Advanced Search (OLGA)

Gene: Arglu1 (arginine and glutamate rich 1) Rattus norvegicus

Analyze

Symbol:

Arglu1

Name:

arginine and glutamate rich 1

RGD ID:

1310061

Description:

Predicted to enable pre-mRNA binding activity and transcription coactivator activity. Predicted to be involved in regulation of alternative mRNA splicing, via spliceosome. Predicted to be located in cytosol and nuclear speck. Predicted to be active in mitochondrion and nucleoplasm. Orthologous to human ARGLU1 (arginine and glutamate rich 1); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

arginine and glutamate-rich protein 1; LOC290912; MGC109359; MGC156517; RGD1310061; similar to hypothetical protein FLJ10154

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ARGLU1 (arginine and glutamate rich 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Arglu1 (arginine and glutamate rich 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Arglu1 (arginine and glutamate rich 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ARGLU1 (arginine and glutamate rich 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ARGLU1 (arginine and glutamate rich 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Arglu1 (arginine and glutamate rich 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ARGLU1 (arginine and glutamate rich 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ARGLU1 (arginine and glutamate rich 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Arglu1 (arginine and glutamate rich 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	UBE2V1 (ubiquitin conjugating enzyme E2 V1)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Arglu1 (arginine and glutamate rich 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ARGLU1 (arginine and glutamate rich 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	arglu1a (arginine and glutamate rich 1a)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	arglu1b (arginine and glutamate rich 1b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG31712	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	F44E2.3	Alliance	DIOPT (OMA\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	arglu1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	87,455,097 - 87,479,148 (+)	NCBI		GRCr8
mRatBN7.2	16	80,753,300 - 80,777,350 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	80,753,315 - 80,777,349 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	86,032,336 - 86,056,378 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	89,484,947 - 89,508,989 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	84,729,373 - 84,753,409 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	86,600,877 - 86,625,084 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	86,600,877 - 86,625,083 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	86,014,418 - 86,038,237 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	86,143,399 - 86,181,601 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	86,129,438 - 86,167,640 (+)	NCBI
Celera	16	78,531,608 - 78,555,458 (+)	NCBI		Celera
Cytogenetic Map	16	q12.5	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Arglu1	Rat	Anal Atresia, Hypospadias, and Penoscrotal Inversion		ISO	RGD:1605984	8554872	ClinVar Annotator: match by term: Anal atresia, hypospadias, and penoscrotal inversion	ClinVar	PMID:31690835

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Arglu1	Rat	(+)-catechin	multiple interactions	ISO	RGD:1605984	6480464	[Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of ARGLU1 mRNA	CTD	PMID:24763279
Arglu1	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ARGLU1 mRNA]	CTD	PMID:31150632
Arglu1	Rat	(-)-demecolcine	decreases expression	ISO	RGD:1605984	6480464	Demecolcine results in decreased expression of ARGLU1 mRNA	CTD	PMID:23649840
Arglu1	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	RGD:1320746	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ARGLU1 mRNA	CTD	PMID:36331819
Arglu1	Rat	(S)-nicotine	increases expression	ISO	RGD:1605984	6480464	Nicotine results in increased expression of ARGLU1 mRNA	CTD	PMID:16949557
Arglu1	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	RGD:1320746	6480464	Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of ARGLU1 mRNA]	CTD	PMID:22206623
Arglu1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1320746	6480464	Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to ARGLU1 promoter]	CTD	PMID:19654925
Arglu1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of ARGLU1 mRNA	CTD	PMID:33387578
Arglu1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of ARGLU1 mRNA	CTD	PMID:34747641
Arglu1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1320746	6480464	Tetrachlorodibenzodioxin affects the expression of ARGLU1 mRNA	CTD	PMID:21570461\|PMID:24680724
Arglu1	Rat	3,4-methylenedioxymethamphetamine	increases expression	ISO	RGD:1320746	6480464	N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of ARGLU1 mRNA	CTD	PMID:20188158
Arglu1	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	RGD:1605984	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Arglu1	Rat	4,4'-sulfonyldiphenol	multiple interactions	ISO	RGD:1605984	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ...	CTD	PMID:28628672
Arglu1	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ...	CTD	PMID:36041667
Arglu1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1320746	6480464	bisphenol S results in increased expression of ARGLU1 mRNA	CTD	PMID:39298647
Arglu1	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:1320746	6480464	Fenretinide results in increased expression of ARGLU1 mRNA	CTD	PMID:28973697
Arglu1	Rat	aflatoxin B1	decreases methylation	ISO	RGD:1605984	6480464	Aflatoxin B1 results in decreased methylation of ARGLU1 gene	CTD	PMID:27153756
Arglu1	Rat	all-trans-retinoic acid	decreases expression	ISO	RGD:1605984	6480464	Tretinoin results in decreased expression of ARGLU1 mRNA	CTD	PMID:21934132
Arglu1	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of ARGLU1 mRNA	CTD	PMID:38685447
Arglu1	Rat	arsane	multiple interactions	ISO	RGD:1605984	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Arglu1	Rat	arsenic atom	multiple interactions	ISO	RGD:1605984	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Arglu1	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1605984	6480464	Benzo(a)pyrene results in increased expression of ARGLU1 mRNA	CTD	PMID:26238291
Arglu1	Rat	benzo[a]pyrene	multiple interactions	ISO	RGD:1320746	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of more ...	CTD	PMID:27858113
Arglu1	Rat	benzo[b]fluoranthene	multiple interactions	ISO	RGD:1320746	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of more ...	CTD	PMID:27858113
Arglu1	Rat	Benzo[ghi]perylene	decreases expression	ISO	RGD:1320746	6480464	1,12-benzoperylene results in decreased expression of ARGLU1 mRNA	CTD	PMID:26377693
Arglu1	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	RGD:1320746	6480464	Diethylhexyl Phthalate results in decreased expression of ARGLU1 mRNA	CTD	PMID:33754040
Arglu1	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:1320746	6480464	Diethylhexyl Phthalate results in increased expression of ARGLU1 mRNA	CTD	PMID:33754040
Arglu1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of ARGLU1 mRNA	CTD	PMID:25181051
Arglu1	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ...	CTD	PMID:36041667
Arglu1	Rat	bisphenol A	increases methylation	ISO	RGD:1605984	6480464	bisphenol A results in increased methylation of ARGLU1 gene	CTD	PMID:31601247
Arglu1	Rat	bisphenol A	decreases expression	ISO	RGD:1605984	6480464	bisphenol A results in decreased expression of ARGLU1 mRNA	CTD	PMID:33670352
Arglu1	Rat	bisphenol A	decreases expression	ISO	RGD:1320746	6480464	bisphenol A results in decreased expression of ARGLU1 mRNA	CTD	PMID:32156529\|PMID:33221593
Arglu1	Rat	bisphenol A	multiple interactions	ISO	RGD:1605984	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Arglu1	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ...	CTD	PMID:36041667
Arglu1	Rat	cadmium atom	multiple interactions	ISO	RGD:1605984	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ARGLU1 more ...	CTD	PMID:35301059
Arglu1	Rat	cadmium dichloride	decreases expression	EXP		6480464	Cadmium Chloride results in decreased expression of ARGLU1 mRNA	CTD	PMID:19010381
Arglu1	Rat	cadmium dichloride	multiple interactions	ISO	RGD:1605984	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ARGLU1 more ...	CTD	PMID:35301059
Arglu1	Rat	cadmium dichloride	decreases expression	ISO	RGD:1605984	6480464	Cadmium Chloride results in decreased expression of ARGLU1 mRNA	CTD	PMID:38568856
Arglu1	Rat	caffeine	decreases phosphorylation	ISO	RGD:1605984	6480464	Caffeine results in decreased phosphorylation of ARGLU1 protein	CTD	PMID:35688186
Arglu1	Rat	cannabidiol	increases expression	ISO	RGD:1605984	6480464	Cannabidiol results in increased expression of ARGLU1 mRNA	CTD	PMID:27918106
Arglu1	Rat	carbon nanotube	decreases expression	ISO	RGD:1320746	6480464	Nanotubes, Carbon analog results in decreased expression of ARGLU1 mRNA; Nanotubes, Carbon results in decreased more ...	CTD	PMID:25554681
Arglu1	Rat	carbon nanotube	increases expression	ISO	RGD:1320746	6480464	Nanotubes, Carbon results in increased expression of ARGLU1 mRNA	CTD	PMID:25620056
Arglu1	Rat	chrysene	multiple interactions	ISO	RGD:1320746	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of more ...	CTD	PMID:27858113
Arglu1	Rat	coumarin	decreases phosphorylation	ISO	RGD:1605984	6480464	coumarin results in decreased phosphorylation of ARGLU1 protein	CTD	PMID:35688186
Arglu1	Rat	cyclosporin A	decreases expression	ISO	RGD:1605984	6480464	Cyclosporine results in decreased expression of ARGLU1 mRNA	CTD	PMID:25562108
Arglu1	Rat	deoxynivalenol	decreases phosphorylation	ISO	RGD:1320746	6480464	deoxynivalenol results in decreased phosphorylation of ARGLU1 protein	CTD	PMID:23811945
Arglu1	Rat	dexamethasone	multiple interactions	ISO	RGD:1605984	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Arglu1	Rat	dibenz[a,h]anthracene	decreases expression	ISO	RGD:1320746	6480464	1,2,5,6-dibenzanthracene results in decreased expression of ARGLU1 mRNA	CTD	PMID:26377693
Arglu1	Rat	Dibutyl phosphate	affects expression	ISO	RGD:1605984	6480464	di-n-butylphosphoric acid affects the expression of ARGLU1 mRNA	CTD	PMID:37042841
Arglu1	Rat	diethylstilbestrol	increases expression	ISO	RGD:1605984	6480464	Diethylstilbestrol results in increased expression of ARGLU1 mRNA	CTD	PMID:36621641
Arglu1	Rat	dorsomorphin	multiple interactions	ISO	RGD:1605984	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Arglu1	Rat	folic acid	multiple interactions	ISO	RGD:1320746	6480464	Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of ARGLU1 mRNA]	CTD	PMID:22206623
Arglu1	Rat	FR900359	affects phosphorylation	ISO	RGD:1605984	6480464	FR900359 affects the phosphorylation of ARGLU1 protein	CTD	PMID:37730182
Arglu1	Rat	furan	increases methylation	EXP		6480464	furan results in increased methylation of ARGLU1 gene	CTD	PMID:22079235
Arglu1	Rat	indometacin	multiple interactions	ISO	RGD:1605984	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Arglu1	Rat	lead diacetate	increases expression	ISO	RGD:1320746	6480464	lead acetate results in increased expression of ARGLU1 mRNA	CTD	PMID:21829687
Arglu1	Rat	leflunomide	decreases expression	ISO	RGD:1605984	6480464	leflunomide results in decreased expression of ARGLU1 mRNA	CTD	PMID:28988120
Arglu1	Rat	manganese atom	multiple interactions	ISO	RGD:1605984	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Arglu1	Rat	manganese(0)	multiple interactions	ISO	RGD:1605984	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Arglu1	Rat	manganese(II) chloride	multiple interactions	ISO	RGD:1605984	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Arglu1	Rat	methotrexate	increases expression	ISO	RGD:1605984	6480464	Methotrexate results in increased expression of ARGLU1 mRNA	CTD	PMID:24449571
Arglu1	Rat	methylmercury chloride	decreases expression	ISO	RGD:1605984	6480464	methylmercuric chloride results in decreased expression of ARGLU1 mRNA	CTD	PMID:28001369
Arglu1	Rat	mono(2-ethyl-5-oxohexyl) phthalate	affects expression	ISO	RGD:1605984	6480464	mono(2-ethyl-5-oxohexyl)phthalate affects the expression of ARGLU1 mRNA	CTD	PMID:34478338
Arglu1	Rat	nicotine	increases expression	ISO	RGD:1605984	6480464	Nicotine results in increased expression of ARGLU1 mRNA	CTD	PMID:16949557
Arglu1	Rat	nitrates	multiple interactions	ISO	RGD:1320746	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of ARGLU1 more ...	CTD	PMID:35964746
Arglu1	Rat	ozone	multiple interactions	ISO	RGD:1605984	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of ARGLU1 mRNA	CTD	PMID:35430440
Arglu1	Rat	ozone	multiple interactions	EXP		6480464	[Air Pollutants results in increased abundance of Ozone] which results in increased expression of ARGLU1 more ...	CTD	PMID:37871705
Arglu1	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:1320746	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ARGLU1 mRNA	CTD	PMID:36331819
Arglu1	Rat	SB 431542	multiple interactions	ISO	RGD:1605984	6480464	[LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of ARGLU1 more ...	CTD	PMID:27188386\|PMID:37664457
Arglu1	Rat	sodium arsenate	increases expression	ISO	RGD:1320746	6480464	sodium arsenate results in increased expression of ARGLU1 mRNA	CTD	PMID:21795629
Arglu1	Rat	sodium arsenite	decreases expression	ISO	RGD:1605984	6480464	sodium arsenite results in decreased expression of ARGLU1 mRNA	CTD	PMID:38568856
Arglu1	Rat	sodium arsenite	increases expression	ISO	RGD:1320746	6480464	sodium arsenite results in increased expression of ARGLU1 mRNA	CTD	PMID:36209798
Arglu1	Rat	sodium arsenite	multiple interactions	ISO	RGD:1605984	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Arglu1	Rat	sulindac	increases expression	ISO	RGD:1605984	6480464	Sulindac results in increased expression of ARGLU1 mRNA	CTD	PMID:11906190
Arglu1	Rat	sunitinib	increases expression	ISO	RGD:1605984	6480464	Sunitinib results in increased expression of ARGLU1 mRNA	CTD	PMID:31533062
Arglu1	Rat	temozolomide	decreases expression	ISO	RGD:1605984	6480464	Temozolomide results in decreased expression of ARGLU1 mRNA	CTD	PMID:31758290
Arglu1	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ARGLU1 mRNA]	CTD	PMID:31150632
Arglu1	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of ARGLU1 mRNA	CTD	PMID:31150632
Arglu1	Rat	tetraphene	decreases expression	ISO	RGD:1320746	6480464	benz(a)anthracene results in decreased expression of ARGLU1 mRNA	CTD	PMID:26377693
Arglu1	Rat	tetraphene	multiple interactions	ISO	RGD:1320746	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of more ...	CTD	PMID:27858113
Arglu1	Rat	thimerosal	decreases expression	ISO	RGD:1605984	6480464	Thimerosal results in decreased expression of ARGLU1 mRNA	CTD	PMID:27188386
Arglu1	Rat	titanium dioxide	increases expression	ISO	RGD:1320746	6480464	titanium dioxide results in increased expression of ARGLU1 mRNA	CTD	PMID:29264374
Arglu1	Rat	titanium dioxide	decreases methylation	ISO	RGD:1320746	6480464	titanium dioxide results in decreased methylation of ARGLU1 gene	CTD	PMID:35295148
Arglu1	Rat	topotecan	affects response to substance	ISO	RGD:1605984	6480464	ARGLU1 protein affects the susceptibility to Topotecan	CTD	PMID:16217747
Arglu1	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of ARGLU1 mRNA	CTD	PMID:33387578
Arglu1	Rat	trichostatin A	decreases expression	ISO	RGD:1605984	6480464	trichostatin A results in decreased expression of ARGLU1 mRNA	CTD	PMID:24935251\|PMID:26272509
Arglu1	Rat	trichostatin A	multiple interactions	ISO	RGD:1605984	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Arglu1	Rat	Triptolide	increases expression	EXP		6480464	triptolide results in increased expression of ARGLU1 protein	CTD	PMID:32519852
Arglu1	Rat	urethane	decreases expression	ISO	RGD:1605984	6480464	Urethane results in decreased expression of ARGLU1 mRNA	CTD	PMID:28818685
Arglu1	Rat	valproic acid	decreases methylation	ISO	RGD:1605984	6480464	Valproic Acid results in decreased methylation of ARGLU1 gene	CTD	PMID:29154799
Arglu1	Rat	valproic acid	decreases expression	ISO	RGD:1605984	6480464	Valproic Acid results in decreased expression of ARGLU1 mRNA	CTD	PMID:23179753\|PMID:24383497\|PMID:26272509
Arglu1	Rat	valproic acid	multiple interactions	ISO	RGD:1605984	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Arglu1	Rat	vorinostat	decreases expression	ISO	RGD:1605984	6480464	vorinostat results in decreased expression of ARGLU1 mRNA	CTD	PMID:27188386

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Arglu1	Rat	mRNA processing	involved_in	IEA	UniProtKB-KW:KW-0507	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Arglu1	Rat	positive regulation of DNA-templated transcription	involved_in	IEA	GO:0003713	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Arglu1	Rat	regulation of alternative mRNA splicing, via spliceosome	involved_in	IEA	UniProtKB:Q3UL36\|ensembl:ENSMUSP00000039493	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Arglu1	Rat	regulation of alternative mRNA splicing, via spliceosome	involved_in	ISO	RGD:1320746	1624291	PMID:30698747	RGD	PMID:30698747
Arglu1	Rat	regulation of alternative mRNA splicing, via spliceosome	involved_in	IEA	UniProtKB:Q9NWB6\|ensembl:ENSP00000383059	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Arglu1	Rat	regulation of alternative mRNA splicing, via spliceosome	involved_in	ISO	RGD:1605984	1624291	PMID:30698747	RGD	PMID:30698747
Arglu1	Rat	regulation of alternative mRNA splicing, via spliceosome	involved_in	ISS	UniProtKB:Q9NWB6	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Arglu1	Rat	RNA splicing	involved_in	IEA	UniProtKB-KW:KW-0508	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Arglu1	Rat	chromosome	located_in	IEA	UniProtKB-SubCell:SL-0468	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Arglu1	Rat	chromosome	located_in	IEA	UniProtKB-KW:KW-0158	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Arglu1	Rat	cytosol	located_in	ISO	RGD:1605984\|UniProtKB:Q9NWB6-1	1624291		RGD	GO_REF:0000052
Arglu1	Rat	cytosol	located_in	IEA	UniProtKB:Q9NWB6\|ensembl:ENSP00000383059	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Arglu1	Rat	mitochondrion	located_in	ISO	RGD:1605984\|UniProtKB:Q9NWB6-1	1624291		RGD	GO_REF:0000052
Arglu1	Rat	mitochondrion	located_in	IEA	UniProtKB:Q9NWB6\|ensembl:ENSP00000383059	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Arglu1	Rat	mitochondrion	is_active_in	IBA	CGD:CAL0000179812\|PANTHER:PTN001271790\|UniProtKB:Q9NWB6	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Arglu1	Rat	nuclear speck	located_in	ISS	UniProtKB:Q9NWB6	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Arglu1	Rat	nuclear speck	located_in	IEA	UniProtKB-SubCell:SL-0186	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Arglu1	Rat	nuclear speck	located_in	IEA	UniProtKB:Q9NWB6\|ensembl:ENSP00000383059	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Arglu1	Rat	nuclear speck	located_in	ISO	RGD:1605984	1624291	PMID:30698747	RGD	PMID:30698747
Arglu1	Rat	nuclear speck	located_in	ISO	RGD:1320746	1624291	PMID:30698747	RGD	PMID:30698747
Arglu1	Rat	nuclear speck	located_in	IEA	UniProtKB:Q3UL36\|ensembl:ENSMUSP00000039493	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Arglu1	Rat	nucleoplasm	located_in	ISO	RGD:1605984\|UniProtKB:Q9NWB6-1	1624291		RGD	GO_REF:0000052
Arglu1	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q9NWB6\|ensembl:ENSP00000383059	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Arglu1	Rat	nucleoplasm	is_active_in	IBA	MGI:2442985\|PANTHER:PTN001271790\|UniProtKB:Q9NWB6	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Arglu1	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Arglu1	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Arglu1	Rat	pre-mRNA binding	enables	ISS	UniProtKB:Q9NWB6	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Arglu1	Rat	pre-mRNA binding	enables	IEA	UniProtKB:Q3UL36\|ensembl:ENSMUSP00000039493	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Arglu1	Rat	pre-mRNA binding	enables	IEA	UniProtKB:Q9NWB6\|ensembl:ENSP00000383059	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Arglu1	Rat	pre-mRNA binding	enables	ISO	RGD:1320746	1624291	PMID:30698747	RGD	PMID:30698747
Arglu1	Rat	pre-mRNA binding	enables	ISO	RGD:1605984	1624291	PMID:30698747	RGD	PMID:30698747
Arglu1	Rat	protein binding	enables	ISO	RGD:1605984	1624291	UniProtKB:P26368\|UniProtKB:P78362\|UniProtKB:Q6NYC1\|UniProtKB:Q9UHX1 PMID:22365833, PMID:23602568, PMID:30698747, PMID:33961781, PMID:39251607	RGD	PMID:22365833\|PMID:23602568\|PMID:30698747\|PMID:33961781\|PMID:39251607
Arglu1	Rat	RNA binding	enables	IEA	UniProtKB-KW:KW-0694	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Arglu1	Rat	transcription coactivator activity	enables	ISO	RGD:1320746	1624291	PMID:30698747	RGD	PMID:30698747
Arglu1	Rat	transcription coactivator activity	enables	IEA	UniProtKB:Q9NWB6\|ensembl:ENSP00000383059	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Arglu1	Rat	transcription coactivator activity	enables	IEA	UniProtKB:Q3UL36\|ensembl:ENSMUSP00000039493	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Arglu1	Rat	transcription coactivator activity	enables	ISS	UniProtKB:Q9NWB6	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Arglu1	Rat	transcription coactivator activity	enables	ISO	RGD:1605984	1624291	PMID:30698747	RGD	PMID:30698747

Disease Annotations Click to see Annotation Detail View

Anal Atresia, Hypospadias, and Penoscrotal Inversion (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

(+)-schisandrin B (EXP)

(-)-demecolcine (ISO)

(1->4)-beta-D-glucan (ISO)

(S)-nicotine (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

4-hydroxyphenyl retinamide (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

Benzo[ghi]perylene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

caffeine (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

chrysene (ISO)

coumarin (ISO)

cyclosporin A (ISO)

deoxynivalenol (ISO)

dexamethasone (ISO)

dibenz[a,h]anthracene (ISO)

Dibutyl phosphate (ISO)

diethylstilbestrol (ISO)

dorsomorphin (ISO)

folic acid (ISO)

FR900359 (ISO)

furan (EXP)

indometacin (ISO)

lead diacetate (ISO)

leflunomide (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methotrexate (ISO)

methylmercury chloride (ISO)

mono(2-ethyl-5-oxohexyl) phthalate (ISO)

nicotine (ISO)

nitrates (ISO)

ozone (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

SB 431542 (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sulindac (ISO)

sunitinib (ISO)

temozolomide (ISO)

tetrachloromethane (EXP)

tetraphene (ISO)

thimerosal (ISO)

titanium dioxide (ISO)

topotecan (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

Triptolide (EXP)

urethane (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

mRNA processing (IEA)

positive regulation of DNA-templated transcription (IEA)

regulation of alternative mRNA splicing, via spliceosome (IEA,ISO,ISS)

RNA splicing (IEA)

Cellular Component

chromosome (IEA)

cytosol (IEA,ISO)

mitochondrion (IBA,IEA,ISO)

nuclear speck (IEA,ISO,ISS)

nucleoplasm (IBA,IEA,ISO)

nucleus (IEA)

Molecular Function

pre-mRNA binding (IEA,ISO,ISS)

protein binding (ISO)

RNA binding (IEA)

transcription coactivator activity (IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:25468996

Genomics

Comparative Map Data

Arglu1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	87,455,097 - 87,479,148 (+)	NCBI		GRCr8
mRatBN7.2	16	80,753,300 - 80,777,350 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	80,753,315 - 80,777,349 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	86,032,336 - 86,056,378 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	89,484,947 - 89,508,989 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	84,729,373 - 84,753,409 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	86,600,877 - 86,625,084 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	86,600,877 - 86,625,083 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	86,014,418 - 86,038,237 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	86,143,399 - 86,181,601 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	86,129,438 - 86,167,640 (+)	NCBI
Celera	16	78,531,608 - 78,555,458 (+)	NCBI		Celera
Cytogenetic Map	16	q12.5	NCBI

ARGLU1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	13	106,541,673 - 106,568,137 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	13	106,541,673 - 106,568,137 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	13	107,194,021 - 107,220,485 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	13	105,993,663 - 106,018,515 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	13	88,039,892 - 88,064,742 (-)	NCBI		Celera
Cytogenetic Map	13	q33.3	NCBI
HuRef	13	87,787,076 - 87,811,929 (-)	NCBI		HuRef
CHM1_1	13	107,164,330 - 107,189,194 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	13	105,762,093 - 105,788,553 (-)	NCBI		T2T-CHM13v2.0

Arglu1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	8,716,307 - 8,741,818 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	8,715,075 - 8,740,521 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	8,666,297 - 8,690,550 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	8,665,075 - 8,690,521 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	8,666,576 - 8,690,537 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	8,666,548 - 8,690,493 (-)	NCBI		MGSCv36	mm8
Celera	8	8,839,215 - 8,862,964 (-)	NCBI		Celera
Cytogenetic Map	8	A1.1	NCBI
cM Map	8	3.57	NCBI

Arglu1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955404	4,962,000 - 4,980,226 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955404	4,962,000 - 4,980,226 (+)	NCBI	ChiLan1.0	ChiLan1.0

ARGLU1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	14	108,040,331 - 108,065,175 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	13	106,720,660 - 106,745,507 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	13	87,683,306 - 87,708,108 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	13	106,823,229 - 106,847,933 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	13	106,823,229 - 106,847,933 (-)	Ensembl	panpan1.1		panPan2

ARGLU1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	22	55,616,498 - 55,640,157 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	22	55,616,977 - 55,639,784 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	22	55,374,265 - 55,397,955 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	22	56,128,655 - 56,152,154 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	22	56,126,981 - 56,152,126 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	22	55,721,376 - 55,745,016 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	22	55,708,193 - 55,731,591 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	22	55,746,940 - 55,770,656 (-)	NCBI		UU_Cfam_GSD_1.0

Arglu1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	190,819,302 - 190,846,313 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936472	5,105,269 - 5,134,313 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936472	5,105,836 - 5,131,294 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ARGLU1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	11	74,239,419 - 74,267,379 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	11	74,241,089 - 74,267,416 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	11	81,617,834 - 81,644,114 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ARGLU1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	3	84,958,279 - 84,983,102 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666046	41,521,231 - 41,546,048 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Arglu1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624793	5,059,644 - 5,085,572 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624793	5,059,826 - 5,083,362 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Arglu1
75 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	103
Count of miRNA genes:	76
Interacting mature miRNAs:	98
Transcripts:	ENSRNOT00000057347
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2300163	Bmd64	Bone mineral density QTL 64	5.3	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	16	37752156	82752156	Rat
7411648	Foco22	Food consumption QTL 22	15	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	52726464	84729064	Rat
2293690	Bss45	Bone structure and strength QTL 45	5.13	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	16	37752156	82752156	Rat
8694364	Abfw7	Abdominal fat weight QTL 7	12.22	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	16	52726464	84729064	Rat
8694429	Bw164	Body weight QTL 164	5	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	16	52726464	84729064	Rat
7205510	Activ5	Activity QTL 5	3.78	0.00028	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	42396345	84729064	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
631525	Pia14	Pristane induced arthritis QTL 14	4.4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	16	55711087	83402471	Rat

Markers in Region

RH128419

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	80,776,999 - 80,777,205 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	86,624,734 - 86,624,939	NCBI	Rnor6.0
Rnor_5.0	16	86,037,887 - 86,038,092	UniSTS	Rnor5.0
RGSC_v3.4	16	86,181,251 - 86,181,456	UniSTS	RGSC3.4
Celera	16	78,555,108 - 78,555,313	UniSTS
RH 3.4 Map	16	787.9	UniSTS
RH 3.4 Map	16	786.1	UniSTS
Cytogenetic Map	16	q12.5	UniSTS

FLJ10154

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	80,776,562 - 80,776,724 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	86,624,297 - 86,624,458	NCBI	Rnor6.0
Rnor_5.0	16	86,037,450 - 86,037,611	UniSTS	Rnor5.0
RGSC_v3.4	16	86,180,814 - 86,180,975	UniSTS	RGSC3.4
Celera	16	78,554,671 - 78,554,832	UniSTS
Cytogenetic Map	16	q12.5	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001024972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010058287	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC091344	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC127459	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473970	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000057347 ⟹ ENSRNOP00000054160

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	80,753,315 - 80,777,349 (+)	Ensembl
Rnor_6.0 Ensembl	16	86,600,877 - 86,625,083 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000088161 ⟹ ENSRNOP00000071691

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	16	86,624,391 - 86,624,524 (+)	Ensembl

RefSeq Acc Id:

NM_001024972 ⟹ NP_001020143

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	87,455,113 - 87,479,148 (+)	NCBI
mRatBN7.2	16	80,753,315 - 80,777,350 (+)	NCBI
Rnor_6.0	16	86,600,877 - 86,625,084 (+)	NCBI
Rnor_5.0	16	86,014,418 - 86,038,237 (+)	NCBI
RGSC_v3.4	16	86,143,399 - 86,181,601 (+)	RGD
Celera	16	78,531,608 - 78,555,458 (+)	RGD

Sequence:

show sequence

GGGAAGGGCGGCCGGTGCTGCCACAGCTGCCATCTTAGGGACTCCGGGCCAGGCCTGCTAGGCC
TTCGCGGCGGAGGCGGCCGTGTGCGTGGCGGGTGCGCTTGGGGCGAGGCGGAGGGTCCGCGGGC
TGGGGGCCGCGCTTCCCAGCGGCGAGGGGCGGCCTGCGGCGGGCAGCGGGCGACAGGCGGCGGG
CGCCGCACGGCGCGAGGATGGGCCGGTCGCGGAGCCGGAGCTCGTCCCGCTCTAAGCACACCAA
GAGCTCCAAGCACAACAAGAAGCGCAGCCGCTCGCGCTCGCGCTCGCGGGACAAGGAGCGGGTG
CGGAAGCGCTCCAAGTCCCGGGAGAGCAAACGGAACCGGCGGCGGGAGTCGCGCTCCCGCTCGC
GCTCCACCAACGCGGCGGCATCCCGGCGCGAGCGGGAGCGCGCCTCGTCCCCGCCCGACCGCAT
CGACATCTTCGGGCGCACGGTGAGCAAGCGCAGCAGCCTGGACGAGAAGCAGAAACGGGAGGAG
GAGGAGAAGAAGGCGGAGTTCGAGCGACAGCGAAAAATTCGGCAGCAGGAAATAGAAGAAAAAC
TCATTGAGGAAGAAACAGCACGAAGAGTAGAAGAATTGGTAGCAAAAAGGGTAGAAGAAGAATT
GGAGAAAAGGAAGGATGAAATTGAGCGAGAAGTTCTCCGAAGGGTTGAAGAAGCCAAACGCATC
ATGGAAAAGCAGTTGCTCGAAGAACTCGAGCGACAGAGACAAGCTGAGCTTGCAGCACAAAAAG
CTAGAGAGGAGGAAGAGAGAGCAAAGCGTGAGGAACTGGAGCGGATATTAGAAGAAAATAACCG
GAAAATCGCAGAAGCACAGGCCAAACTGGCTGAAGAACAATTGAGAATTGTTGAAGAACAAAGA
AAGATTCATGAGGAAAGGATGAAACTAGAACAAGAACGACAGCGTCAACAAAAAGAAGAACAAA
AAATTATCCTGGGCAAGGGGAAGTCCAGGCCAAAACTGTCCTTCTCACTAAAAACCCAGGATTG
AATGGCAAACTCTGAACTTTTTGCAAAGAAAAATGAAAAAACTTCGTATTGTAGCTTCATGTTG
AAGTGGTTTTTTTGTTTTTATTTTTTTTTGTTTTTGTTTTTTTGTTTTTGTTTTGTTTTTTTTT
TTTTTAATTTGGAAAATCTGGAAAGTTAGCTTGTTCTAATAGGGGCTATGCTCTGCAAATCCCT
TTATTTTTCCCTCTTTTCCTCCATTAAGTCAAGTCCTTATCAGATCATTGCTATCTTCTAGAAG
TGGTGTACTTTGCACCTGTTGGGATTCTGTACTGGTTGGGTCTGCTGAAGAGCAGGTCATTTGG
TGACTAGCTGGTCTGGTAAGGTGTTCACTGACCACTGACTTCGGAGTTATACTCTGTTTACTAC
GTCATAATGCTGGTTTTGCTGACTTTTTGTTTTTTTATGCATTTATAAAAAAAGAAAAAGTTGG
TAATTGCATTGCAAAATTGCCAGGGTTTTACTGGACCTGTGGTGTGTTGTTAGAGCAGTGTCCT
TGTGATGCTGTGGCTCTGACGTTCCTGACAACAGGTAAGGAAACAGTTGGTCACCTGCTACAGA
AGCACCTGCAGTGCGGTACTGTCTGTCGGACTTTTGTTCCTTTCATTGACACAATCAAACCAGC
ATTCCCCACTGTAAATAAATGATTTTGCTGAATAAAGTAAAGTCTTAAATTCAAAAAAAAAAAA
AAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XR_010058287

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	87,455,097 - 87,463,990 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001020143	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91344	(Get FASTA)	NCBI Sequence Viewer
	AAI27460	(Get FASTA)	NCBI Sequence Viewer
	EDM08788	(Get FASTA)	NCBI Sequence Viewer
	EDM08789	(Get FASTA)	NCBI Sequence Viewer
	EDM08790	(Get FASTA)	NCBI Sequence Viewer
	EDM08791	(Get FASTA)	NCBI Sequence Viewer
	EDM08792	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000054160
	ENSRNOP00000054160.2
GenBank Protein	Q5BJT0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001020143 ⟸ NM_001024972

- UniProtKB:

A0JPJ8 (UniProtKB/Swiss-Prot), Q5BJT0 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MGRSRSRSSSRSKHTKSSKHNKKRSRSRSRSRDKERVRKRSKSRESKRNRRRESRSRSRSTNAA
ASRRERERASSPPDRIDIFGRTVSKRSSLDEKQKREEEEKKAEFERQRKIRQQEIEEKLIEEET
ARRVEELVAKRVEEELEKRKDEIEREVLRRVEEAKRIMEKQLLEELERQRQAELAAQKAREEEE
RAKREELERILEENNRKIAEAQAKLAEEQLRIVEEQRKIHEERMKLEQERQRQQKEEQKIILGK
GKSRPKLSFSLKTQD

hide sequence

Ensembl Acc Id:

ENSRNOP00000054160 ⟸ ENSRNOT00000057347

Ensembl Acc Id:

ENSRNOP00000071691 ⟸ ENSRNOT00000088161

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5BJT0-F1-model_v2	AlphaFold	Q5BJT0	1-271	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700250

Promoter ID:

EPDNEW_R10774

Type:

initiation region

Name:

Arglu1_1

Description:

arginine and glutamate rich 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	16	86,600,872 - 86,600,932	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310061	AgrOrtholog
BioCyc Gene	G2FUF-10598	BioCyc
Ensembl Genes	ENSRNOG00000024142	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000057347	ENTREZGENE
	ENSRNOT00000057347.4	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7125115	IMAGE-MGC_LOAD
	IMAGE:7315932	IMAGE-MGC_LOAD
InterPro	ARGLU1	UniProtKB/Swiss-Prot
KEGG Report	rno:290912	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109359	IMAGE-MGC_LOAD
	MGC:156517	IMAGE-MGC_LOAD
NCBI Gene	290912	ENTREZGENE
PANTHER	ARGININE AND GLUTAMATE-RICH PROTEIN 1	UniProtKB/Swiss-Prot
	PTHR31711	UniProtKB/Swiss-Prot
Pfam	ARGLU	UniProtKB/Swiss-Prot
PhenoGen	Arglu1	PhenoGen
RatGTEx	ENSRNOG00000024142	RatGTEx
UniProt	A0JPJ8	ENTREZGENE
	ARGL1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	A0JPJ8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2010-01-29	Arglu1	arginine and glutamate rich 1	RGD1310061	similar to hypothetical protein FLJ10154	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1310061	similar to hypothetical protein FLJ10154	RGD1310061_predicted	similar to hypothetical protein FLJ10154 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1310061_predicted	similar to hypothetical protein FLJ10154 (predicted)	LOC290912_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC290912_predicted	similar to hypothetical protein FLJ10154 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar