Advanced Search (OLGA)

Gene: Tipin (timeless interacting protein) Rattus norvegicus

Analyze

Symbol:

Tipin (Ensembl: LOC120094818)

Name:

timeless interacting protein (Ensembl:TIMELESS-interacting protein-like)

RGD ID:

1564084

Description:

Predicted to enable DNA binding activity. Predicted to be involved in several processes, including DNA integrity checkpoint signaling; cell cycle phase transition; and replication fork arrest. Predicted to act upstream of or within DNA damage checkpoint signaling and response to UV. Predicted to be located in chromatin; cytoplasm; and nucleus. Predicted to be part of replication fork protection complex. Orthologous to human TIPIN (TIMELESS interacting protein); INTERACTS WITH 6-propyl-2-thiouracil; acrylamide; aflatoxin B1.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC363076; MGC114381; RGD1564084; similar to timeless-interacting protein; TIMELESS-interacting protein; UV98

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TIPIN (TIMELESS interacting protein)	RGD	RGD
Mus musculus (house mouse):	Tipin (timeless interacting protein)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Tipin (TIMELESS interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TIPIN (TIMELESS interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TIPIN (TIMELESS interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tipin (TIMELESS interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TIPIN (TIMELESS interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TIPIN (TIMELESS interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tipin (TIMELESS interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ZNF716 (zinc finger protein 716)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Tipin (timeless interacting protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	TIPIN (TIMELESS interacting protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tipin (timeless interacting protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG10336	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CSM3	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tipn-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	tipin	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	73,676,020 - 73,696,620 (+)	NCBI		GRCr8
mRatBN7.2	8	64,780,813 - 64,801,358 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	113,543,173 - 113,605,998 (-)	Ensembl		mRatBN7.2 Ensembl
mRatBN7.2 Ensembl	8	64,780,828 - 64,801,352 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	70,295,265 - 70,315,733 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	68,567,853 - 68,588,333 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	66,437,844 - 66,458,313 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	69,753,363 - 69,768,640 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	69,753,373 - 69,768,305 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	69,463,024 - 69,477,515 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	68,480,152 - 68,502,451 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	8	64,192,517 - 64,207,800 (+)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Bloom syndrome (ISO)

colorectal cancer (ISO)

neuronal ceroid lipofuscinosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-colchicine (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

14-Deoxy-11,12-didehydroandrographolide (ISO)

17beta-estradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-hydroxypropanoic acid (ISO)

3-methylcholanthrene (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

adenine (ISO)

afimoxifene (ISO)

aflatoxin B1 (EXP,ISO)

aflatoxin M1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

antimycin A (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

carbon nanotube (ISO)

choline (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

corosolic acid (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

DDE (ISO)

dibenz[a,h]anthracene (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

Enterolactone (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

etoposide (ISO)

folic acid (ISO)

FR900359 (ISO)

hydroxyurea (ISO)

L-methionine (ISO)

methidathion (ISO)

methyl methanesulfonate (ISO)

mitomycin C (ISO)

N-nitrosodiethylamine (ISO)

ozone (ISO)

paracetamol (ISO)

parathion (ISO)

pentachlorophenol (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

piroxicam (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

testosterone enanthate (ISO)

tetrachloromethane (ISO)

tetraphene (ISO)

thiram (ISO)

titanium dioxide (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

Triptolide (ISO)

tris(2-butoxyethyl) phosphate (ISO)

tungsten (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell cycle phase transition (ISO,ISS)

cell division (IEA)

DNA damage checkpoint signaling (ISO)

DNA damage response (IEA)

DNA replication checkpoint signaling (IBA,IEA,ISO,ISS)

mitotic intra-S DNA damage checkpoint signaling (ISO,ISS)

positive regulation of cell population proliferation (ISO,ISS)

replication fork arrest (IBA)

replication fork processing (IEA)

response to UV (ISO)

Cellular Component

chromatin (ISO,ISS)

cytoplasm (ISO)

nucleus (IEA,ISO,ISS)

replication fork protection complex (IBA)

Molecular Function

DNA binding (IBA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:12875843	PMID:17102137	PMID:17141802

Genomics

Comparative Map Data

Tipin
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	73,676,020 - 73,696,620 (+)	NCBI		GRCr8
mRatBN7.2	8	64,780,813 - 64,801,358 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	113,543,173 - 113,605,998 (-)	Ensembl		mRatBN7.2 Ensembl
mRatBN7.2 Ensembl	8	64,780,828 - 64,801,352 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	70,295,265 - 70,315,733 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	68,567,853 - 68,588,333 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	66,437,844 - 66,458,313 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	69,753,363 - 69,768,640 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	69,753,373 - 69,768,305 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	69,463,024 - 69,477,515 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	68,480,152 - 68,502,451 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	8	64,192,517 - 64,207,800 (+)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

TIPIN
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	66,336,191 - 66,386,717 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	66,336,191 - 66,386,746 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	66,628,529 - 66,679,055 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	64,416,062 - 64,436,108 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	15	43,519,139 - 43,539,060 (-)	NCBI		Celera
Cytogenetic Map	15	q22.31	NCBI
HuRef	15	43,465,869 - 43,485,233 (-)	NCBI		HuRef
CHM1_1	15	66,747,160 - 66,766,891 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	64,157,927 - 64,208,168 (-)	NCBI		T2T-CHM13v2.0

Tipin
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	64,188,776 - 64,212,704 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	64,188,863 - 64,212,706 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	64,281,491 - 64,305,422 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	64,281,581 - 64,305,424 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	64,129,414 - 64,152,599 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	64,079,613 - 64,102,798 (+)	NCBI		MGSCv36	mm8
Celera	9	61,510,098 - 61,533,476 (+)	NCBI		Celera
Cytogenetic Map	9	C	NCBI
cM Map	9	34.6	NCBI

Tipin
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955450	9,262,717 - 9,279,401 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955450	9,259,838 - 9,279,479 (+)	NCBI	ChiLan1.0	ChiLan1.0

TIPIN
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	55,595,021 - 55,642,145 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	59,768,356 - 59,814,887 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	45,290,350 - 45,310,335 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	63,566,463 - 63,586,090 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	63,566,463 - 63,585,717 (-)	Ensembl	panpan1.1		panPan2

TIPIN
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	30,641,557 - 30,657,353 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	30,641,555 - 30,657,260 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	30,573,853 - 30,589,657 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	30,836,561 - 30,856,011 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	30,836,561 - 30,855,904 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	30,766,159 - 30,785,588 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	30,829,419 - 30,845,237 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	31,071,478 - 31,086,206 (-)	NCBI		UU_Cfam_GSD_1.0

Tipin
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	108,668,035 - 108,683,341 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	26,517,042 - 26,531,410 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	26,516,511 - 26,531,403 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TIPIN
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	164,350,705 - 164,369,223 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	164,349,196 - 164,369,297 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	182,110,325 - 182,125,754 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TIPIN
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	17,194,859 - 17,214,671 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	17,198,734 - 17,214,810 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	124,233,775 - 124,254,001 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tipin
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624781	6,301,764 - 6,324,870 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624781	6,300,661 - 6,325,394 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tipin
83 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	93
Count of miRNA genes:	71
Interacting mature miRNAs:	82
Transcripts:	ENSRNOT00000066973
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30856404	75856404	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	41866876	86866876	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1582222	Epfw2	Epididymal fat weight QTL 2	3.2	0.0005	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	8	31737729	76737729	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	35582032	80582032	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	50095249	82460899	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1300146	Rf17	Renal function QTL 17	2.9		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	8	28242912	73242912	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	29502665	70386295	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	22662330	67662330	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	40713066	82925667	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	41866876	75097878	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	35551938	80551938	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	54237644	85365202	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
631216	Stl9	Serum triglyceride level QTL 9	4.71	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	8	41867010	70386132	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	50095249	82460899	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	54237644	85365202	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	54259986	100382532	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	50095249	82460899	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	61290298	119084929	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	54043744	98968765	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	46531722	99083736	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
2303564	Gluco43	Glucose level QTL 43	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	26130187	71130187	Rat
2303570	Gluco48	Glucose level QTL 48	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	49805831	94805831	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
2303572	Insul13	Insulin level QTL 13	2		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	8	26130187	71130187	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	54237644	99103503	Rat

Markers in Region

D8Got323

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	8	73,687,185 - 73,687,414 (+)	Marker Load Pipeline
mRatBN7.2	8	64,791,920 - 64,792,149 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	69,759,212 - 69,759,440	NCBI	Rnor6.0
Rnor_5.0	8	69,468,087 - 69,468,315	UniSTS	Rnor5.0
RGSC_v3.4	8	68,492,179 - 68,492,407	UniSTS	RGSC3.4
Celera	8	64,198,369 - 64,198,597	UniSTS
Cytogenetic Map	8	q24	UniSTS

RH139218

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	64,792,119 - 64,792,337 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	69,759,411 - 69,759,628	NCBI	Rnor6.0
Rnor_5.0	8	69,468,286 - 69,468,503	UniSTS	Rnor5.0
RGSC_v3.4	8	68,492,378 - 68,492,595	UniSTS	RGSC3.4
Celera	8	64,198,568 - 64,198,785	UniSTS
RH 3.4 Map	8	809.9	UniSTS
Cytogenetic Map	8	q24	UniSTS

RH140249

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	64,786,364 - 64,786,584 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	69,753,665 - 69,753,884	NCBI	Rnor6.0
Rnor_5.0	8	69,462,540 - 69,462,759	UniSTS	Rnor5.0
RGSC_v3.4	8	68,486,102 - 68,486,321	UniSTS	RGSC3.4
Celera	8	64,192,818 - 64,193,037	UniSTS
RH 3.4 Map	8	809.5	UniSTS
Cytogenetic Map	8	q24	UniSTS

BE100135

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	113,543,816 - 113,543,968 (+)	MAPPER	mRatBN7.2
mRatBN7.2	8	64,786,090 - 64,786,888 (+)	MAPPER	mRatBN7.2
mRatBN7.2	9	113,694,228 - 113,694,380 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	174,729 - 174,880	NCBI	Rnor6.0
Rnor_6.0	8	69,753,390 - 69,754,187	NCBI	Rnor6.0
Rnor_5.0	5	173,744 - 173,895	UniSTS	Rnor5.0
RGSC_v3.4	9	112,832,937 - 112,833,088	UniSTS	RGSC3.4
Celera	8	64,192,544 - 64,193,340	UniSTS
RH 3.4 Map	9	867.0	UniSTS
Cytogenetic Map	9	q38	UniSTS
Cytogenetic Map	8	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025287	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039081743	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063265762	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063265763	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063265765	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC097351	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U12523	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000056239 ⟹ ENSRNOP00000053083

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	113,543,173 - 113,605,998 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000066973 ⟹ ENSRNOP00000059833

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	64,780,828 - 64,801,352 (+)	Ensembl
Rnor_6.0 Ensembl	8	69,753,373 - 69,768,305 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112754 ⟹ ENSRNOP00000083756

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	64,781,184 - 64,801,352 (+)	Ensembl

RefSeq Acc Id:

NM_001025287 ⟹ NP_001020458

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	73,676,091 - 73,696,620 (+)	NCBI
mRatBN7.2	8	64,780,813 - 64,801,358 (+)	NCBI
Rnor_6.0	8	69,753,363 - 69,768,640 (+)	NCBI
Rnor_5.0	8	69,463,024 - 69,477,515 (+)	NCBI
RGSC_v3.4	8	68,480,152 - 68,502,451 (+)	RGD
Celera	8	64,192,517 - 64,207,800 (+)	RGD

Sequence:

show sequence

CGGCCGCCGTTTGGGTGAGGAGGAAAAAATGTTGGAGCAAGAAGAAAATGGCTTGTTTGAAATA
CCAGATTATGAACATGTAGAGGATGAAACTTTTCCTCCCTTCCCACCTCCAGGCTCTCCAGAGA
GAGATCCTGCAGAAGCTGAACCTGATGAAGGGAGTGGAGCACCTGTTCCTGTTCCGCCAAAGAG
AATAGTTAAAAGGAATATACCCAAGCTAGATGCTACAAGATTGACTTCAGAGAGAGGGCTTCCA
GCCTTAAGGCATGTATTTGATAAGACAAAATTCAAGGGGAAAGGTCATGAGGCTGAAGACTTGA
AAACGCTAATCAGACACATGGAGCACTGGGCCCATAGGCTATTCCCCAAACTGCAATTTGAAGA
TTTTATTGACAGAGTTGAAAACCTAGGAAATAAAAAGGAGGTTCAGACCTGTTTAAAACGAATT
CGACTTGATCTGCCTATTGTACATGAAGATTTTGTTAACAATAACGATGAAGTTGAGGAAACTA
ACAGCCTTGATGCAGCTGCCACTGGATTTGATGCCTTTGTGACAAGTTCATCTGACAGCAAGAG
GTTTGCTTCTGAAGCGAGTAGAAACCTAACAGAAGAGCAGCAGCAGAGAATTGAGAAAAATAAA
CAACTGGCCTTGGAAAGAAGGCAGGCAAAGCTATTGAGTAATAGCCAGTCCCTAGAAAATGACG
TGACAGTTGAAGAGAGCAGTACTGGTGAGAATCAAGAAGAGTCAAATGGATTGATCTCTGCTGA
TGGTCCACATGACGTTCCTTCTGCCAGCACACAGGAAGAAGGACAGTTGGAAGCAGAGGAAACA
CAGCTGGACCATCCTAACTTAGACTAATCCAGAAATGTTCTAAGTAGCCAACCCTCTACAACAG
AATCCTACAGGCTTGGAGTTATTTGTAGTTTTTTCTACTTTGTATAAATCCTTAAGTCTTAAGG
CTTCTGTGGATTCCTGTTTAAAATACAATGACTATTTAAATTGTTTCCTACTTATTTTAGTAAG
TCTATTTATTATTTTTGGTGTTCTGTATAAGTCTGACTTTATAAGCTGTTTTGTAGTTTGCATT
GAATTGTTTCTTACTAAATTGGGTAATGATTAAAATGTAAATATGCCCTGACTGTTAGGTCAGT
TTTTAATAAAGAAATAAATTATTTTGTAAGCAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039081743 ⟹ XP_038937671

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	73,676,370 - 73,696,614 (+)	NCBI
mRatBN7.2	8	64,781,104 - 64,801,355 (+)	NCBI

RefSeq Acc Id:

XM_063265762 ⟹ XP_063121832

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	73,676,370 - 73,696,614 (+)	NCBI

RefSeq Acc Id:

XM_063265763 ⟹ XP_063121833

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	73,676,358 - 73,693,386 (+)	NCBI

RefSeq Acc Id:

XM_063265765 ⟹ XP_063121835

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	73,676,020 - 73,693,386 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001020458	(Get FASTA)	NCBI Sequence Viewer
	XP_038937671	(Get FASTA)	NCBI Sequence Viewer
	XP_063121832	(Get FASTA)	NCBI Sequence Viewer
	XP_063121833	(Get FASTA)	NCBI Sequence Viewer
	XP_063121835	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH97351	(Get FASTA)	NCBI Sequence Viewer
	EDL95792	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000053083.2
	ENSRNOP00000059833
	ENSRNOP00000059833.4
	ENSRNOP00000083756.1
	ENSRNOP00055034232
	ENSRNOP00060027599
	ENSRNOP00065007150
GenBank Protein	Q4QR88	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001020458 ⟸ NM_001025287

- UniProtKB:

Q4QR88 (UniProtKB/Swiss-Prot), A6J5B9 (UniProtKB/TrEMBL), F1LM96 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLEQEENGLFEIPDYEHVEDETFPPFPPPGSPERDPAEAEPDEGSGAPVPVPPKRIVKRNIPKL
DATRLTSERGLPALRHVFDKTKFKGKGHEAEDLKTLIRHMEHWAHRLFPKLQFEDFIDRVENLG
NKKEVQTCLKRIRLDLPIVHEDFVNNNDEVEETNSLDAAATGFDAFVTSSSDSKRFASEASRNL
TEEQQQRIEKNKQLALERRQAKLLSNSQSLENDVTVEESSTGENQEESNGLISADGPHDVPSAS
TQEEGQLEAEETQLDHPNLD

hide sequence

Ensembl Acc Id:

ENSRNOP00000059833 ⟸ ENSRNOT00000066973

RefSeq Acc Id:	XP_038937671 ⟸ XM_039081743
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A0L4 (UniProtKB/TrEMBL), F1LM96 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000083756 ⟸ ENSRNOT00000112754

RefSeq Acc Id:	XP_063121835 ⟸ XM_063265765
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_063121833 ⟸ XM_063265763
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063121832 ⟸ XM_063265762
- Peptide Label:	isoform X2
- UniProtKB:	F1LM96 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000053083 ⟸ ENSRNOT00000056239

Protein Domains

Chromosome segregation in meiosis protein

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4QR88-F1-model_v2	AlphaFold	Q4QR88	1-276	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1564084	AgrOrtholog
BioCyc Gene	G2FUF-30103	BioCyc
Ensembl Genes	ENSRNOG00000037221	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00000043068	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055024427	UniProtKB/Swiss-Prot
	ENSRNOG00060019471	UniProtKB/Swiss-Prot
	ENSRNOG00065006402	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000056239.3	UniProtKB/TrEMBL
	ENSRNOT00000066973	UniProtKB/TrEMBL
	ENSRNOT00000066973.4	UniProtKB/Swiss-Prot
	ENSRNOT00000112754.1	UniProtKB/TrEMBL
	ENSRNOT00055041995	UniProtKB/Swiss-Prot
	ENSRNOT00060033708	UniProtKB/Swiss-Prot
	ENSRNOT00065009847	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7387433	IMAGE-MGC_LOAD
InterPro	Csm3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TIPIN/Csm3/Swi3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:363076	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:114381	IMAGE-MGC_LOAD
NCBI Gene	363076	ENTREZGENE
PANTHER	PTHR13220	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TIMELESS-INTERACTING PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Swi3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Tipin	PhenoGen
RatGTEx	ENSRNOG00000037221	RatGTEx
	ENSRNOG00000043068	RatGTEx
	ENSRNOG00055024427	RatGTEx
	ENSRNOG00060019471	RatGTEx
	ENSRNOG00065006402	RatGTEx
UniProt	A0A8I6A0L4	ENTREZGENE, UniProtKB/TrEMBL
	A6J5B9	ENTREZGENE, UniProtKB/TrEMBL
	F1LM96	ENTREZGENE, UniProtKB/TrEMBL
	F1M2N9_RAT	UniProtKB/TrEMBL
	Q4QR88	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-06	Tipin	timeless interacting protein	RGD1564084_predicted	similar to timeless-interacting protein (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1564084_predicted	similar to timeless-interacting protein (predicted)	LOC363076	similar to timeless-interacting protein	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC363076	similar to timeless-interacting protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar