Advanced Search (OLGA)

Gene: Shld1 (shieldin complex subunit 1) Rattus norvegicus

Analyze

Symbol:

Shld1

Name:

shieldin complex subunit 1

RGD ID:

1597982

Description:

Predicted to be involved in negative regulation of double-strand break repair via homologous recombination; positive regulation of double-strand break repair via nonhomologous end joining; and positive regulation of isotype switching. Predicted to be located in chromosome. Predicted to be active in site of double-strand break. Orthologous to human SHLD1 (shieldin complex subunit 1); INTERACTS WITH bisphenol A; glyphosate; N,N-diethyl-m-toluamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

hypothetical protein LOC681292; LOC681292; uncharacterized protein C20orf196 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SHLD1 (shieldin complex subunit 1)	HGNC	EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Mus musculus (house mouse):	Shld1 (shieldin complex subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Shld1 (shieldin complex subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SHLD1 (shieldin complex subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SHLD1 (shieldin complex subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Shld1 (shieldin complex subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SHLD1 (shieldin complex subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SHLD1 (shieldin complex subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Shld1 (shieldin complex subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SHLD1 (shieldin complex subunit 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Shld1 (shieldin complex subunit 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	140,391,611 - 140,462,273 (+)	NCBI		GRCr8
mRatBN7.2	3	119,938,695 - 120,011,068 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	119,938,833 - 120,009,550 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	123,835,517 - 123,904,504 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	132,435,661 - 132,508,126 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	130,091,651 - 130,160,637 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	125,318,682 - 125,396,705 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	125,320,680 - 125,396,821 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	131,866,490 - 131,880,804 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	120,453,601 - 120,537,113 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	118,726,603 - 118,794,859 (+)	NCBI		Celera
Cytogenetic Map	3	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Huntington's disease-like 1 (ISO)

Inosine Triphosphatase Deficiency (ISO)

pantothenate kinase-associated neurodegeneration (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

calcitriol (ISO)

cantharidin (ISO)

chlorpyrifos (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

dorsomorphin (ISO)

ethanol (ISO)

folic acid (ISO)

glyphosate (EXP)

hydrogen peroxide (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

N,N-diethyl-m-toluamide (EXP)

O-methyleugenol (ISO)

permethrin (EXP)

SB 431542 (ISO)

silicon dioxide (ISO)

sunitinib (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

thiram (ISO)

trichloroethene (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of double-strand break repair via homologous recombination (IBA,ISO)

positive regulation of double-strand break repair via nonhomologous end joining (IBA,ISO)

positive regulation of isotype switching (IBA,ISO)

Cellular Component

chromosome (ISO)

site of double-strand break (IBA,ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:29656893

Genomics

Comparative Map Data

Shld1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	140,391,611 - 140,462,273 (+)	NCBI		GRCr8
mRatBN7.2	3	119,938,695 - 120,011,068 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	119,938,833 - 120,009,550 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	123,835,517 - 123,904,504 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	132,435,661 - 132,508,126 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	130,091,651 - 130,160,637 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	125,318,682 - 125,396,705 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	125,320,680 - 125,396,821 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	131,866,490 - 131,880,804 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	120,453,601 - 120,537,113 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	118,726,603 - 118,794,859 (+)	NCBI		Celera
Cytogenetic Map	3	q36	NCBI

SHLD1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	5,750,193 - 5,864,395 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	5,750,393 - 5,864,395 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	5,731,047 - 5,845,041 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	5,679,043 - 5,792,558 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	20	5,802,650 - 5,916,186 (+)	NCBI		Celera
Cytogenetic Map	20	p12.3	NCBI
HuRef	20	5,688,686 - 5,801,246 (+)	NCBI		HuRef
CHM1_1	20	5,731,639 - 5,845,091 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	5,790,559 - 5,904,751 (+)	NCBI		T2T-CHM13v2.0

Shld1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	132,528,871 - 132,592,975 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	132,528,851 - 132,592,975 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	132,686,931 - 132,751,055 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	132,686,931 - 132,751,055 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	132,516,019 - 132,576,791 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	132,378,372 - 132,442,675 (+)	NCBI		MGSCv36	mm8
Celera	2	133,917,666 - 133,978,437 (+)	NCBI		Celera
Cytogenetic Map	2	F2	NCBI
cM Map	2	64.74	NCBI

Shld1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	16,180,051 - 16,280,864 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	16,180,074 - 16,282,937 (+)	NCBI	ChiLan1.0	ChiLan1.0

SHLD1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	6,681,096 - 6,785,874 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	6,677,921 - 6,782,700 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	5,753,262 - 5,858,728 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	5,537,989 - 5,642,107 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	5,537,488 - 5,642,107 (+)	Ensembl	panpan1.1		panPan2

SHLD1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	15,957,863 - 16,037,336 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	15,957,852 - 16,038,008 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	15,779,895 - 15,859,437 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	16,360,435 - 16,439,916 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	16,360,424 - 16,440,144 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	15,966,951 - 16,046,668 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	16,075,491 - 16,154,969 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	16,406,572 - 16,486,634 (-)	NCBI		UU_Cfam_GSD_1.0

Shld1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	164,746,083 - 164,836,687 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936485	13,176,426 - 13,267,953 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936485	13,179,218 - 13,267,980 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SHLD1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	14,610,817 - 14,707,872 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	14,610,723 - 14,706,082 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	15,738,204 - 15,765,607 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SHLD1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	32,265,882 - 32,381,411 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	32,265,788 - 32,381,395 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666071	12,157,627 - 12,273,635 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Shld1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624741	6,638,889 - 6,721,118 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624741	6,630,746 - 6,766,314 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Shld1
578 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	104
Count of miRNA genes:	94
Interacting mature miRNAs:	99
Transcripts:	ENSRNOT00000028891
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
7387306	Bw124	Body weight QTL 124	3.2	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	3	84091273	129091273	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	89772419	134772419	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
1358204	Insglur1	Insulin/glucose ratio QTL 1	3.8		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	3	115638168	135181505	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
1331758	Bp207	Blood pressure QTL 207	2.848		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	112287552	135181505	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001399552	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_002726181	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006224619	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008762239	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039106576	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284549	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284550	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284551	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028891 ⟹ ENSRNOP00000028891

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	119,940,210 - 120,009,550 (+)	Ensembl
Rnor_6.0 Ensembl	3	125,320,680 - 125,396,821 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102243 ⟹ ENSRNOP00000084844

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	119,938,833 - 120,009,550 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112341 ⟹ ENSRNOP00000084047

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	119,958,845 - 120,009,398 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117142 ⟹ ENSRNOP00000097270

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	119,941,752 - 120,009,550 (+)	Ensembl

RefSeq Acc Id:

NM_001399552 ⟹ NP_001386481

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	140,391,719 - 140,462,273 (+)	NCBI
mRatBN7.2	3	119,938,821 - 120,009,383 (+)	NCBI

RefSeq Acc Id:

XM_008762239 ⟹ XP_008760461

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	140,391,745 - 140,462,273 (+)	NCBI
mRatBN7.2	3	119,938,874 - 120,011,068 (+)	NCBI
Rnor_6.0	3	125,319,656 - 125,396,705 (+)	NCBI

Sequence:

show sequence

GGGATTAAAGGCGTGGGCTACCAGGGGTCTATTATAATTTTAAACAGCAGTCTTAGTAACCTTG
ATGTTTCCTTAAAATCTAAAGTGTAAACTACAGTCTGTTTTGTACATTAGCGGAGCTGTGCAAC
TTGGACTGTTCTCCCCACCCCAAAGAAAACTAACTGTTCTGAGGAACACAGTCCCGAGCATCGC
TCCGCCCACCACCTGCCCCTACCCCAGTCTGTCTCTGGAGCTGGCTCCATCGTGTACACTGCTA
GATGTTCCGTTTGTGTCTGTGACTCAGGACTGTGTGTTTCTTGTGATGTGACAGTGGATATTGT
TGTGCTGCCTTTCCCCTTGTCCTTCTTTCTTTTTCTTTCAGAATAGAAACTATGTGAATAGTTT
AGTGGTAAGGCAAGCCCTTGGTTTGTGTGCTTGAGGACCTGGGTTCGATCCCCCAGTTCCCCCT
GTCTCATCGTTTTCTCCTGACCCATTCGCCGACTCTCAGACAGTATGTTTAGAAGAACATGTGC
AGCTGCTTATTTTATGGTGCAAAGGATTCTGCTTTTCAGCACAATTTTTTTTGTTTCCTTTTGG
TCCAGTGCCCAGTCTGGGGTTTTGGGCATTTAAGTGATCCAAAATGCAAAGCAAGATTATCACC
TCAGGGATTCTTTTCATCAGTGACCTTCAGTTTGATGTTCTTTCAAGCCTCCTTTGAAGGCAAG
CAGAATATACTGGGCTCATCCATGACCTCTTCGCTCCCTTCCACAGGCCTCCAGTGCAGGGTTA
CATAACGGAAGCGGAAGCCAGAGGTGCCTTGCAGAGGTCCTGCTGAAGCTCCAAACTTGCTTAG
CTGTTAGAGCGCCCGCAGAGAGACGGGATGTTCTGTTTTTTGGAAACCTTATCTTTCCACTCCT
TTTAGAAGTGCTCAGCTGATACCTTGGCTGATCCTCTGCCTGAGCAAGTGTCTGCAGCATGTGA
CTGGATGTCCTCAAACAAGGACCTGGCCAGGCGTCAGTGTTGATTTGTTTTCTATACTTGCTGG
CTTTGCCTGATCAAGGTTATAGCACTGAGGCTGCTCAGACATGAGCGACTGAAGGCCTTCGAGC
TGGGCTCTTTCATTTGGGAGCAGCTTTTTAAAGTGTAAAGATAGGATTATCTGCAGCAGGAATG
GGGCTGTTGCCGGTGAAGCACTTGGTGTAGGGGTCGAATCTACTATACTGTTGACAAATGCCTA
TGGACTCCCAGGCAGCCACGCCCAGCAGCCTGTCCGAAGAGAGCTGTACCTTGGATCTACCTAT
GGTGTGTGACTCCATGGGTTATGAAGCATCCCAGGGAGCCAGCCAGGGAAGCGACAGCACCTCT
CTGAGTTCTCTGGAACCCCATCCTTTCCCTTCTTCTTCAACTGCCGATTCAGATAGCAATTCTC
TAACTACTGAGCAAAAAGGCTCCTGGGACTCTGAGAACTTCTGGCTTGATCCTTCTTCAAAAGG
CCAGGTGGAGACCAACGAAGAGGAGGATGGACTTCGGAAATCCCTGGATAGATTCTATGAAGCA
TTTGCCCAACCACTGCCAGGCTCTGGGGATCCGCTCTCTGCACCTGTGTGTCAGTGCCTGTCTC
AGACCATCTCTGAGCTCGAGGGCCAGGAGAGCCAAAAGTATGCTCTCCGCAGTTTCCAGATGGC
CCGGGTCATCTTCAGCCGGGATGGCTGCTCTACCTTACAGCGGCATTCCAGGGAAACCCGCTTC
TACCCACTAGAGCAAGAAGGCAGCTCTGTGGATGATGAAGAGCCCACCCCAGGACTGTCAAGAG
AGGTCATTCGTTTTCTCTTGGAACAGACCATAATGAAAGACTCATAGCTGGTGCTGATGTTGTG
AAAGTGCTGTCACCTGCTCCCCAGAGTCCATGGATGTGTGTAGCACATCTTTCTGTTTCCAC

hide sequence

RefSeq Acc Id:

XM_039106576 ⟹ XP_038962504

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	140,391,611 - 140,462,273 (+)	NCBI
mRatBN7.2	3	119,938,695 - 120,011,068 (+)	NCBI

RefSeq Acc Id:

XM_063284549 ⟹ XP_063140619

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	140,411,234 - 140,462,273 (+)	NCBI

RefSeq Acc Id:

XM_063284550 ⟹ XP_063140620

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	140,391,761 - 140,462,273 (+)	NCBI

RefSeq Acc Id:

XM_063284551 ⟹ XP_063140621

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	140,447,524 - 140,462,273 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001386481	(Get FASTA)	NCBI Sequence Viewer
	XP_008760461	(Get FASTA)	NCBI Sequence Viewer
	XP_038962504	(Get FASTA)	NCBI Sequence Viewer
	XP_063140619	(Get FASTA)	NCBI Sequence Viewer
	XP_063140620	(Get FASTA)	NCBI Sequence Viewer
	XP_063140621	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL80272	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000028891.5
	ENSRNOP00000084047.1
	ENSRNOP00000084844.1
	ENSRNOP00000097270.1

RefSeq Acc Id:	XP_008760461 ⟸ XM_008762239
- Peptide Label:	isoform X4
- UniProtKB:	D3ZVK4 (UniProtKB/TrEMBL), A0A8I6AUR4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPMDSQAATPSSLSEESCTLDLPMVCDSMGYEASQGASQGSDSTSLSSLEPHPFPSSSTADSDS NSLTTEQKGSWDSENFWLDPSSKGQVETNEEEDGLRKSLDRFYEAFAQPLPGSGDPLSAPVCQC LSQTISELEGQESQKYALRSFQMARVIFSRDGCSTLQRHSRETRFYPLEQEGSSVDDEEPTPGL SREVIRFLLEQTIMKDS hide sequence

Ensembl Acc Id:

ENSRNOP00000028891 ⟸ ENSRNOT00000028891

RefSeq Acc Id:	XP_038962504 ⟸ XM_039106576
- Peptide Label:	isoform X3
- UniProtKB:	A0A8I6AUR4 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000084844 ⟸ ENSRNOT00000102243

Ensembl Acc Id:

ENSRNOP00000097270 ⟸ ENSRNOT00000117142

Ensembl Acc Id:

ENSRNOP00000084047 ⟸ ENSRNOT00000112341

RefSeq Acc Id:	NP_001386481 ⟸ NM_001399552
- UniProtKB:	A0A8I6A0G4 (UniProtKB/TrEMBL), A6HQH1 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063140620 ⟸ XM_063284550
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063140619 ⟸ XM_063284549
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZYL2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063140621 ⟸ XM_063284551
- Peptide Label:	isoform X5

Protein Domains

Shieldin complex subunit 1 C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZVK4-F1-model_v2	AlphaFold	D3ZVK4	1-209	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1597982	AgrOrtholog
BioCyc Gene	G2FUF-47768	BioCyc
Ensembl Genes	ENSRNOG00000021268	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000028891.7	UniProtKB/TrEMBL
	ENSRNOT00000102243.1	UniProtKB/TrEMBL
	ENSRNOT00000112341.1	UniProtKB/TrEMBL
	ENSRNOT00000117142.1	UniProtKB/TrEMBL
InterPro	DUF4521	UniProtKB/TrEMBL
	SHLD1_C	UniProtKB/TrEMBL
NCBI Gene	681292	ENTREZGENE
PANTHER	PTHR36863	UniProtKB/TrEMBL
	SHIELDIN COMPLEX SUBUNIT 1	UniProtKB/TrEMBL
Pfam	DUF4521	UniProtKB/TrEMBL
PhenoGen	Shld1	PhenoGen
RatGTEx	ENSRNOG00000021268	RatGTEx
UniProt	A0A8I5ZYL2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A0G4	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AUR4	ENTREZGENE, UniProtKB/TrEMBL
	A6HQH1	ENTREZGENE, UniProtKB/TrEMBL
	D3ZVK4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-05-18	Shld1	shieldin complex subunit 1	LOC681292	hypothetical protein LOC681292	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	LOC681292	hypothetical protein LOC681292	LOC688129	hypothetical protein LOC688129	Data merged from RGD:1592430	1643240	APPROVED
2006-11-20	LOC681292	hypothetical protein LOC681292			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC688129	hypothetical protein LOC688129			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar