDKRB2
BDKRB2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 74,084,907 - 74,125,604 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 74,118,210 - 74,122,909 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 61,236,289 - 61,276,664 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Bdkrb2
.
Predicted Target Of
Count of predictions: 352 Count of miRNA genes: 134 Interacting mature miRNAs: 152 Transcripts: ENSRNOT00000071735, ENSRNOT00000074621 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12801411 Schws8 Schwannoma susceptibility QTL 8 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 94968928 139968928 Rat 1331797 Bp213 Blood pressure QTL 213 3.291 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 104085867 128713626 Rat 1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 71111 Iddm8 Insulin dependent diabetes mellitus QTL 8 1.9 0.002 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 6 105156861 140994061 Rat 1358355 Srcrt4 Stress Responsive Cort QTL 4 6.39 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 100364669 140994061 Rat 61329 Eae9 Experimental allergic encephalomyelitis QTL 9 3.7 body mass (VT:0001259) change in body weight (CMO:0002045) 6 122549046 140994061 Rat 2313399 Anxrr28 Anxiety related response QTL 28 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 6 100671796 132340886 Rat 1331725 Bp212 Blood pressure QTL 212 3.52475 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 93701310 128713626 Rat 8552796 Vie3 Viral induced encephalitis QTL 3 2.6 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 6 96833997 140994061 Rat 4145118 Mcs26 Mammary carcinoma susceptibility QTL 26 0.0001 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 106752656 132339866 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 1641917 Colcr5 Colorectal carcinoma resistance QTL 5 3.18 0.0009 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 6 122549046 137801795 Rat 61414 Pia3 Pristane induced arthritis QTL 3 4.5 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 6 94968928 137848904 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 737976 Pia24 Pristane induced arthritis QTL 24 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 6 112636280 140994061 Rat 1298087 Iddm18 Insulin dependent diabetes mellitus QTL 18 0.0001 urine glucose amount (VT:0001758) percentage of study population developing diabetes mellitus during a period of time (CMO:0001114) 6 116506292 130245370 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat 2293085 Iddm29 Insulin dependent diabetes mellitus QTL 29 7.66 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 6 122549046 140286318 Rat
PMC150944P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 124,498,937 - 124,499,509 (+) MAPPER mRatBN7.2 Rnor_6.0 6 129,426,117 - 129,426,688 NCBI Rnor6.0 Rnor_5.0 6 138,618,713 - 138,619,284 UniSTS Rnor5.0 RGSC_v3.4 6 129,747,682 - 129,748,253 UniSTS RGSC3.4 Celera 6 122,065,863 - 122,066,434 UniSTS Cytogenetic Map 6 q32 UniSTS
L27595
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 124,499,992 - 124,500,146 (+) MAPPER mRatBN7.2 Rnor_6.0 6 129,427,172 - 129,427,325 NCBI Rnor6.0 Rnor_5.0 6 138,619,768 - 138,619,921 UniSTS Rnor5.0 RGSC_v3.4 6 129,748,737 - 129,748,890 UniSTS RGSC3.4 Celera 6 122,066,918 - 122,067,071 UniSTS Cytogenetic Map 6 q32 UniSTS
PMC126639P3
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 124,500,590 - 124,500,832 (+) MAPPER mRatBN7.2 Rnor_6.0 6 129,427,770 - 129,428,011 NCBI Rnor6.0 Rnor_5.0 6 138,620,366 - 138,620,607 UniSTS Rnor5.0 RGSC_v3.4 6 129,749,335 - 129,749,576 UniSTS RGSC3.4 Celera 6 122,067,516 - 122,067,757 UniSTS Cytogenetic Map 6 q32 UniSTS
RH94464
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 6 130,266,163 - 130,266,316 (+) Marker Load Pipeline mRatBN7.2 6 124,501,455 - 124,501,608 (+) MAPPER mRatBN7.2 Rnor_6.0 6 129,428,635 - 129,428,787 NCBI Rnor6.0 Rnor_5.0 6 138,621,231 - 138,621,383 UniSTS Rnor5.0 RGSC_v3.4 6 129,750,200 - 129,750,352 UniSTS RGSC3.4 Celera 6 122,068,381 - 122,068,533 UniSTS RH 3.4 Map 6 815.41 UniSTS Cytogenetic Map 6 q32 UniSTS
This gene Bdkrb2 is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
74
73
42
25
42
6
201
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000071735 ⟹ ENSRNOP00000064715
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 124,472,566 - 124,502,497 (+) Ensembl Rnor_6.0 Ensembl 6 129,399,468 - 129,429,676 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000074621 ⟹ ENSRNOP00000064990
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 124,472,625 - 124,502,497 (+) Ensembl Rnor_6.0 Ensembl 6 129,399,505 - 129,429,676 (+) Ensembl
RefSeq Acc Id:
NM_001270713 ⟹ NP_001257642
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 130,237,338 - 130,267,205 (+) NCBI mRatBN7.2 6 124,472,631 - 124,502,497 (+) NCBI Rnor_6.0 6 129,399,526 - 129,429,676 (+) NCBI Rnor_5.0 6 138,615,812 - 138,622,272 (+) NCBI Celera 6 122,039,584 - 122,069,422 (+) NCBI
Sequence:
GAATTCCGTTGCTGTCGGGGACTCCCTACAACACAGAACCGGCTCTCTAGAGAAAAGGACGATCCTCACTCGTCTTTGTCCTGAGTACAAATGCACTGTTCTTGGAAGCGACCCGTGCTCCTGTCCGT
hide sequence
RefSeq Acc Id:
NM_173100 ⟹ NP_775123
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 130,237,273 - 130,267,205 (+) NCBI mRatBN7.2 6 124,472,566 - 124,502,497 (+) NCBI Rnor_6.0 6 129,399,468 - 129,429,676 (+) NCBI Rnor_5.0 6 138,615,812 - 138,622,272 (+) NCBI RGSC_v3.4 6 129,744,781 - 129,748,851 (+) RGD Celera 6 122,039,524 - 122,069,422 (+) NCBI
Sequence:
GAGGAGAGTGAGTAGTACTGTTGGGGACGGCGTGGCAGGCAGTCGCTAGCCCTGGACCGAGGGA
hide sequence
RefSeq Acc Id:
XM_039111800 ⟹ XP_038967728
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 130,237,057 - 130,267,205 (+) NCBI mRatBN7.2 6 124,472,317 - 124,502,497 (+) NCBI
RefSeq Acc Id:
XM_039111801 ⟹ XP_038967729
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 130,237,055 - 130,267,205 (+) NCBI mRatBN7.2 6 124,472,342 - 124,502,497 (+) NCBI
RefSeq Acc Id:
XM_063261559 ⟹ XP_063117629
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 130,237,057 - 130,267,205 (+) NCBI
RefSeq Acc Id:
XM_063261560 ⟹ XP_063117630
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 130,237,057 - 130,267,205 (+) NCBI
RefSeq Acc Id:
NP_775123 ⟸ NM_173100
- Peptide Label:
isoform 2
- UniProtKB:
P25023 (UniProtKB/Swiss-Prot), A0A0H2UI29 (UniProtKB/TrEMBL), A6KBC4 (UniProtKB/TrEMBL)
- Sequence:
MHCSWKRPVLLSVHEPMPTTASLGIEMFNITTQALGSAHNGTFSEVNCPDTEWWSWLNAIQAPFLWVLFLLAALENIFVLSVFCLHKTNCTVAEIYLGNLAAADLILACGLPFWAITIANNFDWLFGE
hide sequence
RefSeq Acc Id:
NP_001257642 ⟸ NM_001270713
- Peptide Label:
isoform 1
- UniProtKB:
P25023 (UniProtKB/Swiss-Prot), G3V942 (UniProtKB/TrEMBL), A6KBC5 (UniProtKB/TrEMBL)
- Sequence:
MDTRSSLCPKTQAVVEVAMFWGPGCHLSTCIEMFNITTQALGSAHNGTFSEVNCPDTEWWSWLN
hide sequence
Ensembl Acc Id:
ENSRNOP00000064715 ⟸ ENSRNOT00000071735
Ensembl Acc Id:
ENSRNOP00000064990 ⟸ ENSRNOT00000074621
RefSeq Acc Id:
XP_038967728 ⟸ XM_039111800
- Peptide Label:
isoform X1
- UniProtKB:
P25023 (UniProtKB/Swiss-Prot), G3V942 (UniProtKB/TrEMBL), A6KBC5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038967729 ⟸ XM_039111801
- Peptide Label:
isoform X2
- UniProtKB:
P25023 (UniProtKB/Swiss-Prot), A0A0H2UI29 (UniProtKB/TrEMBL), A6KBC4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063117630 ⟸ XM_063261560
- Peptide Label:
isoform X1
- UniProtKB:
P25023 (UniProtKB/Swiss-Prot), A6KBC5 (UniProtKB/TrEMBL), G3V942 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063117629 ⟸ XM_063261559
- Peptide Label:
isoform X1
- UniProtKB:
P25023 (UniProtKB/Swiss-Prot), A6KBC5 (UniProtKB/TrEMBL), G3V942 (UniProtKB/TrEMBL)
RGD ID: 13694815 Promoter ID: EPDNEW_R5336 Type: single initiation site Name: Bdkrb2_1 Description: bradykinin receptor B2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 129,399,450 - 129,399,510 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-09-25
Bdkrb2
bradykinin receptor B2
Bdkrb2
bradykinin receptor, beta 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Bdkrb2
bradykinin receptor, beta 2
bradykinin receptor b2
Name updated
1299863 APPROVED
2002-06-10
Bdkrb2
Bradykinin receptor B2
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
expressed in uterus, vas deferens, kidney, lung, heart, ileum, testis, and brain
631709
gene_function
receptor
631709
gene_process
involved in pain response
631709
gene_product
member of seven transmembrane G protein-coupled superfamily of receptors
631709
gene_regulation
expression is higher in unstimulated, cultured cardiac fibroblasts from adult SHR rats than in those from WKY rats. After exposure of cells to IL-1 beta, expression is enhanced in cells of both strains to equivalent levels.
1358958
gene_transcript
mRNA exists in two splicing variants
631790
