Symbol:
Clcc1
Name:
chloride channel CLIC-like 1
RGD ID:
708359
Description:
Enables chloride channel activity. Involved in chloride transport. Located in Golgi apparatus; endoplasmic reticulum; and nucleus. Human ortholog(s) of this gene implicated in retinitis pigmentosa 32. Orthologous to human CLCC1 (chloride channel CLIC like 1); INTERACTS WITH 2,6-dinitrotoluene; 3,4-methylenedioxymethamphetamine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
chloride channel CLIC-like protein 1; ER anion channel 1; ERAC1; LOC170927; Mclc; Mid-1-related chloride channel 1; mid-1-related chloride channel protein 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 198,984,455 - 199,015,015 (+) NCBI GRCr8 mRatBN7.2 2 196,296,350 - 196,326,914 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 196,296,393 - 196,326,913 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 203,940,058 - 203,964,771 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 201,822,001 - 201,846,740 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 196,638,975 - 196,663,716 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 211,450,426 - 211,479,885 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 211,450,484 - 211,479,884 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 230,923,372 - 230,952,836 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 204,245,357 - 204,278,530 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 204,208,110 - 204,241,283 (+) NCBI Celera 2 188,943,040 - 188,970,221 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Clcc1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 198,984,455 - 199,015,015 (+) NCBI GRCr8 mRatBN7.2 2 196,296,350 - 196,326,914 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 196,296,393 - 196,326,913 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 203,940,058 - 203,964,771 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 201,822,001 - 201,846,740 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 196,638,975 - 196,663,716 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 211,450,426 - 211,479,885 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 211,450,484 - 211,479,884 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 230,923,372 - 230,952,836 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 204,245,357 - 204,278,530 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 204,208,110 - 204,241,283 (+) NCBI Celera 2 188,943,040 - 188,970,221 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
CLCC1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 108,929,505 - 108,963,484 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 108,881,885 - 108,963,527 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 109,472,127 - 109,506,106 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 109,273,653 - 109,307,634 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 107,741,688 - 107,775,523 (-) NCBI Celera Cytogenetic Map 1 p13.3 NCBI HuRef 1 107,364,991 - 107,398,998 (-) NCBI HuRef CHM1_1 1 109,587,075 - 109,621,067 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 108,962,861 - 108,996,846 (-) NCBI T2T-CHM13v2.0
Clcc1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 108,561,194 - 108,586,156 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 108,561,229 - 108,586,156 (+) Ensembl GRCm39 Ensembl GRCm38 3 108,653,878 - 108,678,840 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 108,653,913 - 108,678,840 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 108,456,831 - 108,481,758 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 108,782,303 - 108,806,068 (+) NCBI MGSCv36 mm8 Celera 3 110,988,607 - 111,013,587 (+) NCBI Celera Cytogenetic Map 3 F3 NCBI cM Map 3 47.49 NCBI
Clcc1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955435 12,387,575 - 12,408,801 (-) NCBI ChiLan1.0 ChiLan1.0
CLCC1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 118,340,064 - 118,371,568 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 117,500,106 - 117,531,651 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 111,309,680 - 111,340,851 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 110,474,158 - 110,505,626 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 110,473,752 - 110,505,613 (-) Ensembl panpan1.1 panPan2
CLCC1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 42,807,432 - 42,829,317 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 42,807,064 - 42,829,273 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 45,582,407 - 45,604,915 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 43,139,838 - 43,162,167 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 43,139,894 - 43,162,212 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 42,870,406 - 42,892,709 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 42,828,824 - 42,851,132 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 43,270,389 - 43,292,703 (+) NCBI UU_Cfam_GSD_1.0
Clcc1
CLCC1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 111,080,682 - 111,101,303 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 111,080,648 - 111,101,007 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 121,572,770 - 121,592,914 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CLCC1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 24,627,309 - 24,657,684 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 24,610,854 - 24,655,653 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 33,694,780 - 33,732,055 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Clcc1
.
Predicted Target Of
Count of predictions: 1011 Count of miRNA genes: 310 Interacting mature miRNAs: 402 Transcripts: ENSRNOT00000027617, ENSRNOT00000051701, ENSRNOT00000055859 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 61458 Bp10 Blood pressure QTL 10 3.42 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189020722 215287351 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 1302793 Bw16 Body weight QTL 16 5 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 2 157142209 202446871 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 2317752 Glom23 Glomerulus QTL 23 3.6 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 2 193452645 245889826 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 4889834 Pur24 Proteinuria QTL 24 5.8 0.014 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 2 184114274 202447032 Rat 1359031 Bp275 Blood pressure QTL 275 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 185876309 219753474 Rat 1581499 Esta2 Estrogen-induced thymic atrophy QTL 2 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 189599258 226936289 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 9589044 Scfw1 Subcutaneous fat weight QTL 1 5.8 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 2 182171407 227171407 Rat 8694435 Bw166 Body weight QTL 166 14.08 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 2 182171407 227171407 Rat 2301966 Bp322 Blood pressure QTL 322 3.58 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150540301 202447032 Rat 1298083 Bp158 Blood pressure QTL 158 2.62 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189020722 215287351 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1331745 Bp203 Blood pressure QTL 203 4.377 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 189599258 218414891 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 8694194 Abfw1 Abdominal fat weight QTL 1 11.7 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 2 182171407 227171407 Rat 61366 Iddm3 Insulin dependent diabetes mellitus QTL 3 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 189599258 234599258 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 2300189 Bmd48 Bone mineral density QTL 48 5.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 179335906 224335906 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 2301408 Kidm36 Kidney mass QTL 36 0.002 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 190613715 226808892 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150341684 202446871 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 738013 Alc15 Alcohol consumption QTL 15 4.1 0.00022 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 2 184165752 229165752 Rat 61398 Bp50 Blood pressure QTL 50 4.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189599258 234599258 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 1354609 Niddm62 Non-insulin dependent diabetes mellitus QTL 62 4.72 0.000006 insulin secretion trait (VT:0003564) plasma insulin level (CMO:0000342) 2 150540301 202447032 Rat 61417 Cia10 Collagen induced arthritis QTL 10 3.4 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 2 179946951 224946951 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 8694383 Bw158 Body weight QTL 158 7.69 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 2 182171407 227171407 Rat 7488927 Bp365 Blood pressure QTL 365 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 162765032 207765032 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 7488925 Bp364 Blood pressure QTL 364 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 160564068 205564068 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 2293084 Iddm26 Insulin dependent diabetes mellitus QTL 26 2.9 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 174930955 213594495 Rat
RH131755
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 196,326,624 - 196,326,804 (+) MAPPER mRatBN7.2 Rnor_6.0 2 211,479,596 - 211,479,775 NCBI Rnor6.0 Rnor_5.0 2 230,952,547 - 230,952,726 UniSTS Rnor5.0 RGSC_v3.4 2 204,278,241 - 204,278,420 UniSTS RGSC3.4 Celera 2 188,969,932 - 188,970,111 UniSTS RH 3.4 Map 2 1398.5 UniSTS Cytogenetic Map 2 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000027617 ⟹ ENSRNOP00000027617
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 196,306,297 - 196,325,036 (+) Ensembl Rnor_6.0 Ensembl 2 211,460,373 - 211,478,007 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000051701 ⟹ ENSRNOP00000042185
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 196,296,393 - 196,326,913 (+) Ensembl Rnor_6.0 Ensembl 2 211,450,484 - 211,479,884 (+) Ensembl
RefSeq Acc Id:
NM_133414 ⟹ NP_596905
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 198,984,511 - 199,015,015 (+) NCBI mRatBN7.2 2 196,296,406 - 196,326,914 (+) NCBI Rnor_6.0 2 211,450,484 - 211,479,885 (+) NCBI Rnor_5.0 2 230,923,372 - 230,952,836 (+) NCBI RGSC_v3.4 2 204,245,357 - 204,278,530 (+) RGD Celera 2 188,943,040 - 188,970,221 (+) RGD
Sequence:
GGCACGAGCAGGACTTCTGCGCGAGCGCACGTTGTCTGAGCCTTGCTCAGGATGCTGTGTTCACTGCTCCTTTGTGGATGTCTGTTACTGATCACTGGTTATGCTCATGACGATGACTGGATTGACCC
hide sequence
RefSeq Acc Id:
XM_006233128 ⟹ XP_006233190
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 198,984,489 - 199,015,015 (+) NCBI mRatBN7.2 2 196,296,367 - 196,326,914 (+) NCBI Rnor_6.0 2 211,450,452 - 211,479,885 (+) NCBI Rnor_5.0 2 230,923,372 - 230,952,836 (+) NCBI
Sequence:
AGCTGCGGTCCGAGTGAGTCGATGAGTGGGCTCAGGACTTCTGCGCGAGCGCACGTTGTCTGAGGTAGGCGGCTGGGCGTCTTCTGCGTCTGGGCTGGCCCCGGTCGCTCTGGAAGAGCAGGCAGGAC
hide sequence
RefSeq Acc Id:
XM_017590597 ⟹ XP_017446086
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 198,984,489 - 199,015,015 (+) NCBI mRatBN7.2 2 196,296,366 - 196,326,914 (+) NCBI Rnor_6.0 2 211,450,451 - 211,479,885 (+) NCBI
Sequence:
CAGCTGCGGTCCGAGTGAGTCGATGAGTGGGCTCAGGACTTCTGCGCGAGCGCACGTTGTCTGAGGTAGGCGGCTGGGCGTCTTCTGCGTCTGGGCTGGCCCCGGTCGCTCTGGAAGAGCAGGCAGGA
hide sequence
RefSeq Acc Id:
XM_063281217 ⟹ XP_063137287
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 198,984,455 - 199,015,015 (+) NCBI
RefSeq Acc Id:
NP_596905 ⟸ NM_133414
- Peptide Label:
precursor
- UniProtKB:
Q9WU61 (UniProtKB/Swiss-Prot), Q8VIF1 (UniProtKB/Swiss-Prot), Q8VIF0 (UniProtKB/Swiss-Prot), Q8VIE9 (UniProtKB/Swiss-Prot), Q8VIE8 (UniProtKB/Swiss-Prot), Q66HQ5 (UniProtKB/Swiss-Prot), A0A140TAF5 (UniProtKB/TrEMBL), A6HV18 (UniProtKB/TrEMBL)
- Sequence:
MLCSLLLCGCLLLITGYAHDDDWIDPTDMLNYDAASGTMRKSQAKYGTSEKKEVNPGLSDAQELSDCLQRLDSLTHKVDDCEKKKMKDYESQSNPVFRRYLNKILIEAGKLGLPDEDRVDVRYDAEIL
hide sequence
RefSeq Acc Id:
XP_006233190 ⟸ XM_006233128
- Peptide Label:
isoform X1
- UniProtKB:
Q8VIF1 (UniProtKB/Swiss-Prot), Q8VIF0 (UniProtKB/Swiss-Prot), Q8VIE9 (UniProtKB/Swiss-Prot), Q8VIE8 (UniProtKB/Swiss-Prot), Q66HQ5 (UniProtKB/Swiss-Prot), Q9WU61 (UniProtKB/Swiss-Prot), A0A140TAF5 (UniProtKB/TrEMBL), A6HV18 (UniProtKB/TrEMBL)
- Sequence:
MLCSLLLCGCLLLITGYAHDDDWIDPTDMLNYDAASGTMRKSQAKYGTSEKKEVNPDLSDAQEL
hide sequence
RefSeq Acc Id:
XP_017446086 ⟸ XM_017590597
- Peptide Label:
isoform X2
- UniProtKB:
A6HV21 (UniProtKB/TrEMBL), A6HV24 (UniProtKB/TrEMBL)
- Sequence:
MLCSLLLCGCLLLITGYAHDDDWIDPTDMLNYDAASGTMRKSQAKYGTSEKKEVNPDLSDAQELSDCLQRLDSLTHKVDDCEKKKMKDYESQSNPVFRRYLNKILIEAGKLGLPDEDRVDVRYDAEIL
hide sequence
Ensembl Acc Id:
ENSRNOP00000042185 ⟸ ENSRNOT00000051701
Ensembl Acc Id:
ENSRNOP00000027617 ⟸ ENSRNOT00000027617
RefSeq Acc Id:
XP_063137287 ⟸ XM_063281217
- Peptide Label:
isoform X1
- UniProtKB:
Q9WU61 (UniProtKB/Swiss-Prot), Q8VIF1 (UniProtKB/Swiss-Prot), Q8VIF0 (UniProtKB/Swiss-Prot), Q8VIE9 (UniProtKB/Swiss-Prot), Q8VIE8 (UniProtKB/Swiss-Prot), Q66HQ5 (UniProtKB/Swiss-Prot), A0A140TAF5 (UniProtKB/TrEMBL), A6HV18 (UniProtKB/TrEMBL)
RGD ID: 13691687 Promoter ID: EPDNEW_R2212 Type: initiation region Name: Clcc1_1 Description: chloride channel CLIC-like 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 211,450,475 - 211,450,535 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Clcc1
chloride channel CLIC-like 1
Mclc
Mid-1-related chloride channel 1
Symbol and Name updated
1299863 APPROVED
2005-07-08
Mclc
Mid-1-related chloride channel 1
LOC170927
Symbol updated
1299863 APPROVED
