Symbol:
Arglu1
Name:
arginine and glutamate rich 1
RGD ID:
1310061
Description:
Predicted to enable pre-mRNA binding activity and transcription coactivator activity. Predicted to be involved in regulation of alternative mRNA splicing, via spliceosome. Predicted to be located in cytosol and nuclear speck. Predicted to be active in mitochondrion and nucleoplasm. Orthologous to human ARGLU1 (arginine and glutamate rich 1); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
arginine and glutamate-rich protein 1; LOC290912; MGC109359; MGC156517; RGD1310061; similar to hypothetical protein FLJ10154
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 87,455,097 - 87,479,148 (+) NCBI GRCr8 mRatBN7.2 16 80,753,300 - 80,777,350 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 80,753,315 - 80,777,349 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 86,032,336 - 86,056,378 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 89,484,947 - 89,508,989 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 84,729,373 - 84,753,409 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 86,600,877 - 86,625,084 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 86,600,877 - 86,625,083 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 86,014,418 - 86,038,237 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 86,143,399 - 86,181,601 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 86,129,438 - 86,167,640 (+) NCBI Celera 16 78,531,608 - 78,555,458 (+) NCBI Celera Cytogenetic Map 16 q12.5 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Arglu1 Rat (+)-catechin multiple interactions ISO ARGLU1 (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of ARGLU1 mRNA CTD PMID:24763279 Arglu1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ARGLU1 mRNA] CTD PMID:31150632 Arglu1 Rat (-)-demecolcine decreases expression ISO ARGLU1 (Homo sapiens) 6480464 Demecolcine results in decreased expression of ARGLU1 mRNA CTD PMID:23649840 Arglu1 Rat (1->4)-beta-D-glucan multiple interactions ISO Arglu1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ARGLU1 mRNA CTD PMID:36331819 Arglu1 Rat (S)-nicotine increases expression ISO ARGLU1 (Homo sapiens) 6480464 Nicotine results in increased expression of ARGLU1 mRNA CTD PMID:16949557 Arglu1 Rat 1,2-dimethylhydrazine multiple interactions ISO Arglu1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of ARGLU1 mRNA] CTD PMID:22206623 Arglu1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Arglu1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to ARGLU1 promoter] CTD PMID:19654925 Arglu1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ARGLU1 mRNA CTD PMID:33387578 Arglu1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ARGLU1 mRNA CTD PMID:34747641 Arglu1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Arglu1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ARGLU1 mRNA CTD PMID:21570461 and PMID:24680724 Arglu1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Arglu1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of ARGLU1 mRNA CTD PMID:20188158 Arglu1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO ARGLU1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of ARGLU1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of ARGLU1 mRNA CTD PMID:28628672 Arglu1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO ARGLU1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of ARGLU1 mRNA CTD PMID:28628672 Arglu1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of ARGLU1 mRNA CTD PMID:36041667 Arglu1 Rat 4,4'-sulfonyldiphenol increases expression ISO Arglu1 (Mus musculus) 6480464 bisphenol S results in increased expression of ARGLU1 mRNA CTD PMID:39298647 Arglu1 Rat 4-hydroxyphenyl retinamide increases expression ISO Arglu1 (Mus musculus) 6480464 Fenretinide results in increased expression of ARGLU1 mRNA CTD PMID:28973697 Arglu1 Rat aflatoxin B1 decreases methylation ISO ARGLU1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of ARGLU1 gene CTD PMID:27153756 Arglu1 Rat all-trans-retinoic acid decreases expression ISO ARGLU1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of ARGLU1 mRNA CTD PMID:21934132 Arglu1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of ARGLU1 mRNA CTD PMID:38685447 Arglu1 Rat arsane multiple interactions ISO ARGLU1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ARGLU1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ARGLU1 mRNA CTD PMID:39836092 Arglu1 Rat arsenic atom multiple interactions ISO ARGLU1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ARGLU1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ARGLU1 mRNA CTD PMID:39836092 Arglu1 Rat benzo[a]pyrene increases expression ISO ARGLU1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of ARGLU1 mRNA CTD PMID:26238291 Arglu1 Rat benzo[a]pyrene multiple interactions ISO Arglu1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of ARGLU1 mRNA CTD PMID:27858113 Arglu1 Rat benzo[b]fluoranthene multiple interactions ISO Arglu1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of ARGLU1 mRNA CTD PMID:27858113 Arglu1 Rat Benzo[ghi]perylene decreases expression ISO Arglu1 (Mus musculus) 6480464 1 and 12-benzoperylene results in decreased expression of ARGLU1 mRNA CTD PMID:26377693 Arglu1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Arglu1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of ARGLU1 mRNA CTD PMID:33754040 Arglu1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Arglu1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of ARGLU1 mRNA CTD PMID:33754040 Arglu1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ARGLU1 mRNA CTD PMID:25181051 Arglu1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of ARGLU1 mRNA CTD PMID:36041667 Arglu1 Rat bisphenol A increases methylation ISO ARGLU1 (Homo sapiens) 6480464 bisphenol A results in increased methylation of ARGLU1 gene CTD PMID:31601247 Arglu1 Rat bisphenol A decreases expression ISO ARGLU1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of ARGLU1 mRNA CTD PMID:33670352 Arglu1 Rat bisphenol A decreases expression ISO Arglu1 (Mus musculus) 6480464 bisphenol A results in decreased expression of ARGLU1 mRNA CTD PMID:32156529 and PMID:33221593 Arglu1 Rat bisphenol A multiple interactions ISO ARGLU1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of ARGLU1 mRNA CTD PMID:28628672 Arglu1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of ARGLU1 mRNA CTD PMID:36041667 Arglu1 Rat cadmium atom multiple interactions ISO ARGLU1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ARGLU1 mRNA CTD PMID:35301059 Arglu1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of ARGLU1 mRNA CTD PMID:19010381 Arglu1 Rat cadmium dichloride multiple interactions ISO ARGLU1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ARGLU1 mRNA CTD PMID:35301059 Arglu1 Rat cadmium dichloride decreases expression ISO ARGLU1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of ARGLU1 mRNA CTD PMID:38568856 Arglu1 Rat caffeine decreases phosphorylation ISO ARGLU1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of ARGLU1 protein CTD PMID:35688186 Arglu1 Rat cannabidiol increases expression ISO ARGLU1 (Homo sapiens) 6480464 Cannabidiol results in increased expression of ARGLU1 mRNA CTD PMID:27918106 Arglu1 Rat carbon nanotube decreases expression ISO Arglu1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Arglu1 Rat carbon nanotube increases expression ISO Arglu1 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of ARGLU1 mRNA CTD PMID:25620056 Arglu1 Rat chrysene multiple interactions ISO Arglu1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of ARGLU1 mRNA CTD PMID:27858113 Arglu1 Rat coumarin decreases phosphorylation ISO ARGLU1 (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of ARGLU1 protein CTD PMID:35688186 Arglu1 Rat cyclosporin A decreases expression ISO ARGLU1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ARGLU1 mRNA CTD PMID:25562108 Arglu1 Rat deoxynivalenol decreases phosphorylation ISO Arglu1 (Mus musculus) 6480464 deoxynivalenol results in decreased phosphorylation of ARGLU1 protein CTD PMID:23811945 Arglu1 Rat dexamethasone multiple interactions ISO ARGLU1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of ARGLU1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of ARGLU1 mRNA CTD PMID:28628672 Arglu1 Rat dibenz[a,h]anthracene decreases expression ISO Arglu1 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Arglu1 Rat Dibutyl phosphate affects expression ISO ARGLU1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ARGLU1 mRNA CTD PMID:37042841 Arglu1 Rat diethylstilbestrol increases expression ISO ARGLU1 (Homo sapiens) 6480464 Diethylstilbestrol results in increased expression of ARGLU1 mRNA CTD PMID:36621641 Arglu1 Rat dorsomorphin multiple interactions ISO ARGLU1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Arglu1 Rat folic acid multiple interactions ISO Arglu1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of ARGLU1 mRNA] CTD PMID:22206623 Arglu1 Rat FR900359 affects phosphorylation ISO ARGLU1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of ARGLU1 protein CTD PMID:37730182 Arglu1 Rat furan increases methylation EXP 6480464 furan results in increased methylation of ARGLU1 gene CTD PMID:22079235 Arglu1 Rat indometacin multiple interactions ISO ARGLU1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of ARGLU1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of ARGLU1 mRNA CTD PMID:28628672 Arglu1 Rat lead diacetate increases expression ISO Arglu1 (Mus musculus) 6480464 lead acetate results in increased expression of ARGLU1 mRNA CTD PMID:21829687 Arglu1 Rat leflunomide decreases expression ISO ARGLU1 (Homo sapiens) 6480464 leflunomide results in decreased expression of ARGLU1 mRNA CTD PMID:28988120 Arglu1 Rat manganese atom multiple interactions ISO ARGLU1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ARGLU1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of ARGLU1 mRNA CTD PMID:39836092 Arglu1 Rat manganese(0) multiple interactions ISO ARGLU1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ARGLU1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of ARGLU1 mRNA CTD PMID:39836092 Arglu1 Rat manganese(II) chloride multiple interactions ISO ARGLU1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ARGLU1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of ARGLU1 mRNA CTD PMID:39836092 Arglu1 Rat methotrexate increases expression ISO ARGLU1 (Homo sapiens) 6480464 Methotrexate results in increased expression of ARGLU1 mRNA CTD PMID:24449571 Arglu1 Rat methylmercury chloride decreases expression ISO ARGLU1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of ARGLU1 mRNA CTD PMID:28001369 Arglu1 Rat mono(2-ethyl-5-oxohexyl) phthalate affects expression ISO ARGLU1 (Homo sapiens) 6480464 mono(2-ethyl-5-oxohexyl)phthalate affects the expression of ARGLU1 mRNA CTD PMID:34478338 Arglu1 Rat nicotine increases expression ISO ARGLU1 (Homo sapiens) 6480464 Nicotine results in increased expression of ARGLU1 mRNA CTD PMID:16949557 Arglu1 Rat nitrates multiple interactions ISO Arglu1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of ARGLU1 mRNA CTD PMID:35964746 Arglu1 Rat ozone multiple interactions ISO ARGLU1 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of ARGLU1 mRNA CTD PMID:35430440 Arglu1 Rat ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of ARGLU1 mRNA CTD PMID:37871705 Arglu1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Arglu1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ARGLU1 mRNA CTD PMID:36331819 Arglu1 Rat SB 431542 multiple interactions ISO ARGLU1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Arglu1 Rat sodium arsenate increases expression ISO Arglu1 (Mus musculus) 6480464 sodium arsenate results in increased expression of ARGLU1 mRNA CTD PMID:21795629 Arglu1 Rat sodium arsenite decreases expression ISO ARGLU1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ARGLU1 mRNA CTD PMID:38568856 Arglu1 Rat sodium arsenite increases expression ISO Arglu1 (Mus musculus) 6480464 sodium arsenite results in increased expression of ARGLU1 mRNA CTD PMID:36209798 Arglu1 Rat sodium arsenite multiple interactions ISO ARGLU1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ARGLU1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ARGLU1 mRNA CTD PMID:39836092 Arglu1 Rat sulindac increases expression ISO ARGLU1 (Homo sapiens) 6480464 Sulindac results in increased expression of ARGLU1 mRNA CTD PMID:11906190 Arglu1 Rat sunitinib increases expression ISO ARGLU1 (Homo sapiens) 6480464 Sunitinib results in increased expression of ARGLU1 mRNA CTD PMID:31533062 Arglu1 Rat temozolomide decreases expression ISO ARGLU1 (Homo sapiens) 6480464 Temozolomide results in decreased expression of ARGLU1 mRNA CTD PMID:31758290 Arglu1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ARGLU1 mRNA] CTD PMID:31150632 Arglu1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of ARGLU1 mRNA CTD PMID:31150632 Arglu1 Rat tetraphene decreases expression ISO Arglu1 (Mus musculus) 6480464 benz(a)anthracene results in decreased expression of ARGLU1 mRNA CTD PMID:26377693 Arglu1 Rat tetraphene multiple interactions ISO Arglu1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of ARGLU1 mRNA CTD PMID:27858113 Arglu1 Rat thimerosal decreases expression ISO ARGLU1 (Homo sapiens) 6480464 Thimerosal results in decreased expression of ARGLU1 mRNA CTD PMID:27188386 Arglu1 Rat titanium dioxide increases expression ISO Arglu1 (Mus musculus) 6480464 titanium dioxide results in increased expression of ARGLU1 mRNA CTD PMID:29264374 Arglu1 Rat titanium dioxide decreases methylation ISO Arglu1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ARGLU1 gene CTD PMID:35295148 Arglu1 Rat topotecan affects response to substance ISO ARGLU1 (Homo sapiens) 6480464 ARGLU1 protein affects the susceptibility to Topotecan CTD PMID:16217747 Arglu1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of ARGLU1 mRNA CTD PMID:33387578 Arglu1 Rat trichostatin A decreases expression ISO ARGLU1 (Homo sapiens) 6480464 trichostatin A results in decreased expression of ARGLU1 mRNA CTD PMID:24935251 and PMID:26272509 Arglu1 Rat trichostatin A multiple interactions ISO ARGLU1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ARGLU1 mRNA CTD PMID:27188386 Arglu1 Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of ARGLU1 protein CTD PMID:32519852 Arglu1 Rat urethane decreases expression ISO ARGLU1 (Homo sapiens) 6480464 Urethane results in decreased expression of ARGLU1 mRNA CTD PMID:28818685 Arglu1 Rat valproic acid decreases methylation ISO ARGLU1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of ARGLU1 gene CTD PMID:29154799 Arglu1 Rat valproic acid decreases expression ISO ARGLU1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ARGLU1 mRNA CTD PMID:23179753 more ... Arglu1 Rat valproic acid multiple interactions ISO ARGLU1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ARGLU1 mRNA CTD PMID:27188386 Arglu1 Rat vorinostat decreases expression ISO ARGLU1 (Homo sapiens) 6480464 vorinostat results in decreased expression of ARGLU1 mRNA CTD PMID:27188386
(+)-catechin (ISO) (+)-schisandrin B (EXP) (-)-demecolcine (ISO) (1->4)-beta-D-glucan (ISO) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) Benzo[ghi]perylene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) cannabidiol (ISO) carbon nanotube (ISO) chrysene (ISO) coumarin (ISO) cyclosporin A (ISO) deoxynivalenol (ISO) dexamethasone (ISO) dibenz[a,h]anthracene (ISO) Dibutyl phosphate (ISO) diethylstilbestrol (ISO) dorsomorphin (ISO) folic acid (ISO) FR900359 (ISO) furan (EXP) indometacin (ISO) lead diacetate (ISO) leflunomide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methotrexate (ISO) methylmercury chloride (ISO) mono(2-ethyl-5-oxohexyl) phthalate (ISO) nicotine (ISO) nitrates (ISO) ozone (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) SB 431542 (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sulindac (ISO) sunitinib (ISO) temozolomide (ISO) tetrachloromethane (EXP) tetraphene (ISO) thimerosal (ISO) titanium dioxide (ISO) topotecan (ISO) trichloroethene (EXP) trichostatin A (ISO) Triptolide (EXP) urethane (ISO) valproic acid (ISO) vorinostat (ISO)
Arglu1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 87,455,097 - 87,479,148 (+) NCBI GRCr8 mRatBN7.2 16 80,753,300 - 80,777,350 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 80,753,315 - 80,777,349 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 86,032,336 - 86,056,378 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 89,484,947 - 89,508,989 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 84,729,373 - 84,753,409 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 86,600,877 - 86,625,084 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 86,600,877 - 86,625,083 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 86,014,418 - 86,038,237 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 86,143,399 - 86,181,601 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 86,129,438 - 86,167,640 (+) NCBI Celera 16 78,531,608 - 78,555,458 (+) NCBI Celera Cytogenetic Map 16 q12.5 NCBI
ARGLU1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 13 106,541,673 - 106,568,137 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 13 106,541,673 - 106,568,137 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 13 107,194,021 - 107,220,485 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 13 105,993,663 - 106,018,515 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 13 88,039,892 - 88,064,742 (-) NCBI Celera Cytogenetic Map 13 q33.3 NCBI HuRef 13 87,787,076 - 87,811,929 (-) NCBI HuRef CHM1_1 13 107,164,330 - 107,189,194 (-) NCBI CHM1_1 T2T-CHM13v2.0 13 105,762,093 - 105,788,553 (-) NCBI T2T-CHM13v2.0
Arglu1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 8,716,307 - 8,741,818 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 8,715,075 - 8,740,521 (-) Ensembl GRCm39 Ensembl GRCm38 8 8,666,297 - 8,690,550 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 8,665,075 - 8,690,521 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 8,666,576 - 8,690,537 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 8,666,548 - 8,690,493 (-) NCBI MGSCv36 mm8 Celera 8 8,839,215 - 8,862,964 (-) NCBI Celera Cytogenetic Map 8 A1.1 NCBI cM Map 8 3.57 NCBI
Arglu1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955404 4,962,000 - 4,980,226 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955404 4,962,000 - 4,980,226 (+) NCBI ChiLan1.0 ChiLan1.0
ARGLU1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 14 108,040,331 - 108,065,175 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 13 106,720,660 - 106,745,507 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 13 87,683,306 - 87,708,108 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 13 106,823,229 - 106,847,933 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 13 106,823,229 - 106,847,933 (-) Ensembl panpan1.1 panPan2
ARGLU1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 22 55,616,498 - 55,640,157 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 22 55,616,977 - 55,639,784 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 22 55,374,265 - 55,397,955 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 22 56,128,655 - 56,152,154 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 22 56,126,981 - 56,152,126 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 22 55,721,376 - 55,745,016 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 22 55,708,193 - 55,731,591 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 22 55,746,940 - 55,770,656 (-) NCBI UU_Cfam_GSD_1.0
Arglu1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 190,819,302 - 190,846,313 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936472 5,105,269 - 5,134,313 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936472 5,105,836 - 5,131,294 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ARGLU1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 11 74,239,419 - 74,267,379 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 11 74,241,089 - 74,267,416 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 11 81,617,834 - 81,644,114 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ARGLU1
Arglu1
.
Predicted Target Of
Count of predictions: 103 Count of miRNA genes: 76 Interacting mature miRNAs: 98 Transcripts: ENSRNOT00000057347 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2300163 Bmd64 Bone mineral density QTL 64 5.3 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 16 37752156 82752156 Rat 7411648 Foco22 Food consumption QTL 22 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 16 52726464 84729064 Rat 2293690 Bss45 Bone structure and strength QTL 45 5.13 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 16 37752156 82752156 Rat 8694364 Abfw7 Abdominal fat weight QTL 7 12.22 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 16 52726464 84729064 Rat 8694429 Bw164 Body weight QTL 164 5 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 16 52726464 84729064 Rat 7205510 Activ5 Activity QTL 5 3.78 0.00028 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 42396345 84729064 Rat 70205 Gcr3 Gastric cancer resistance QTL 3 2.3 stomach morphology trait (VT:0000470) stomach tumor diameter (CMO:0001889) 16 17696791 82635055 Rat 631525 Pia14 Pristane induced arthritis QTL 14 4.4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 16 55711087 83402471 Rat
RH128419
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 80,776,999 - 80,777,205 (+) MAPPER mRatBN7.2 Rnor_6.0 16 86,624,734 - 86,624,939 NCBI Rnor6.0 Rnor_5.0 16 86,037,887 - 86,038,092 UniSTS Rnor5.0 RGSC_v3.4 16 86,181,251 - 86,181,456 UniSTS RGSC3.4 Celera 16 78,555,108 - 78,555,313 UniSTS RH 3.4 Map 16 787.9 UniSTS RH 3.4 Map 16 786.1 UniSTS Cytogenetic Map 16 q12.5 UniSTS
FLJ10154
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 80,776,562 - 80,776,724 (+) MAPPER mRatBN7.2 Rnor_6.0 16 86,624,297 - 86,624,458 NCBI Rnor6.0 Rnor_5.0 16 86,037,450 - 86,037,611 UniSTS Rnor5.0 RGSC_v3.4 16 86,180,814 - 86,180,975 UniSTS RGSC3.4 Celera 16 78,554,671 - 78,554,832 UniSTS Cytogenetic Map 16 q12.5 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000057347 ⟹ ENSRNOP00000054160
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 80,753,315 - 80,777,349 (+) Ensembl Rnor_6.0 Ensembl 16 86,600,877 - 86,625,083 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000088161 ⟹ ENSRNOP00000071691
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 16 86,624,391 - 86,624,524 (+) Ensembl
RefSeq Acc Id:
NM_001024972 ⟹ NP_001020143
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 87,455,113 - 87,479,148 (+) NCBI mRatBN7.2 16 80,753,315 - 80,777,350 (+) NCBI Rnor_6.0 16 86,600,877 - 86,625,084 (+) NCBI Rnor_5.0 16 86,014,418 - 86,038,237 (+) NCBI RGSC_v3.4 16 86,143,399 - 86,181,601 (+) RGD Celera 16 78,531,608 - 78,555,458 (+) RGD
Sequence:
GGGAAGGGCGGCCGGTGCTGCCACAGCTGCCATCTTAGGGACTCCGGGCCAGGCCTGCTAGGCCTTCGCGGCGGAGGCGGCCGTGTGCGTGGCGGGTGCGCTTGGGGCGAGGCGGAGGGTCCGCGGGC
hide sequence
RefSeq Acc Id:
XR_010058287
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 87,455,097 - 87,463,990 (+) NCBI
RefSeq Acc Id:
NP_001020143 ⟸ NM_001024972
- UniProtKB:
A0JPJ8 (UniProtKB/Swiss-Prot), Q5BJT0 (UniProtKB/Swiss-Prot)
- Sequence:
MGRSRSRSSSRSKHTKSSKHNKKRSRSRSRSRDKERVRKRSKSRESKRNRRRESRSRSRSTNAAASRRERERASSPPDRIDIFGRTVSKRSSLDEKQKREEEEKKAEFERQRKIRQQEIEEKLIEEET
hide sequence
Ensembl Acc Id:
ENSRNOP00000054160 ⟸ ENSRNOT00000057347
Ensembl Acc Id:
ENSRNOP00000071691 ⟸ ENSRNOT00000088161
RGD ID: 13700250 Promoter ID: EPDNEW_R10774 Type: initiation region Name: Arglu1_1 Description: arginine and glutamate rich 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 16 86,600,872 - 86,600,932 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2010-01-29
Arglu1
arginine and glutamate rich 1
RGD1310061
similar to hypothetical protein FLJ10154
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
RGD1310061
similar to hypothetical protein FLJ10154
RGD1310061_predicted
similar to hypothetical protein FLJ10154 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1310061_predicted
similar to hypothetical protein FLJ10154 (predicted)
LOC290912_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC290912_predicted
similar to hypothetical protein FLJ10154 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
