Symbol:
Scg3
Name:
secretogranin III
RGD ID:
621209
Description:
Predicted to be involved in protein localization to secretory granule. Predicted to be located in extracellular region and transport vesicle membrane. Predicted to be active in secretory granule membrane. Orthologous to human SCG3 (secretogranin III); INTERACTS WITH 6-propyl-2-thiouracil; amitrole; ammonium chloride.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1B1075; secretogranin-3; SgIII
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SCG3 (secretogranin III) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Scg3 (secretogranin III) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Scg3 (secretogranin III) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SCG3 (secretogranin III) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SCG3 (secretogranin III) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Scg3 (secretogranin III) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SCG3 (secretogranin III) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SCG3 (secretogranin III) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Scg3 (secretogranin III) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SCG3 (secretogranin III)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Scg3 (secretogranin III)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
scg3 (secretogranin III)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
scg3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 85,280,253 - 85,322,484 (-) NCBI GRCr8 mRatBN7.2 8 76,399,777 - 76,442,015 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 76,399,777 - 76,442,015 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 81,907,241 - 81,955,800 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 80,172,086 - 80,214,605 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 78,006,582 - 78,055,133 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 82,582,352 - 82,641,536 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 82,582,352 - 82,641,536 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 82,183,497 - 82,242,336 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 80,467,921 - 80,514,192 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 80,495,390 - 80,533,246 (-) NCBI Celera 8 76,189,600 - 76,231,758 (-) NCBI Celera Cytogenetic Map 8 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Scg3 Rat 17alpha-ethynylestradiol multiple interactions ISO Scg3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SCG3 mRNA CTD PMID:17942748 Scg3 Rat 17alpha-ethynylestradiol increases expression ISO Scg3 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of SCG3 mRNA CTD PMID:17942748 Scg3 Rat 17beta-estradiol increases expression ISO Scg3 (Mus musculus) 6480464 Estradiol results in increased expression of SCG3 mRNA CTD PMID:19484750 Scg3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Scg3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SCG3 mRNA CTD PMID:17942748 Scg3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Scg3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SCG3 mRNA CTD PMID:24680724 Scg3 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Scg3 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Scg3 Rat 4-hydroxyphenyl retinamide decreases expression ISO Scg3 (Mus musculus) 6480464 Fenretinide results in decreased expression of SCG3 mRNA CTD PMID:28973697 Scg3 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SCG3 mRNA CTD PMID:30047161 Scg3 Rat all-trans-retinoic acid decreases expression ISO SCG3 (Homo sapiens) 6480464 Tretinoin results in decreased expression of SCG3 mRNA CTD PMID:21934132 Scg3 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of SCG3 mRNA CTD PMID:30047161 Scg3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SCG3 mRNA CTD PMID:16483693 Scg3 Rat antirheumatic drug decreases expression ISO SCG3 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of SCG3 mRNA CTD PMID:24449571 Scg3 Rat belinostat increases expression ISO SCG3 (Homo sapiens) 6480464 belinostat results in increased expression of SCG3 mRNA CTD PMID:26272509 Scg3 Rat belinostat multiple interactions ISO SCG3 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SCG3 mRNA CTD PMID:27188386 Scg3 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of SCG3 mRNA CTD PMID:21839799 Scg3 Rat benzo[a]pyrene affects methylation ISO SCG3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SCG3 5' UTR and Benzo(a)pyrene affects the methylation of SCG3 promoter CTD PMID:27901495 Scg3 Rat benzo[a]pyrene decreases expression ISO SCG3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of SCG3 mRNA CTD PMID:22316170 Scg3 Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of SCG3 mRNA CTD PMID:31199487 Scg3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SCG3 mRNA CTD PMID:25181051 Scg3 Rat bisphenol A decreases expression ISO Scg3 (Mus musculus) 6480464 bisphenol A results in decreased expression of SCG3 mRNA CTD PMID:32156529 Scg3 Rat bisphenol A multiple interactions ISO SCG3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of SCG3 gene CTD PMID:31601247 Scg3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SCG3 mRNA CTD PMID:34973380 Scg3 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of SCG3 gene CTD PMID:28505145 Scg3 Rat Butylbenzyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of SCG3 mRNA CTD PMID:31199487 Scg3 Rat CGP 52608 multiple interactions ISO SCG3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SCG3 gene] CTD PMID:28238834 Scg3 Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of SCG3 mRNA CTD PMID:18668222 Scg3 Rat cyclophosphamide decreases expression ISO Scg3 (Mus musculus) 6480464 Cyclophosphamide results in decreased expression of SCG3 mRNA CTD PMID:15331540 Scg3 Rat dibutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of SCG3 mRNA CTD PMID:31199487 Scg3 Rat diethyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of SCG3 mRNA CTD PMID:31199487 Scg3 Rat diisobutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of SCG3 mRNA CTD PMID:31199487 Scg3 Rat diisononyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of SCG3 mRNA CTD PMID:31199487 Scg3 Rat dorsomorphin multiple interactions ISO SCG3 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Scg3 Rat entinostat decreases expression ISO SCG3 (Homo sapiens) 6480464 entinostat results in decreased expression of SCG3 mRNA CTD PMID:27188386 Scg3 Rat entinostat multiple interactions ISO SCG3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SCG3 mRNA CTD PMID:27188386 Scg3 Rat entinostat increases expression ISO SCG3 (Homo sapiens) 6480464 entinostat results in increased expression of SCG3 mRNA CTD PMID:26272509 Scg3 Rat ethanol decreases expression ISO Scg3 (Mus musculus) 6480464 Ethanol results in decreased expression of SCG3 mRNA CTD PMID:15513904 Scg3 Rat ethanol affects splicing ISO Scg3 (Mus musculus) 6480464 Ethanol affects the splicing of SCG3 mRNA CTD PMID:30319688 Scg3 Rat ethanol increases expression ISO Scg3 (Mus musculus) 6480464 Ethanol results in increased expression of SCG3 mRNA CTD PMID:30319688 Scg3 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of SCG3 mRNA CTD PMID:18035473 Scg3 Rat fulvestrant multiple interactions ISO SCG3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of SCG3 gene CTD PMID:31601247 Scg3 Rat lead(0) affects splicing ISO SCG3 (Homo sapiens) 6480464 Lead affects the splicing of SCG3 mRNA CTD PMID:28903495 Scg3 Rat mercury atom increases expression ISO SCG3 (Homo sapiens) 6480464 Mercury results in increased expression of SCG3 mRNA CTD PMID:16823088 Scg3 Rat mercury(0) increases expression ISO SCG3 (Homo sapiens) 6480464 Mercury results in increased expression of SCG3 mRNA CTD PMID:16823088 Scg3 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of SCG3 mRNA CTD PMID:30047161 Scg3 Rat methylmercury chloride increases expression ISO SCG3 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of SCG3 mRNA CTD PMID:28001369 Scg3 Rat mono(2-ethylhexyl) phthalate decreases expression ISO Scg3 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of SCG3 mRNA CTD PMID:22401849 Scg3 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine increases expression ISO SCG3 (Homo sapiens) 6480464 N more ... CTD PMID:19013360 Scg3 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of SCG3 mRNA CTD PMID:33484710 Scg3 Rat panobinostat multiple interactions ISO SCG3 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SCG3 mRNA CTD PMID:27188386 Scg3 Rat panobinostat increases expression ISO SCG3 (Homo sapiens) 6480464 panobinostat results in increased expression of SCG3 mRNA CTD PMID:26272509 Scg3 Rat paraquat multiple interactions ISO SCG3 (Homo sapiens) 6480464 benzyloxycarbonyl-valyl-alanyl-aspartic acid deficiency inhibits the reaction [Paraquat results in decreased expression of SCG3 protein] more ... CTD PMID:22987761 and PMID:30280190 Scg3 Rat paraquat increases expression ISO SCG3 (Homo sapiens) 6480464 Paraquat results in increased expression of SCG3 mRNA CTD PMID:30280190 Scg3 Rat paraquat decreases expression ISO SCG3 (Homo sapiens) 6480464 Paraquat results in decreased expression of SCG3 mRNA CTD PMID:22987761 Scg3 Rat potassium dichromate decreases expression ISO Scg3 (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of SCG3 mRNA CTD PMID:23608068 Scg3 Rat SB 431542 multiple interactions ISO SCG3 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Scg3 Rat silicon dioxide increases expression ISO SCG3 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of SCG3 mRNA CTD PMID:25895662 Scg3 Rat sodium arsenite increases expression ISO Scg3 (Mus musculus) 6480464 sodium arsenite results in increased expression of SCG3 mRNA CTD PMID:37682722 Scg3 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of SCG3 mRNA CTD PMID:30047161 Scg3 Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of SCG3 protein CTD PMID:35544339 Scg3 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of SCG3 mRNA CTD PMID:23411599 Scg3 Rat titanium dioxide decreases methylation ISO Scg3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SCG3 promoter CTD PMID:35295148 Scg3 Rat trichloroethene decreases methylation EXP 6480464 Trichloroethylene results in decreased methylation of SCG3 gene CTD PMID:27618143 Scg3 Rat trichostatin A increases expression ISO SCG3 (Homo sapiens) 6480464 trichostatin A results in increased expression of SCG3 mRNA CTD PMID:24935251 Scg3 Rat triclosan increases expression ISO SCG3 (Homo sapiens) 6480464 Triclosan results in increased expression of SCG3 mRNA CTD PMID:30510588 Scg3 Rat trimellitic anhydride decreases expression ISO Scg3 (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of SCG3 mRNA CTD PMID:19042947 Scg3 Rat tunicamycin increases expression ISO SCG3 (Homo sapiens) 6480464 Tunicamycin results in increased expression of SCG3 mRNA CTD PMID:29453283 Scg3 Rat valproic acid affects expression ISO SCG3 (Homo sapiens) 6480464 Valproic Acid affects the expression of SCG3 mRNA CTD PMID:25979313 Scg3 Rat valproic acid multiple interactions ISO SCG3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SCG3 mRNA CTD PMID:27188386 Scg3 Rat valproic acid increases expression ISO SCG3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SCG3 mRNA CTD PMID:23179753 more ... Scg3 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of SCG3 mRNA CTD PMID:22615374 Scg3 Rat vorinostat multiple interactions ISO SCG3 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SCG3 mRNA CTD PMID:27188386 Scg3 Rat vorinostat decreases expression ISO SCG3 (Homo sapiens) 6480464 vorinostat results in decreased expression of SCG3 mRNA CTD PMID:27188386 Scg3 Rat XL147 multiple interactions ISO Scg3 (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with XL147] results in decreased expression of SCG3 mRNA CTD PMID:27935865 Scg3 Rat zinc sulfate increases expression ISO SCG3 (Homo sapiens) 6480464 Zinc Sulfate results in increased expression of SCG3 mRNA CTD PMID:19013360
17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) belinostat (ISO) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) Butylbenzyl phthalate (EXP) CGP 52608 (ISO) chlorpyrifos (EXP) cyclophosphamide (ISO) dibutyl phthalate (EXP) diethyl phthalate (EXP) diisobutyl phthalate (EXP) diisononyl phthalate (EXP) dorsomorphin (ISO) entinostat (ISO) ethanol (ISO) flavonoids (EXP) fulvestrant (ISO) lead(0) (ISO) mercury atom (ISO) mercury(0) (ISO) methimazole (EXP) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO) nitrofen (EXP) panobinostat (ISO) paraquat (ISO) potassium dichromate (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) thapsigargin (EXP) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) trimellitic anhydride (ISO) tunicamycin (ISO) valproic acid (ISO) vinclozolin (EXP) vorinostat (ISO) XL147 (ISO) zinc sulfate (ISO)
1.
Primary structure of mouse secretogranin III and its absence from deficient mice.
Dopazo A, etal., J Mol Neurosci 1993 Winter;4(4):225-33.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Identification of a chromogranin A domain that mediates binding to secretogranin III and targeting to secretory granules in pituitary cells and pancreatic beta-cells.
Hosaka M, etal., Mol Biol Cell. 2002 Oct;13(10):3388-99.
4.
Association of variations in the FTO, SCG3 and MTMR9 genes with metabolic syndrome in a Japanese population.
Hotta K, etal., J Hum Genet. 2011 Sep;56(9):647-51. doi: 10.1038/jhg.2011.74. Epub 2011 Jul 28.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Scg3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 85,280,253 - 85,322,484 (-) NCBI GRCr8 mRatBN7.2 8 76,399,777 - 76,442,015 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 76,399,777 - 76,442,015 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 81,907,241 - 81,955,800 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 80,172,086 - 80,214,605 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 78,006,582 - 78,055,133 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 82,582,352 - 82,641,536 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 82,582,352 - 82,641,536 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 82,183,497 - 82,242,336 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 80,467,921 - 80,514,192 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 80,495,390 - 80,533,246 (-) NCBI Celera 8 76,189,600 - 76,231,758 (-) NCBI Celera Cytogenetic Map 8 q24 NCBI
SCG3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 51,681,503 - 51,721,026 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 51,681,492 - 51,721,026 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 51,973,700 - 52,013,223 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 49,760,842 - 49,800,515 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 49,760,841 - 49,800,514 NCBI Celera 15 28,866,950 - 28,906,642 (+) NCBI Celera Cytogenetic Map 15 q21.2 NCBI HuRef 15 28,804,039 - 28,843,731 (+) NCBI HuRef CHM1_1 15 52,091,646 - 52,131,257 (+) NCBI CHM1_1 T2T-CHM13v2.0 15 49,488,960 - 49,528,517 (+) NCBI T2T-CHM13v2.0
Scg3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 75,550,648 - 75,591,733 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 75,550,471 - 75,591,338 (-) Ensembl GRCm39 Ensembl GRCm38 9 75,643,366 - 75,685,959 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 75,643,189 - 75,684,056 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 75,491,173 - 75,531,863 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 75,429,283 - 75,469,926 (-) NCBI MGSCv36 mm8 Celera 9 72,806,816 - 72,848,434 (-) NCBI Celera Cytogenetic Map 9 D NCBI cM Map 9 42.32 NCBI
Scg3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955409 2,875,017 - 2,907,363 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955409 2,876,355 - 2,907,363 (-) NCBI ChiLan1.0 ChiLan1.0
SCG3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 40,915,374 - 40,955,246 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 45,095,846 - 45,135,710 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 30,619,990 - 30,658,668 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 48,950,839 - 48,989,481 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 48,950,839 - 48,989,481 (+) Ensembl panpan1.1 panPan2
SCG3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 30 17,373,924 - 17,406,632 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 30 17,308,591 - 17,406,646 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 30 17,235,828 - 17,333,023 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 30 17,454,894 - 17,552,842 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 30 17,454,273 - 17,555,486 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 30 17,376,485 - 17,474,260 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 30 17,495,281 - 17,592,525 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 30 17,601,119 - 17,699,155 (+) NCBI UU_Cfam_GSD_1.0
Scg3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 95,666,009 - 95,704,416 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936471 13,514,073 - 13,555,139 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936471 13,514,072 - 13,552,250 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SCG3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 120,045,309 - 120,138,260 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 120,045,302 - 120,090,035 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 133,136,325 - 133,181,057 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SCG3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 26 31,655,789 - 31,693,585 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 26 31,654,094 - 31,693,535 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 109,520,872 - 109,560,174 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Scg3
.
Predicted Target Of
Count of predictions: 264 Count of miRNA genes: 176 Interacting mature miRNAs: 191 Transcripts: ENSRNOT00000014491 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 4889938 Bss89 Bone structure and strength QTL 89 3.8 tibia size trait (VT:0100001) tibia cortical bone volume (CMO:0001725) 8 50095249 82460899 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 737824 Hcar10 Hepatocarcinoma resistance QTL 10 2.9 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 8 40713066 82925667 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 10450865 Bw175 Body weight QTL 175 4.1 total fat pad mass (VT:0015008) adipose tissue molecular composition measurement (CMO:0000484) 8 75311777 84531599 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1582254 Kidm31 Kidney mass QTL 31 3 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 8 54237644 85365202 Rat 10402857 Bp380 Blood pressure QTL 380 0.95 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 5684973 Bss100 Bone structure and strength QTL 100 4.7 tibia area (VT:1000281) tibia area measurement (CMO:0001382) 8 50095249 82460899 Rat 1582243 Bw66 Body weight QTL 66 3.4 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 8 54237644 85365202 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 634332 Pia18 Pristane induced arthritis QTL 18 4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 75311938 82925521 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 2313086 Bss60 Bone structure and strength QTL 60 4.1 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 8 50095249 82460899 Rat 2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 2293697 Bmd39 Bone mineral density QTL 39 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 8 54043744 98968765 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303570 Gluco48 Glucose level QTL 48 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 49805831 94805831 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 2301402 Bp316 Blood pressure QTL 316 0.005 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat
AI547406
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 76,399,881 - 76,400,126 (+) MAPPER mRatBN7.2 Rnor_6.0 8 82,582,457 - 82,582,701 NCBI Rnor6.0 Rnor_5.0 8 82,183,602 - 82,183,846 UniSTS Rnor5.0 RGSC_v3.4 8 80,468,026 - 80,468,270 UniSTS RGSC3.4 Celera 8 76,189,705 - 76,189,949 UniSTS RH 3.4 Map 8 901.28 UniSTS Cytogenetic Map 8 q24 UniSTS
Scg3
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 76,399,783 - 76,399,881 (+) MAPPER mRatBN7.2 Rnor_6.0 8 82,582,359 - 82,582,456 NCBI Rnor6.0 Rnor_5.0 8 82,183,504 - 82,183,601 UniSTS Rnor5.0 RGSC_v3.4 8 80,467,928 - 80,468,025 UniSTS RGSC3.4 Celera 8 76,189,607 - 76,189,704 UniSTS Cytogenetic Map 8 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
47
113
79
78
47
25
47
6
202
94
93
44
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000014491 ⟹ ENSRNOP00000014491
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 76,399,777 - 76,442,015 (-) Ensembl Rnor_6.0 Ensembl 8 82,582,352 - 82,641,536 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000099204 ⟹ ENSRNOP00000088677
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 76,399,777 - 76,441,722 (-) Ensembl
RefSeq Acc Id:
NM_053856 ⟹ NP_446308
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 85,280,253 - 85,322,484 (-) NCBI mRatBN7.2 8 76,399,777 - 76,442,015 (-) NCBI Rnor_6.0 8 82,582,352 - 82,641,536 (-) NCBI Rnor_5.0 8 82,183,497 - 82,242,336 (-) NCBI RGSC_v3.4 8 80,467,921 - 80,514,192 (-) RGD Celera 8 76,189,600 - 76,231,758 (-) RGD
Sequence:
GTAGAGTAAAGCTACGCCCAGGCCCGCGTCCGCAGGCGACGCAGGAACTTCAGCACCCGCGGGGCGGACAGCGCCCGCCGCACCTGCTCACCTGCTCCGGGCGCCGGAAGAGCCCACATCCTCCTGCC
hide sequence
RefSeq Acc Id:
NP_446308 ⟸ NM_053856
- Peptide Label:
precursor
- UniProtKB:
P47868 (UniProtKB/Swiss-Prot), A6I1E8 (UniProtKB/TrEMBL), F1M7L6 (UniProtKB/TrEMBL)
- Sequence:
MGFLWTGSWILVLVLNSGPIQAFPKPEGSQDKSLHNRELSAERPLNEQIAEAEADKIKKTYPSESKPSESNFSSVDNLNLLKAITEKETVEKAKQSIRSSPFDNRLNVDDADSTKNRKLTDEYDSTKS
hide sequence
Ensembl Acc Id:
ENSRNOP00000014491 ⟸ ENSRNOT00000014491
Ensembl Acc Id:
ENSRNOP00000088677 ⟸ ENSRNOT00000099204
RGD ID: 13696132 Promoter ID: EPDNEW_R6657 Type: single initiation site Name: Scg3_1 Description: secretogranin III SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 82,641,550 - 82,641,610 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-02-26
Scg3
secretogranin III
Symbol and Name status set to approved
625702 APPROVED
2002-08-07
Scg3
secretogranin III
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_product
member of the granin family
634042
gene_protein
421 amino acids
634042
