Advanced Search (OLGA)

Gene: Trim71 (tripartite motif containing 71) Rattus norvegicus

Analyze

Symbol:

Trim71

Name:

tripartite motif containing 71

RGD ID:

1566388

Description:

Predicted to enable miRNA binding activity; translation repressor activity; and ubiquitin protein ligase activity. Predicted to be involved in several processes, including G1/S transition of mitotic cell cycle; negative regulation of gene expression; and protein ubiquitination. Predicted to act upstream of with a positive effect on post-transcriptional regulation of gene expression. Predicted to act upstream of or within neural tube closure; positive regulation of miRNA-mediated gene silencing; and regulation of protein metabolic process. Predicted to be located in P-body. Human ortholog(s) of this gene implicated in hydrocephalus. Orthologous to human TRIM71 (tripartite motif containing 71); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; atrazine; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

B-box zinc finger, Filamin and NHL repeat containing protein (123.8 kD) (lin-41); Drosophila dappled/ vertebrate TRipartite Motif protein related; E3 ubiquitin-protein ligase TRIM71; LOC301042; protein lin-41 homolog; RGD1566388; RING-type E3 ubiquitin transferase TRIM71; similar to abnormal cell LINeage LIN-41, heterochronic gene; similar to abnormal cell LINeage LIN-41, heterochronic gene (Lin41); tripartite motif containing 71, E3 ubiquitin protein ligase; tripartite motif-containing 71; tripartite motif-containing protein 71

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TRIM71 (tripartite motif containing 71)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Trim71 (tripartite motif-containing 71)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Trim71 (tripartite motif containing 71)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TRIM71 (tripartite motif containing 71)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TRIM71 (tripartite motif containing 71)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Trim71 (tripartite motif containing 71)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TRIM71 (tripartite motif containing 71)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TRIM71 (tripartite motif containing 71)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Trim71 (tripartite motif containing 71)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Trim71 (tripartite motif containing 71)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TRIM71 (tripartite motif containing 71)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Trim71 (tripartite motif-containing 71)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	trim71 (tripartite motif containing 71, E3 ubiquitin protein ligase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	lin-41	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	lin-41	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	wech	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	trim71	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	trim71	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	nudcd1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	123,076,499 - 123,129,016 (-)	NCBI	GRCr8	GRCr8		GRCr8
mRatBN7.2	8	114,193,439 - 114,250,807 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	114,199,187 - 114,250,807 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	119,816,432 - 119,867,941 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	118,015,676 - 118,067,192 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	115,858,501 - 115,910,021 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	122,553,015 - 122,604,787 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	122,553,015 - 122,604,787 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	121,865,609 - 121,917,140 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	118,905,817 - 118,972,365 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	113,446,095 - 113,498,183 (-)	NCBI		Celera
Cytogenetic Map	8	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Congenital Communicating Hydrocephalus 1 (ISO)

COVID-19 (ISO)

CRYPTOZOOSPERMIA (ISO)

hydrocephalus (ISO,ISS)

spermatogenic failure 3 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

aldehydo-D-glucose (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (EXP)

cadmium dichloride (ISO)

caffeine (ISO)

choline (ISO)

D-glucose (ISO)

folic acid (ISO)

fulvestrant (ISO)

glucose (ISO)

L-methionine (ISO)

methapyrilene (ISO)

okadaic acid (ISO)

paracetamol (EXP)

resveratrol (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

titanium dioxide (ISO)

tributylstannane (EXP)

trichloroethene (EXP)

triclosan (ISO)

triptonide (ISO)

urethane (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

3'-UTR-mediated mRNA destabilization (ISO)

fibroblast growth factor receptor signaling pathway (ISO,ISS)

G1/S transition of mitotic cell cycle (ISO,ISS)

miRNA processing (ISO,ISS)

miRNA-mediated gene silencing by inhibition of translation (ISO,ISS)

negative regulation of translation (IEA,ISO)

neural tube closure (ISO)

neural tube development (ISO,ISS)

positive regulation of miRNA-mediated gene silencing (ISO)

post-transcriptional regulation of gene expression (IBA,ISO,ISS)

proteasome-mediated ubiquitin-dependent protein catabolic process (IBA)

protein autoubiquitination (ISO,ISS)

protein polyubiquitination (IBA)

protein ubiquitination (IEA)

regulation of miRNA-mediated gene silencing (ISO)

regulation of neural precursor cell proliferation (ISO,ISS)

regulation of protein metabolic process (ISO)

regulatory ncRNA-mediated gene silencing (IEA)

stem cell proliferation (ISO,ISS)

Cellular Component

P-body (IBA,IEA,ISO,ISS)

Molecular Function

metal ion binding (IEA)

miRNA binding (IBA,IEA,ISO,ISS)

protein binding (ISO)

RNA binding (IEA)

transferase activity (IEA)

translation repressor activity (ISO)

ubiquitin protein ligase activity (IBA,IEA,ISO)

ubiquitin-protein transferase activity (ISO,ISS)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:18604195	PMID:19098426	PMID:19898466	PMID:22508726	PMID:22735451	PMID:23125361	PMID:28431233

Genomics

Comparative Map Data

Trim71
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	123,076,499 - 123,129,016 (-)	NCBI	GRCr8	GRCr8		GRCr8
mRatBN7.2	8	114,193,439 - 114,250,807 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	114,199,187 - 114,250,807 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	119,816,432 - 119,867,941 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	118,015,676 - 118,067,192 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	115,858,501 - 115,910,021 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	122,553,015 - 122,604,787 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	122,553,015 - 122,604,787 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	121,865,609 - 121,917,140 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	118,905,817 - 118,972,365 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	113,446,095 - 113,498,183 (-)	NCBI		Celera
Cytogenetic Map	8	q32	NCBI

TRIM71
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	32,817,997 - 32,897,824 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	32,817,526 - 32,897,824 (+)	Ensembl			hg38	GRCh38
GRCh37	3	32,859,489 - 32,939,316 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	32,834,514 - 32,908,775 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	3	32,796,792 - 32,870,969 (+)	NCBI		Celera
Cytogenetic Map	3	p22.3	NCBI
HuRef	3	32,795,360 - 32,869,252 (+)	NCBI		HuRef
CHM1_1	3	32,809,475 - 32,883,728 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	32,816,172 - 32,895,937 (+)	NCBI		T2T-CHM13v2.0

Trim71
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	114,340,336 - 114,393,437 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	114,336,201 - 114,393,437 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	9	114,511,268 - 114,564,369 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	114,507,133 - 114,564,369 (-)	Ensembl			mm10	GRCm38
MGSCv37	9	114,163,741 - 114,214,213 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	9	114,361,343 - 114,411,815 (-)	NCBI		MGSCv36	mm8
Celera	9	114,985,559 - 115,054,772 (-)	NCBI		Celera
Cytogenetic Map	9	F3	NCBI
cM Map	9	64.54	NCBI

Trim71
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955421	97,772 - 168,432 (+)	Ensembl
ChiLan1.0	NW_004955421	97,130 - 174,326 (+)	NCBI	ChiLan1.0	ChiLan1.0

TRIM71
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	32,797,964 - 32,877,720 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	32,802,730 - 32,882,485 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	32,745,217 - 32,824,985 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	33,050,997 - 33,127,389 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	33,050,997 - 33,123,910 (+)	Ensembl			panPan2	panpan1.1

TRIM71
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	23	3,888,287 - 3,959,910 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	23	3,893,647 - 3,960,411 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	23	3,932,083 - 4,003,431 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	23	4,149,436 - 4,221,387 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	23	4,154,795 - 4,221,622 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	23	3,983,609 - 4,055,232 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	23	4,114,710 - 4,186,051 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	23	4,084,133 - 4,156,041 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Trim71
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	190,084,507 - 190,153,358 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936473	23,224,588 - 23,290,169 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936473	23,223,984 - 23,290,177 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TRIM71
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	18,761,950 - 18,831,564 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	18,762,043 - 18,835,788 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

TRIM71
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	77,319,064 - 77,396,036 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	77,319,148 - 77,390,066 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	50,696,403 - 50,770,434 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Trim71
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624788	10,859,932 - 10,929,029 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624788	10,858,490 - 10,929,693 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Trim71
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	8	105,117,306 - 105,166,695 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Trim71
389 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	27
Count of miRNA genes:	22
Interacting mature miRNAs:	27
Transcripts:	ENSRNOT00000047198
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	105462581	132782436	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	82352698	127352698	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	80768445	125768445	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	80768445	125768445	Rat
10450865	Bw175	Body weight QTL 175	4.1		total fat pad mass (VT:0015008)	adipose tissue molecular composition measurement (CMO:0000484)	8	84192326	129192326	Rat
724539	Cm19	Cardiac mass QTL 19	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	8	103375781	129871912	Rat
738011	Anxrr9	Anxiety related response QTL 9	6.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	8	102413464	132782436	Rat
1599689	Iddm24	Insulin dependent diabetes mellitus QTL 24	4.72	0.001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	8	122879213	126360737	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	55428333	127966348	Rat
634332	Pia18	Pristane induced arthritis QTL 18	4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	84192326	132782436	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	85348065	130348065	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	79394435	132782436	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	80768445	125768445	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	80768445	125768445	Rat
61437	Cia6	Collagen induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	91340911	131690273	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
11	7	29	89	43	49	26	25	26	3	184	76	11	74	65	88	23	8	8

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001191801	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039081294	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000047198 ⟹ ENSRNOP00000044089

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	114,199,187 - 114,250,807 (-)	Ensembl
Rnor_6.0 Ensembl	8	122,553,015 - 122,604,787 (-)	Ensembl

RefSeq Acc Id:

NM_001191801 ⟹ NP_001178730

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	123,077,400 - 123,129,016 (-)	NCBI
mRatBN7.2	8	114,199,187 - 114,250,807 (-)	NCBI
Rnor_6.0	8	122,553,015 - 122,604,787 (-)	NCBI
Rnor_5.0	8	121,865,609 - 121,917,140 (-)	NCBI
Celera	8	113,446,095 - 113,498,183 (-)	NCBI

Sequence:

show sequence

ATGGCTTCGTTCCCTGAGACCGACTTCCAGATCTGCCTGCTGTGCAAGGAGATGTGCGGCTCGC
CCGCGCCTCTCTCCTCCAGCTCGTCCGCCTCTTCATCGTCCTCGCAGACGTCCACGTCGTCGGC
GGGCGGCGGCGGCCCCGGGGCGGCGGCGCGGCGCCTGCACGTCCTGCCCTGCCTGCACGCCTTC
TGCCGGCCGTGCCTCGAGGCGCACCGGCTCCCGGCTCCCGGTGGCGCCGGCCCCGCCGAGGCGC
TGAAGCTGCGCTGTCCTGTGTGTGACCAGAAGGTGGTCCTGGCCGAGGCGGCAGGCATGGACGC
GCTGCCGTCGTCCGCCTTCCTGCTCAGCAACCTGCTGGACGCCGTGGTGGCCACCGCCGACGAG
CCGCCGCCCAAGAACGGGCGCGCGGGTGGCGGCCCCGGGGGCGCGGGCGGCCACAGCAATCACC
GGCACCACGCGCACCACCCGGCCCAGCGCGCCGCCGCTCCAGCGCCGCAGCCGCCGCCCGGCCC
GGCCGCTTCTCCAGGGTCGCTGTTGTTGCGCCGGCCGCACGGCTGCAGCTCCTGCGACGAGGGC
AATGCTGCCTCGTCGCGCTGCCTCGACTGCCAGGAACACCTGTGCGACAACTGTGTCCGCGCGC
ACCAGCGCGTACGCCTCACCAAGGACCACTACATCGAGCGCGGCCCGCCGGGGCCTGCGGCCGC
CTCCGCGGCGCAGCAGCTGGGGCTCGGGCCGCCCTTCGCAGGCGCGCCCTTCTCCATCCTCTCG
GTGTTCCCGGAGCGCCTCGGCTTCTGCCAACACCACGACGACGAGGTACTACATCTGTACTGCG
ACACCTGCTCCGTGCCCATCTGCAGAGAGTGCACACTGGGCCGCCATGGCGGCCACAGCTTCGC
CTACCTCCAGGACGCCCTACAGGACTCACGGGCACTCACCATCCAGCTGCTGGCCGACGCCCAG
CAGGGCCGCCAGGCCATTCAGCTGAGCATTGAGCAGGCGCAGACTGTGGCAGAACAAGTGGAGA
TGAAGGCCAAGGTGGTCCAGTCGGAGGTCAAGGCCGTCACGGCGAGACACAAGAAAGCTCTGGA
GGAGCGTGAGTGCGAGCTGCTGTGGAAGGTGGAGAAGATCCGGCAGGTGAAGGCTAAGTCTCTC
TACCTGCAGGTGGAGAAGCTGCGGCAGAATCTCAACAAGCTGGAGAGCACCATCAGCGCCGTCC
AGCAGGTCCTAGAAGAGGGCCGAGCCCTGGACATCCTGCTGGCCCGAGACCGGATGCTGGCTCA
GGTGCAGGAGCTCAAGACCATCCGGGGCCTCCTGCAGCCCCAGGAAGATGACCGAGTTATGTTC
ACACCCCCCGACCAGGCCCTGTACCTTGCCCTCAAGTCTTTTGGCTTTGTCAGCAGTGGGGCCT
TTGCCCCACTCACGAAGGCCGCGGGAGATGGCATCAAGCGAGCCCTTCAGGGAAAGGTGGCCTC
CTTCACTGTCATGGGCTATGACCACAATGGTGAGCCCCGCCTCTCAGGAGGTGACCTGATGTCG
GTGGTGGTCCTTGGCCCTGATGGAAACCTGTTTGGTGCAGAAGTGAGCGACCAGCAGAATGGGA
CCTACGTCGTGAGCTACAGGCCCCAGCTTGAGGGTGAACACTTGGTATCAGTGACGCTGTATAA
CCAGCACATCGAGAACAGCCCCTTCAAGGTAGTGGTCAAGTCGGGCCGCAGCTATGTGGGCATC
GGGCTCCCAGTGTTGAGCTTTGGCAGCGAGGGTGATGGCGAGGGTAAGCTCTGCAGGCCCTGGG
GCGTGAGTGTGGATAAGGAGGGCTACATCATCGTGGCTGACCGCAGCAATAACAGAATTCAGGT
GTTTAAGCCCTGTGGGTCTTTCCACCACAAGTTTGGTACCCTAGGATCTCGGCCCGGGCAGTTT
GACCGACCGGCGGGGGTGGCCTGCGACGCCTCCCGCAGGATCGTGGTGGCCGACAAAGACAATC
ATCGCATCCAGATCTTCACCTTCGAGGGCCAGTTCCTTCTGAAGTTTGGCGAGAAAGGAACCAA
GAATGGGCAGTTTAACTACCCGTGGGATGTAGCGGTCAACTCTGAGGGCAAGATCCTGGTTTCA
GACACCCGAAACCACCGCATCCAGCTGTTCGGACCCGACGGCGTCTTCCTGAATAAGTATGGCT
TCGAGGGATCTCTCTGGAAGCACTTCGACTCCCCACGGGGCGTGGCTTTCAACCATGAAGGTCA
CCTGGTAGTCACTGATTTCAACAACCATCGGCTCCTGGTTATCCACCCCGATTGCCAGTCTGCC
CGCTTCCTGGGCTCTGAGGGCACTGGCAATGGGCAGTTCCTGCGACCACAGGGTGTGGCTGTAG
ACCAGGAAGGGCGAATCATTGTCGCCGATTCCAGAAATCACCGTGTGCAGATGTTTGAGGCCAA
CGGCAGCTTCCTGTGCAAGTTCGGTGCTCAAGGCAGCGGCTTCGGGCAGATGGACCGCCCCTCA
GGTATCGCGGTCACCCCGGAAGGATTGATCGTCGTGGTGGACTTTGGCAACAATCGAATCCTCA
TCTTCTAA

hide sequence

RefSeq Acc Id:

XM_039081294 ⟹ XP_038937222

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	123,076,499 - 123,094,081 (-)	NCBI
mRatBN7.2	8	114,193,439 - 114,215,334 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001178730	(Get FASTA)	NCBI Sequence Viewer
	XP_038937222	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	D3ZVM4	(Get FASTA)	NCBI Sequence Viewer
	EDL76988	(Get FASTA)	NCBI Sequence Viewer
	EDL76989	(Get FASTA)	NCBI Sequence Viewer
	EDL76990	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000044089.3

RefSeq Acc Id:

NP_001178730 ⟸ NM_001191801

- UniProtKB:

D3ZVM4 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MASFPETDFQICLLCKEMCGSPAPLSSSSSASSSSSQTSTSSAGGGGPGAAARRLHVLPCLHAF
CRPCLEAHRLPAPGGAGPAEALKLRCPVCDQKVVLAEAAGMDALPSSAFLLSNLLDAVVATADE
PPPKNGRAGGGPGGAGGHSNHRHHAHHPAQRAAAPAPQPPPGPAASPGSLLLRRPHGCSSCDEG
NAASSRCLDCQEHLCDNCVRAHQRVRLTKDHYIERGPPGPAAASAAQQLGLGPPFAGAPFSILS
VFPERLGFCQHHDDEVLHLYCDTCSVPICRECTLGRHGGHSFAYLQDALQDSRALTIQLLADAQ
QGRQAIQLSIEQAQTVAEQVEMKAKVVQSEVKAVTARHKKALEERECELLWKVEKIRQVKAKSL
YLQVEKLRQNLNKLESTISAVQQVLEEGRALDILLARDRMLAQVQELKTIRGLLQPQEDDRVMF
TPPDQALYLALKSFGFVSSGAFAPLTKAAGDGIKRALQGKVASFTVMGYDHNGEPRLSGGDLMS
VVVLGPDGNLFGAEVSDQQNGTYVVSYRPQLEGEHLVSVTLYNQHIENSPFKVVVKSGRSYVGI
GLPVLSFGSEGDGEGKLCRPWGVSVDKEGYIIVADRSNNRIQVFKPCGSFHHKFGTLGSRPGQF
DRPAGVACDASRRIVVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGKILVS
DTRNHRIQLFGPDGVFLNKYGFEGSLWKHFDSPRGVAFNHEGHLVVTDFNNHRLLVIHPDCQSA
RFLGSEGTGNGQFLRPQGVAVDQEGRIIVADSRNHRVQMFEANGSFLCKFGAQGSGFGQMDRPS
GIAVTPEGLIVVVDFGNNRILIF

hide sequence

Ensembl Acc Id:

ENSRNOP00000044089 ⟸ ENSRNOT00000047198

RefSeq Acc Id:	XP_038937222 ⟸ XM_039081294
- Peptide Label:	isoform X1
- UniProtKB:	A6I3N8 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZVM4-F1-model_v2	AlphaFold	D3ZVM4	1-855	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1566388	AgrOrtholog
BioCyc Gene	G2FUF-28923	BioCyc
Ensembl Genes	ENSRNOG00000030098	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000047198.4	UniProtKB/Swiss-Prot
Gene3D-CATH	2.120.10.30	UniProtKB/Swiss-Prot
	2.60.40.10	UniProtKB/Swiss-Prot
	3.30.40.10	UniProtKB/Swiss-Prot
	Classic Zinc Finger	UniProtKB/Swiss-Prot
InterPro	6-blade_b-propeller_TolB-like	UniProtKB/Swiss-Prot
	Filamin/ABP280_repeat-like	UniProtKB/Swiss-Prot
	Filamin/ABP280_rpt	UniProtKB/Swiss-Prot
	Ig-like_fold	UniProtKB/Swiss-Prot
	Ig_E-set	UniProtKB/Swiss-Prot
	NHL_repeat	UniProtKB/Swiss-Prot
	TRIM-NHL_E3_ligases	UniProtKB/Swiss-Prot
	Znf_B-box	UniProtKB/Swiss-Prot
	Znf_C3HC4_RING-type	UniProtKB/Swiss-Prot
	Znf_RING	UniProtKB/Swiss-Prot
	Znf_RING/FYVE/PHD	UniProtKB/Swiss-Prot
	Znf_RING_CS	UniProtKB/Swiss-Prot
KEGG Report	rno:301042	UniProtKB/Swiss-Prot
NCBI Gene	301042	ENTREZGENE
PANTHER	E3 UBIQUITIN-PROTEIN LIGASE NHLRC1-RELATED	UniProtKB/Swiss-Prot
	PROTEIN LIN-41	UniProtKB/Swiss-Prot
Pfam	Filamin	UniProtKB/Swiss-Prot
	NHL	UniProtKB/Swiss-Prot
	zf-B_box	UniProtKB/Swiss-Prot
	zf-C3HC4	UniProtKB/Swiss-Prot
PhenoGen	Trim71	PhenoGen
PROSITE	FILAMIN_REPEAT	UniProtKB/Swiss-Prot
	NHL	UniProtKB/Swiss-Prot
	ZF_BBOX	UniProtKB/Swiss-Prot
	ZF_RING_1	UniProtKB/Swiss-Prot
	ZF_RING_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000030098	RatGTEx
SMART	BBOX	UniProtKB/Swiss-Prot
	IG_FLMN	UniProtKB/Swiss-Prot
	RING	UniProtKB/Swiss-Prot
Superfamily-SCOP	B-box zinc-binding domain	UniProtKB/Swiss-Prot
	NHL repeat	UniProtKB/Swiss-Prot
	RING/U-box	UniProtKB/Swiss-Prot
	SSF81296	UniProtKB/Swiss-Prot
UniProt	A6I3N8	ENTREZGENE, UniProtKB/TrEMBL
	D3ZVM4	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-07-07	Trim71	tripartite motif containing 71	Trim71	tripartite motif containing 71, E3 ubiquitin protein ligase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-10-16	Trim71	tripartite motif containing 71, E3 ubiquitin protein ligase	Trim71	tripartite motif-containing 71	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	Trim71	tripartite motif-containing 71	RGD1566388_predicted	similar to abnormal cell LINeage LIN-41, heterochronic gene (Lin41) (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-10	RGD1566388_predicted	similar to abnormal cell LINeage LIN-41, heterochronic gene (Lin41) (predicted)		similar to abnormal cell LINeage LIN-41, heterochronic gene; Drosophila dappled/ vertebrate TRipartite Motif protein related; B-box zinc finger, Filamin and NHL repeat containing protein (123.8 kD) (lin-41) (predicted)	Name updated	1299863	APPROVED
2006-03-07	RGD1566388_predicted	similar to abnormal cell LINeage LIN-41, heterochronic gene; Drosophila dappled/ vertebrate TRipartite Motif protein related; B-box zinc finger, Filamin and NHL repeat containing protein (123.8 kD) (lin-41) (predicted)	LOC301042	similar to abnormal cell LINeage LIN-41, heterochronic gene; Drosophila dappled/ vertebrate TRipartite Motif protein related; B-box zinc finger, Filamin and NHL repeat containing protein (123.8 kD) (lin-41)	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC301042	similar to abnormal cell LINeage LIN-41, heterochronic gene; Drosophila dappled/ vertebrate TRipartite Motif protein related; B-box zinc finger, Filamin and NHL repeat containing protein (123.8 kD) (lin-41)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM