Advanced Search (OLGA)

Gene: Fam163b (family with sequence similarity 163, member B) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Fam163b

Name:

family with sequence similarity 163, member B

RGD ID:

1597714

Description:

Predicted to be located in membrane. Orthologous to human FAM163B (family with sequence similarity 163 member B); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC685169; LOC685169; uncharacterized protein LOC685169

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	30,834,145 - 30,865,802 (-)	NCBI		GRCr8
mRatBN7.2	3	10,437,383 - 10,466,458 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	10,437,383 - 10,466,458 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	13,503,225 - 13,532,345 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	22,088,623 - 22,117,739 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	20,343,913 - 20,373,031 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	5,656,400 - 5,693,273 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	5,656,163 - 5,693,147 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	11,018,783 - 11,054,772 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	6,007,361 - 6,036,371 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	5,235,362 - 5,264,429 (-)	NCBI		Celera
Cytogenetic Map	3	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fam163b	Rat	developmental and epileptic encephalopathy 14		ISO	FAM163B (Homo sapiens)	8554872	ClinVar Annotator: match by term: Developmental and epileptic encephalopathy and 14	ClinVar	PMID:28492532
Fam163b	Rat	Ehlers-Danlos syndrome classic type 1		ISO	FAM163B (Homo sapiens)	8554872	ClinVar Annotator: match by term: Ehlers-Danlos syndrome and classic type	ClinVar	PMID:28492532
Fam163b	Rat	Kleefstra syndrome 1		ISO	FAM163B (Homo sapiens)	8554872	ClinVar Annotator: match by term: Kleefstra syndrome 1	ClinVar	PMID:22318994 more ...
Fam163b	Rat	Leigh disease		ISO	FAM163B (Homo sapiens)	8554872	ClinVar Annotator: match by term: Leigh syndrome	ClinVar	PMID:28492532
Fam163b	Rat	primary coenzyme Q10 deficiency 7		ISO	FAM163B (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neonatal encephalomyopathy-cardiomyopathy-respiratory distress syndrome	ClinVar	PMID:28492532
Fam163b	Rat	Rafiq syndrome		ISO	FAM163B (Homo sapiens)	8554872	ClinVar Annotator: match by term: Rafiq syndrome	ClinVar	PMID:28492532
Fam163b	Rat	tuberous sclerosis 1		ISO	FAM163B (Homo sapiens)	8554872	ClinVar Annotator: match by term: Tuberous sclerosis 1	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fam163b	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of FAM163B mRNA	CTD	PMID:32741896
Fam163b	Rat	17beta-estradiol 3-benzoate	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of FAM163B mRNA	CTD	PMID:32741896
Fam163b	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Fam163b (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of FAM163B mRNA	CTD	PMID:24680724
Fam163b	Rat	2,3,7,8-Tetrachlorodibenzofuran	decreases expression	EXP		6480464	2 more ...	CTD	PMID:32109520
Fam163b	Rat	acrylamide	decreases expression	EXP		6480464	Acrylamide results in decreased expression of FAM163B mRNA	CTD	PMID:28959563
Fam163b	Rat	acrylamide	decreases expression	ISO	FAM163B (Homo sapiens)	6480464	Acrylamide results in decreased expression of FAM163B mRNA	CTD	PMID:32763439
Fam163b	Rat	aldehydo-D-glucose	multiple interactions	ISO	Fam163b (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of FAM163B mRNA	CTD	PMID:37567420
Fam163b	Rat	arsane	decreases expression	ISO	FAM163B (Homo sapiens)	6480464	Arsenic results in decreased expression of FAM163B mRNA	CTD	PMID:36861143
Fam163b	Rat	arsenic atom	decreases expression	ISO	FAM163B (Homo sapiens)	6480464	Arsenic results in decreased expression of FAM163B mRNA	CTD	PMID:36861143
Fam163b	Rat	benzo[a]pyrene	decreases expression	ISO	Fam163b (Mus musculus)	6480464	Benzo(a)pyrene results in decreased expression of FAM163B mRNA	CTD	PMID:22228805
Fam163b	Rat	benzo[a]pyrene	affects methylation	ISO	FAM163B (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of FAM163B polyA tail	CTD	PMID:30157460
Fam163b	Rat	benzo[a]pyrene	increases methylation	ISO	FAM163B (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of FAM163B promoter	CTD	PMID:27901495
Fam163b	Rat	bis(2-ethylhexyl) phthalate	decreases expression	EXP		6480464	Diethylhexyl Phthalate results in decreased expression of FAM163B mRNA	CTD	PMID:29945229
Fam163b	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of FAM163B mRNA	CTD	PMID:25181051
Fam163b	Rat	bisphenol A	decreases expression	ISO	Fam163b (Mus musculus)	6480464	bisphenol A results in decreased expression of FAM163B mRNA	CTD	PMID:32156529
Fam163b	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of FAM163B mRNA	CTD	PMID:34947998
Fam163b	Rat	copper atom	increases expression	EXP		6480464	Copper deficiency results in increased expression of FAM163B mRNA	CTD	PMID:26033743
Fam163b	Rat	copper atom	multiple interactions	EXP		6480464	[Copper co-treated with Dietary Sucrose] results in increased expression of FAM163B mRNA	CTD	PMID:26033743
Fam163b	Rat	copper(0)	increases expression	EXP		6480464	Copper deficiency results in increased expression of FAM163B mRNA	CTD	PMID:26033743
Fam163b	Rat	copper(0)	multiple interactions	EXP		6480464	[Copper co-treated with Dietary Sucrose] results in increased expression of FAM163B mRNA	CTD	PMID:26033743
Fam163b	Rat	copper(II) sulfate	increases expression	ISO	Fam163b (Mus musculus)	6480464	Copper Sulfate results in increased expression of FAM163B mRNA	CTD	PMID:18579281
Fam163b	Rat	cyclosporin A	decreases methylation	ISO	FAM163B (Homo sapiens)	6480464	Cyclosporine results in decreased methylation of FAM163B promoter	CTD	PMID:27989131
Fam163b	Rat	D-glucose	multiple interactions	ISO	Fam163b (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of FAM163B mRNA	CTD	PMID:37567420
Fam163b	Rat	ethanol	affects expression	ISO	Fam163b (Mus musculus)	6480464	Ethanol affects the expression of FAM163B mRNA	CTD	PMID:30319688
Fam163b	Rat	ethanol	affects splicing	ISO	Fam163b (Mus musculus)	6480464	Ethanol affects the splicing of FAM163B mRNA	CTD	PMID:30319688
Fam163b	Rat	ethylparaben	decreases expression	ISO	FAM163B (Homo sapiens)	6480464	ethyl-p-hydroxybenzoate results in decreased expression of FAM163B mRNA	CTD	PMID:37690743
Fam163b	Rat	fructose	multiple interactions	ISO	Fam163b (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of FAM163B mRNA	CTD	PMID:37567420
Fam163b	Rat	glucose	multiple interactions	ISO	Fam163b (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of FAM163B mRNA	CTD	PMID:37567420
Fam163b	Rat	iron dichloride	decreases expression	ISO	FAM163B (Homo sapiens)	6480464	ferrous chloride results in decreased expression of FAM163B mRNA	CTD	PMID:35984750
Fam163b	Rat	N-methyl-4-phenylpyridinium	increases expression	ISO	FAM163B (Homo sapiens)	6480464	1-Methyl-4-phenylpyridinium results in increased expression of FAM163B mRNA	CTD	PMID:24810058
Fam163b	Rat	potassium dichromate	increases expression	ISO	Fam163b (Mus musculus)	6480464	Potassium Dichromate results in increased expression of FAM163B mRNA	CTD	PMID:23608068
Fam163b	Rat	resveratrol	multiple interactions	ISO	FAM163B (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of FAM163B mRNA	CTD	PMID:23557933
Fam163b	Rat	testosterone	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of FAM163B mRNA	CTD	PMID:32741896
Fam163b	Rat	titanium dioxide	decreases methylation	ISO	Fam163b (Mus musculus)	6480464	titanium dioxide results in decreased methylation of FAM163B gene	CTD	PMID:35295148
Fam163b	Rat	valproic acid	increases methylation	ISO	FAM163B (Homo sapiens)	6480464	Valproic Acid results in increased methylation of FAM163B gene	CTD	PMID:29154799

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fam163b	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Fam163b	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fam163b	Rat	protein binding	enables	ISO	FAM163B (Homo sapiens)	1624291	UniProtKB:Q12959 more ...	RGD	PMID:24550280 more ...

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Fam163b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	30,834,145 - 30,865,802 (-)	NCBI		GRCr8
mRatBN7.2	3	10,437,383 - 10,466,458 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	10,437,383 - 10,466,458 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	13,503,225 - 13,532,345 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	22,088,623 - 22,117,739 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	20,343,913 - 20,373,031 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	5,656,400 - 5,693,273 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	5,656,163 - 5,693,147 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	11,018,783 - 11,054,772 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	6,007,361 - 6,036,371 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	5,235,362 - 5,264,429 (-)	NCBI		Celera
Cytogenetic Map	3	p12	NCBI

FAM163B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	133,577,081 - 133,609,389 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	133,577,081 - 133,609,389 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	136,442,203 - 136,474,511 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	135,433,965 - 135,435,166 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	9	106,991,068 - 106,992,269 (-)	NCBI		Celera
Cytogenetic Map	9	q34.2	NCBI
HuRef	9	105,943,556 - 105,945,387 (-)	NCBI		HuRef
CHM1_1	9	136,593,007 - 136,594,838 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	145,791,075 - 145,825,393 (-)	NCBI		T2T-CHM13v2.0

Fam163b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	27,000,391 - 27,032,489 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	27,000,392 - 27,032,503 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	27,110,379 - 27,142,477 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	27,110,380 - 27,142,491 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	26,967,523 - 26,997,994 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	26,934,012 - 26,964,483 (-)	NCBI		MGSCv36	mm8
Celera	2	26,815,061 - 26,845,378 (-)	NCBI		Celera
Cytogenetic Map	2	A3	NCBI
cM Map	2	19.25	NCBI

Fam163b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955513	2,880,253 - 2,903,575 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955513	2,880,253 - 2,903,575 (-)	NCBI	ChiLan1.0	ChiLan1.0

FAM163B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	5,741,791 - 5,776,163 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	5,744,125 - 5,778,499 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	104,700,420 - 104,734,748 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	133,311,168 - 133,343,841 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	133,311,168 - 133,343,841 (-)	Ensembl	panpan1.1		panPan2

FAM163B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	49,960,093 - 49,988,263 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	49,961,706 - 49,962,807 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	49,241,103 - 49,269,296 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	50,835,023 - 50,862,647 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	50,834,763 - 50,862,632 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	49,595,837 - 49,623,982 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	49,937,772 - 49,965,933 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	50,016,111 - 50,044,314 (-)	NCBI		UU_Cfam_GSD_1.0

Fam163b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	200,011,983 - 200,037,568 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936669	3,360,236 - 3,361,686 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936669	3,337,490 - 3,363,077 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FAM163B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	273,156,751 - 273,186,756 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	273,156,749 - 273,186,756 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	307,130,575 - 307,160,599 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FAM163B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	4,525,338 - 4,560,676 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	4,557,505 - 4,558,705 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666058	428,478 - 464,163 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fam163b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624760	1,978,293 - 2,001,410 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624760	1,978,667 - 2,002,131 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Fam163b
136 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	315
Count of miRNA genes:	183
Interacting mature miRNAs:	209
Transcripts:	ENSRNOT00000008660
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358357	Srcrtb1	Stress Responsive Cort Basal QTL 1	6.36	0.002	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	8658162	27494778	Rat
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	1	36847613	Rat
2292615	Ept17	Estrogen-induced pituitary tumorigenesis QTL 17	6.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	6537645	10778823	Rat
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	8227194	47233430	Rat
1298526	Arunc3	Aerobic running capacity QTL 3	2.2		exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	8227194	33703538	Rat
8693641	Alc30	Alcohol consumption QTL 30	2	0.739	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	3	10434306	24512004	Rat
631545	Bp85	Blood pressure QTL 85	3.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	33278763	Rat
631679	Cm10	Cardiac mass QTL 10	7.34	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	1	31158234	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
631568	Bp92	Blood pressure QTL 92	2.2	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	39874793	Rat
70203	Gcr2	Gastric cancer resistance QTL 2	2.6		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	3	8658162	27494778	Rat
70202	Alc19	Alcohol consumption QTL 19	2.5		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	3	1	27494778	Rat
2312664	Scl62	Serum cholesterol level QTL 62		0.05	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	1	38710544	Rat
61468	Bp15	Blood pressure QTL 15	4.4		blood pressure trait (VT:0000183)	pulse pressure (CMO:0000292)	3	1	33278763	Rat
1358185	Ept6	Estrogen-induced pituitary tumorigenesis QTL 6	6.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	6537645	10778823	Rat
631831	Alc8	Alcohol consumption QTL 8	2.7		consumption behavior trait (VT:0002069)	calculated ethanol drink intake rate (CMO:0001615)	3	1	33230976	Rat

bnlg1246b

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	3	11,030,918 - 11,031,390	NCBI	Rnor5.0
RGSC_v3.4	3	6,015,696 - 6,016,167	UniSTS	RGSC3.4
Celera	3	5,243,893 - 5,244,364	UniSTS
Cytogenetic Map	3	p12	UniSTS
Cytogenetic Map	2	q12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
5	5	49	110	55	53	31	17	31	3	158	83	93	34	58	22


RefSeq Transcripts	NM_001109458	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006233869	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284556	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000008660 ⟹ ENSRNOP00000008660

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	3	5,656,163 - 5,693,147 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111342 ⟹ ENSRNOP00000079918

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	10,437,383 - 10,466,458 (-)	Ensembl

RefSeq Acc Id:

NM_001109458 ⟹ NP_001102928

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	30,835,461 - 30,864,530 (-)	NCBI
mRatBN7.2	3	10,437,383 - 10,466,458 (-)	NCBI
Rnor_6.0	3	5,657,716 - 5,693,273 (-)	NCBI
Rnor_5.0	3	11,018,783 - 11,054,772 (-)	NCBI
RGSC_v3.4	3	6,007,361 - 6,036,371 (-)	RGD
Celera	3	5,235,362 - 5,264,429 (-)	RGD

Sequence:

show sequence

CCTCCTGCGCGCGCCCCGCGCCCGGGACTGGGCTGGAGTCGCGCGTGCCGCTTGCAGAGAGGCAGCTAGGCGTCCAGAGCCGTGGCCGCAACGCGGAGCTGGCAGGGAGTCTCGCCTGGCCACGCACT
TGCCTCCTCTGGGGCCTCCAGGAGTCTCTTGGCGCTCACCTTGCCAGTCCGGCCCCAGCAGGCTCCACCGGCCTTGGCCTGGGCTGCATTTGCCGCTACTTGCTGTGCCCAGGACAGAGGGACGTCCG
CCCCGTCACGTGTGTCCAAGTCCTCCGCCAGCCGGGGCAGTGTGGTTCCCATGGTTCAAGGCTGTTGATGGAGAAGTGGGCGGATGACAGCCGGGACTGTGGTCATCACTGGGGGCATCTTGGCAACT
GTGATCCTCCTCTGCATAATCGCTGTTCTGTGCTACTGTCGACTCCAGTATTACTGCTGCAAGAAGGACGAATCCGAGGAGGACGAGGAGGAGCCCGACTTCGCTGTGCATTCTCACCTGCCGCCCCT
TCATTCCAACCGCAACCTTGTGTTGACCAACGGGCCAGCTCTCTACCCGGCTGCCACCACCTCTTTCAGCCAAAAGTCCCCGCAGGCCCGTGCCCTCTGCCGCAGCTGCTCCCACTACGAGCCGCCCA
CCTTCTTCCTGCAGGAGCCAGAGGATGACGACTTTGAGGGCGTGCGCAACGGCGGGGGCCGCGTGGCCTACAAAAGCATCAGCCAGGAAGATGTGGAGCTGCCGTCCGCGAGCTTCGGGGGCCTGCAG
GCGCTCAACCCCAACCGCCTCTCTGCCATGCGGGAGGCCTTTTCCCGAAGCCGGAGCGTAAGCACTGACGTGTGACGGGCCTCTATCCTGCTGAGGCACCGAGCCCTGGGTCCTGAGATCATGACAGG
ATACCCGCGGCACACTCCAGCCCCATCTCCAGACCTCTGCTCAGCCAGTCTTCCCTGTATCCTTGTCCTAGGGGCTCCGGGAATGAGGAACCCCTGGGCCCTCTACAAGGATAAAGCCCAATGAACCA
GATGTGGCAGCTGTGAGTAGGGACAGCTGTCACAAGAAGGGAGGCAAGGGACAGGAGGGTAAGGTAAGGCTGCGTTGGGGCCCAGGGGCCTGGTCCTATTTCCAGGAAGTGAGAAGATGGATACTGTC
TCTAGCAACTAGTCTGTCTCTGGCTTCATGGTCTTAGCTGTCAGTCCCTCCCCAGACCTTGGGCTTCCTACCTTGCTTAAGTGGTCTCACCGGTTGCCAGTGACCCTACAAGCATGAACCTTCCTTAG
AGACTGTGGACCAAATAAATATTCTGTCCCTTC

hide sequence

RefSeq Acc Id:

XM_063284556 ⟹ XP_063140626

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	30,834,145 - 30,865,802 (-)	NCBI


Protein RefSeqs	NP_001102928	(Get FASTA)	NCBI Sequence Viewer
	XP_063140626	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL93442	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000079918.1

RefSeq Acc Id:	NP_001102928 ⟸ NM_001109458
- UniProtKB:	D3Z988 (UniProtKB/TrEMBL), A6JTK5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTAGTVVITGGILATVILLCIIAVLCYCRLQYYCCKKDESEEDEEEPDFAVHSHLPPLHSNRNLVLTNGPALYPAATTSFSQKSPQARALCRSCSHYEPPTFFLQEPEDDDFEGVRNGGGRVAYKSIS QEDVELPSASFGGLQALNPNRLSAMREAFSRSRSVSTDV hide sequence

Ensembl Acc Id:

ENSRNOP00000008660 ⟸ ENSRNOT00000008660

Ensembl Acc Id:

ENSRNOP00000079918 ⟸ ENSRNOT00000111342

RefSeq Acc Id:	XP_063140626 ⟸ XM_063284556
- Peptide Label:	isoform X1
- UniProtKB:	A6JTK5 (UniProtKB/TrEMBL), D3Z988 (UniProtKB/TrEMBL)

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3Z988-F1-model_v2	AlphaFold	D3Z988	1-167	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-50306	BioCyc
Ensembl Genes	ENSRNOG00000006591	Ensembl
	ENSRNOG00000065438	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000111342.1	UniProtKB/TrEMBL
InterPro	FAM163	UniProtKB/TrEMBL
	FAM163B	UniProtKB/TrEMBL
KEGG Report	rno:685169	UniProtKB/TrEMBL
NCBI Gene	685169	ENTREZGENE
PANTHER	PROTEIN FAM163B	UniProtKB/TrEMBL
	PTHR31396	UniProtKB/TrEMBL
Pfam	FAM163	UniProtKB/TrEMBL
PhenoGen	Fam163b	PhenoGen
RatGTEx	ENSRNOG00000006591	RatGTEx
	ENSRNOG00000065438	RatGTEx
UniProt	A6JTK5	ENTREZGENE, UniProtKB/TrEMBL
	D3Z988	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2010-04-21	Fam163b	family with sequence similarity 163, member B	LOC685169	hypothetical protein LOC685169	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	LOC685169	hypothetical protein LOC685169	LOC687497	hypothetical protein LOC687497	Data merged from RGD:1585309	1643240	APPROVED
2006-11-20	LOC685169	hypothetical protein LOC685169			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC687497	hypothetical protein LOC687497			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar