Symbol:
Cpne1
Name:
copine 1
RGD ID:
1311148
Description:
Predicted to enable several functions, including NF-kappaB binding activity; identical protein binding activity; and phospholipid binding activity. Predicted to be involved in several processes, including cellular response to calcium ion; neuron projection extension; and regulation of signal transduction. Predicted to be located in cytosol; nuclear membrane; and nucleoplasm. Predicted to be active in plasma membrane. Orthologous to human CPNE1 (copine 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; aconitine; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
copine I; copine-1; copine-1-like; LOC100910990; LOC362249
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CPNE1 (copine 1) HGNC
Ensembl, HomoloGene, OrthoDB, OrthoMCL
Mus musculus (house mouse):
Cpne1 (copine I) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cpne1 (copine 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CPNE1 (copine 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CPNE1 (copine 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cpne1 (copine 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
RBM12 (RNA binding motif protein 12) HGNC
HomoloGene
Alliance orthologs 3
Homo sapiens (human):
CPNE1 (copine 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cpne1 (copine I)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Rbm12 (RNA binding motif protein 12)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cpne1 (copine I)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
rbm12 (RNA binding motif protein 12)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
rbm-12
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
CG7879
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
cpne1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 165,047,615 - 165,089,994 (-) NCBI GRCr8 mRatBN7.2 3 144,587,531 - 144,629,911 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 144,588,995 - 144,598,636 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 148,454,985 - 148,462,709 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 157,072,257 - 157,079,981 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 154,811,783 - 154,819,507 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 151,617,733 - 151,625,448 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 151,616,037 - 151,625,644 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 152,150,152 - 152,159,749 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 157,980,656 - 157,994,839 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.1 3 146,386,321 - 146,433,463 (-) NCBI Celera 3 143,310,994 - 143,318,709 (-) NCBI Celera Cytogenetic Map 3 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cpne1 Rat 1,2-dichloroethane increases expression ISO Cpne1 (Mus musculus) 6480464 ethylene dichloride results in increased expression of CPNE1 mRNA CTD PMID:28960355 Cpne1 Rat 1,2-dimethylhydrazine decreases expression ISO Cpne1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of CPNE1 mRNA CTD PMID:22206623 Cpne1 Rat 17beta-estradiol decreases expression ISO Cpne1 (Mus musculus) 6480464 Estradiol results in decreased expression of CPNE1 mRNA CTD PMID:19484750 and PMID:39298647 Cpne1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Cpne1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Cpne1 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Cpne1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Cpne1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cpne1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CPNE1 mRNA CTD PMID:24680724 Cpne1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CPNE1 mRNA CTD PMID:33387578 Cpne1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CPNE1 mRNA CTD PMID:34747641 Cpne1 Rat 2,6-dimethoxyphenol multiple interactions ISO CPNE1 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Cpne1 Rat 2-amino-14,16-dimethyloctadecan-3-ol decreases expression ISO CPNE1 (Homo sapiens) 6480464 2-amino-14 and 16-dimethyloctadecan-3-ol results in decreased expression of CPNE1 protein CTD PMID:32044396 Cpne1 Rat 4,4'-sulfonyldiphenol increases expression ISO Cpne1 (Mus musculus) 6480464 bisphenol S results in increased expression of CPNE1 mRNA CTD PMID:39298647 Cpne1 Rat 5-aza-2'-deoxycytidine affects expression ISO CPNE1 (Homo sapiens) 6480464 Decitabine affects the expression of CPNE1 mRNA CTD PMID:23300844 Cpne1 Rat acetylsalicylic acid increases expression ISO CPNE1 (Homo sapiens) 6480464 Aspirin results in increased expression of CPNE1 mRNA CTD PMID:11906190 Cpne1 Rat aconitine increases expression EXP 6480464 Aconitine results in increased expression of CPNE1 protein CTD PMID:33236894 Cpne1 Rat aflatoxin B1 increases methylation ISO CPNE1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of CPNE1 gene CTD PMID:27153756 Cpne1 Rat aristolochic acid A increases expression ISO CPNE1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of CPNE1 mRNA CTD PMID:33212167 Cpne1 Rat arsenous acid multiple interactions ISO CPNE1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to CPNE1 protein] CTD PMID:26598702 Cpne1 Rat atrazine increases expression ISO CPNE1 (Homo sapiens) 6480464 Atrazine results in increased expression of CPNE1 mRNA CTD PMID:22378314 Cpne1 Rat beauvericin decreases expression ISO CPNE1 (Homo sapiens) 6480464 beauvericin results in decreased expression of CPNE1 mRNA CTD PMID:29203277 Cpne1 Rat benzo[a]pyrene decreases expression ISO Cpne1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of CPNE1 mRNA CTD PMID:27195522 Cpne1 Rat benzo[a]pyrene decreases methylation ISO CPNE1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of CPNE1 5' UTR CTD PMID:27901495 Cpne1 Rat benzo[a]pyrene diol epoxide I increases expression ISO CPNE1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Cpne1 Rat bisphenol A affects expression ISO CPNE1 (Homo sapiens) 6480464 bisphenol A affects the expression of CPNE1 mRNA CTD PMID:30903817 Cpne1 Rat bisphenol A decreases expression ISO CPNE1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of CPNE1 protein CTD PMID:34186270 Cpne1 Rat bisphenol A increases expression ISO CPNE1 (Homo sapiens) 6480464 bisphenol A results in increased expression of CPNE1 protein CTD PMID:37567409 Cpne1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CPNE1 mRNA CTD PMID:34947998 Cpne1 Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of CPNE1 mRNA CTD PMID:32479839 Cpne1 Rat cadmium dichloride decreases expression ISO CPNE1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of CPNE1 mRNA CTD PMID:38568856 Cpne1 Rat CGP 52608 multiple interactions ISO CPNE1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CPNE1 gene] CTD PMID:28238834 Cpne1 Rat ciguatoxin CTX1B affects expression ISO Cpne1 (Mus musculus) 6480464 Ciguatoxins affects the expression of CPNE1 mRNA CTD PMID:18353800 Cpne1 Rat cisplatin affects expression ISO CPNE1 (Homo sapiens) 6480464 Cisplatin affects the expression of CPNE1 mRNA CTD PMID:23300844 Cpne1 Rat clozapine decreases expression ISO CPNE1 (Homo sapiens) 6480464 Clozapine results in decreased expression of CPNE1 protein CTD PMID:34122009 Cpne1 Rat cobalt dichloride decreases expression ISO CPNE1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of CPNE1 mRNA CTD PMID:19320972 Cpne1 Rat copper(II) chloride decreases expression ISO CPNE1 (Homo sapiens) 6480464 cupric chloride results in decreased expression of CPNE1 mRNA CTD PMID:38568856 Cpne1 Rat dextran sulfate multiple interactions ISO Cpne1 (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in decreased expression of CPNE1 protein] CTD PMID:35362542 Cpne1 Rat dextran sulfate decreases expression ISO Cpne1 (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of CPNE1 protein CTD PMID:35362542 Cpne1 Rat diarsenic trioxide multiple interactions ISO CPNE1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to CPNE1 protein] CTD PMID:26598702 Cpne1 Rat Dibutyl phosphate affects expression ISO CPNE1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of CPNE1 mRNA CTD PMID:37042841 Cpne1 Rat dibutyl phthalate decreases expression ISO Cpne1 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of CPNE1 protein CTD PMID:34864091 Cpne1 Rat doxorubicin decreases expression ISO CPNE1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of CPNE1 mRNA CTD PMID:29803840 Cpne1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of CPNE1 mRNA CTD PMID:29391264 Cpne1 Rat enzyme inhibitor multiple interactions ISO CPNE1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of CPNE1 protein CTD PMID:23301498 Cpne1 Rat ethanol affects expression ISO Cpne1 (Mus musculus) 6480464 Ethanol affects the expression of CPNE1 mRNA CTD PMID:30319688 Cpne1 Rat Evodiamine multiple interactions ISO Cpne1 (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in decreased expression of CPNE1 protein] CTD PMID:35362542 Cpne1 Rat folic acid increases expression ISO Cpne1 (Mus musculus) 6480464 Folic Acid results in increased expression of CPNE1 mRNA CTD PMID:25629700 Cpne1 Rat furfural multiple interactions ISO CPNE1 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Cpne1 Rat glyphosate increases expression EXP 6480464 Glyphosate results in increased expression of CPNE1 mRNA CTD PMID:38314887 Cpne1 Rat ivermectin decreases expression ISO CPNE1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of CPNE1 protein CTD PMID:32959892 Cpne1 Rat lead diacetate increases expression ISO Cpne1 (Mus musculus) 6480464 lead acetate results in increased expression of CPNE1 mRNA CTD PMID:21829687 Cpne1 Rat leflunomide decreases expression ISO Cpne1 (Mus musculus) 6480464 leflunomide results in decreased expression of CPNE1 mRNA CTD PMID:19751817 Cpne1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of CPNE1 mRNA CTD PMID:33387578 Cpne1 Rat PCB138 multiple interactions ISO Cpne1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Cpne1 Rat rotenone increases expression ISO CPNE1 (Homo sapiens) 6480464 Rotenone results in increased expression of CPNE1 mRNA CTD PMID:29955902 Cpne1 Rat SB 431542 multiple interactions ISO CPNE1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of CPNE1 protein CTD PMID:37664457 Cpne1 Rat sodium arsenite decreases expression ISO CPNE1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of CPNE1 mRNA CTD PMID:38568856 Cpne1 Rat sodium chloride multiple interactions ISO CPNE1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of CPNE1 protein more ... CTD PMID:38598786 Cpne1 Rat sulindac decreases expression ISO CPNE1 (Homo sapiens) 6480464 Sulindac results in decreased expression of CPNE1 mRNA CTD PMID:11906190 Cpne1 Rat temozolomide decreases expression ISO CPNE1 (Homo sapiens) 6480464 Temozolomide results in decreased expression of CPNE1 mRNA CTD PMID:31758290 Cpne1 Rat tert-butyl hydroperoxide increases expression ISO CPNE1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of CPNE1 mRNA CTD PMID:15336504 Cpne1 Rat thapsigargin decreases expression ISO CPNE1 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of CPNE1 protein CTD PMID:21692457 Cpne1 Rat theophylline affects binding ISO CPNE1 (Homo sapiens) 6480464 Theophylline binds to CPNE1 protein CTD PMID:18951874 Cpne1 Rat thiram decreases expression ISO CPNE1 (Homo sapiens) 6480464 Thiram results in decreased expression of CPNE1 mRNA CTD PMID:38568856 Cpne1 Rat titanium dioxide decreases methylation ISO Cpne1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CPNE1 gene and titanium dioxide results in decreased methylation of CPNE1 promoter CTD PMID:35295148 Cpne1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of CPNE1 mRNA CTD PMID:33387578 Cpne1 Rat triphenyl phosphate affects expression ISO CPNE1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CPNE1 mRNA CTD PMID:37042841 Cpne1 Rat triptonide decreases expression ISO Cpne1 (Mus musculus) 6480464 triptonide results in decreased expression of CPNE1 mRNA CTD PMID:33045310 Cpne1 Rat valproic acid affects expression ISO Cpne1 (Mus musculus) 6480464 Valproic Acid affects the expression of CPNE1 mRNA CTD PMID:17963808 Cpne1 Rat vitamin E increases expression ISO CPNE1 (Homo sapiens) 6480464 Vitamin E results in increased expression of CPNE1 mRNA CTD PMID:19244175
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 2-amino-14,16-dimethyloctadecan-3-ol (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) acetylsalicylic acid (ISO) aconitine (EXP) aflatoxin B1 (ISO) aristolochic acid A (ISO) arsenous acid (ISO) atrazine (ISO) beauvericin (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) bromobenzene (EXP) cadmium dichloride (ISO) CGP 52608 (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) clozapine (ISO) cobalt dichloride (ISO) copper(II) chloride (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) doxorubicin (ISO) endosulfan (EXP) enzyme inhibitor (ISO) ethanol (ISO) Evodiamine (ISO) folic acid (ISO) furfural (ISO) glyphosate (EXP) ivermectin (ISO) lead diacetate (ISO) leflunomide (ISO) paracetamol (EXP) PCB138 (ISO) rotenone (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium chloride (ISO) sulindac (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) thapsigargin (ISO) theophylline (ISO) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO) vitamin E (ISO)
Cpne1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 165,047,615 - 165,089,994 (-) NCBI GRCr8 mRatBN7.2 3 144,587,531 - 144,629,911 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 144,588,995 - 144,598,636 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 148,454,985 - 148,462,709 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 157,072,257 - 157,079,981 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 154,811,783 - 154,819,507 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 151,617,733 - 151,625,448 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 151,616,037 - 151,625,644 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 152,150,152 - 152,159,749 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 157,980,656 - 157,994,839 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.1 3 146,386,321 - 146,433,463 (-) NCBI Celera 3 143,310,994 - 143,318,709 (-) NCBI Celera Cytogenetic Map 3 q42 NCBI
CPNE1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 35,626,044 - 35,664,900 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 35,626,031 - 35,664,956 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 34,213,966 - 34,252,822 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 33,677,380 - 33,716,262 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 33,677,381 - 33,716,262 NCBI Celera 20 30,962,261 - 31,001,142 (-) NCBI Celera Cytogenetic Map 20 q11.22 NCBI HuRef 20 30,991,367 - 31,030,291 (-) NCBI HuRef CHM1_1 20 34,115,593 - 34,154,510 (-) NCBI CHM1_1 T2T-CHM13v2.0 20 37,347,020 - 37,385,875 (-) NCBI T2T-CHM13v2.0
Cpne1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 155,913,765 - 155,953,847 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 155,913,762 - 155,953,885 (-) Ensembl GRCm39 Ensembl GRCm38 2 156,071,841 - 156,111,965 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 156,071,842 - 156,111,965 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 155,897,577 - 155,937,701 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 155,763,286 - 155,803,405 (-) NCBI MGSCv36 mm8 Celera 2 162,007,248 - 162,047,562 (-) NCBI Celera Cytogenetic Map 2 H1 NCBI cM Map 2 77.34 NCBI
Cpne1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955422 25,793,819 - 25,837,564 (+) Ensembl ChiLan1.0 ChiLan1.0 Ensembl NW_004955422 25,793,841 - 25,806,956 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955422 25,793,841 - 25,837,680 (+) NCBI ChiLan1.0 ChiLan1.0
CPNE1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 24,554,636 - 24,589,748 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 24,554,636 - 24,589,731 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 24,199,753 - 24,234,861 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 25,247,213 - 25,282,324 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 25,246,568 - 25,282,307 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 24,533,545 - 24,568,660 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 24,628,580 - 24,663,692 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 25,067,994 - 25,103,125 (-) NCBI UU_Cfam_GSD_1.0
CPNE1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 38,956,673 - 38,964,890 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 38,956,489 - 38,997,189 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 44,285,465 - 44,326,165 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
Cpne1
.
Predicted Target Of
Count of predictions: 119 Count of miRNA genes: 72 Interacting mature miRNAs: 80 Transcripts: ENSRNOT00000026657, ENSRNOT00000067490 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 1598877 Bp285 Blood pressure QTL 285 1.5 0.03 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 120538241 165538241 Rat 1578653 Vnigr3 Vascular neointimal growth QTL 3 3.1 artery morphology trait (VT:0002191) artery neointimal hyperplastic lesion area (CMO:0001414) 3 130656562 169034231 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 1298068 Bp167 Blood pressure QTL 167 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 141074471 169034231 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 2298477 Eau4 Experimental allergic uveoretinitis QTL 4 0.0011 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 3 137398739 169034231 Rat 61335 Bp20 Blood pressure QTL 20 3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 141339236 155617360 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1331726 Bp208 Blood pressure QTL 208 3.129 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 141339013 162184794 Rat 1300173 Rf11 Renal function QTL 11 3.38 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 121056165 145956249 Rat 9589106 Insul23 Insulin level QTL 23 13.86 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 3 131635904 169034231 Rat 10755461 Coatc16 Coat color QTL 16 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 3 122438700 167438700 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 2303620 Vencon4 Ventilatory control QTL 4 3.9 respiration trait (VT:0001943) tidal volume (CMO:0000222) 3 127162703 168026850 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 1576306 Schws3 Schwannoma susceptibility QTL 3 0.001 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 3 118839124 163839124 Rat 619618 Rf3 Renal disease susceptibility QTL 3 6.5 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate to body weight ratio (CMO:0001270) 3 107693393 152693393 Rat 1300159 Kidm4 Kidney mass QTL 4 3.83 kidney mass (VT:0002707) right kidney wet weight to body weight ratio (CMO:0001953) 3 121056165 157309487 Rat 5686842 Rf59 Renal function QTL 59 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 3 140069424 146976080 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 631673 Iddm13 Insulin dependent diabetes mellitus QTL 13 1.3 0.663 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 3 130193298 161695983 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 1578656 Vnigr2 Vascular neointimal growth QTL 2 4.2 artery morphology trait (VT:0002191) lesioned artery residual lumen area (CMO:0001417) 3 130656562 169034231 Rat 8552952 Pigfal13 Plasma insulin-like growth factor 1 level QTL 13 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 138799500 169034231 Rat 631541 Bp81 Blood pressure QTL 81 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 124122556 169034231 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat
REN58508
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 144,595,209 - 144,595,461 (+) MAPPER mRatBN7.2 Rnor_6.0 3 152,157,821 - 152,158,072 NCBI Rnor6.0 Rnor_6.0 3 151,623,716 - 151,623,967 NCBI Rnor6.0 Rnor_5.0 3 157,988,334 - 157,988,585 UniSTS Rnor5.0 Rnor_5.0 3 159,532,709 - 159,532,960 UniSTS Rnor5.0 RGSC_v3.4 3 146,486,723 - 146,486,974 UniSTS RGSC3.4 Celera 3 143,316,977 - 143,317,228 UniSTS Cytogenetic Map 3 q42 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
28
11
67
221
197
186
115
46
115
24
400
172
165
77
130
71
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000026657 ⟹ ENSRNOP00000026657
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 144,588,995 - 144,598,636 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000067490 ⟹ ENSRNOP00000059795
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 144,588,995 - 144,598,636 (-) Ensembl
RefSeq Acc Id:
NM_001256465 ⟹ NP_001243394
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 165,047,615 - 165,089,994 (-) NCBI mRatBN7.2 3 144,587,531 - 144,629,911 (-) NCBI Rnor_6.0 3 151,617,733 - 151,625,448 (-) NCBI Rnor_5.0 3 157,980,656 - 157,994,839 (-) NCBI Celera 3 143,310,994 - 143,318,709 (-) NCBI
Sequence:
ATGGCCCATTGTGTGACCTTGGTTCAGCTGTCCGTTTCCTGTGACCACCTCATTGACAAGGACATCGGCTCCAAGTCTGACCCACTCTGCGTCCTTTTACAGGATGTGGGAGGTGCCTGGGCTGAGCT
hide sequence
RefSeq Acc Id:
NP_001243394 ⟸ NM_001256465
- UniProtKB:
D4A1R8 (UniProtKB/Swiss-Prot), D3ZSJ8 (UniProtKB/Swiss-Prot), H1UBM6 (UniProtKB/Swiss-Prot), A0A8L2QF48 (UniProtKB/TrEMBL)
- Sequence:
MAHCVTLVQLSVSCDHLIDKDIGSKSDPLCVLLQDVGGAWAELCRTERVRNCSSPAFSKTLQIEYHFETVQKLRFGIYDIDNKTPELGDDDFLGGAECSLGQIVSSQTLTLPLMLKPGKPAGRGTITV
hide sequence
Ensembl Acc Id:
ENSRNOP00000059795 ⟸ ENSRNOT00000067490
Ensembl Acc Id:
ENSRNOP00000026657 ⟸ ENSRNOT00000026657
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-12-20
Cpne1
copine 1
LOC100910990
copine-1-like
Data merged from RGD:6495669
737654 PROVISIONAL
2016-02-03
Cpne1
copine 1
Cpne1
copine I
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-07-05
LOC100910990
copine-1-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2008-04-30
Cpne1
copine I
Cpne1_predicted
copine I (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Cpne1_predicted
copine I (predicted)
Symbol and Name status set to approved
70820 APPROVED
