Symbol:
Amn
Name:
amnion associated transmembrane protein
RGD ID:
1308634
Description:
Predicted to enable cargo receptor activity and signaling receptor binding activity. Predicted to be involved in several processes, including Golgi to plasma membrane protein transport; cobalamin metabolic process; and cobalamin transport. Predicted to act upstream of or within renal protein absorption. Located in brush border membrane and endocytic vesicle. Part of protein-containing complex. Human ortholog(s) of this gene implicated in megaloblastic anemia. Orthologous to human AMN (amnion associated transmembrane protein); INTERACTS WITH 6-propyl-2-thiouracil; bisphenol A; C60 fullerene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
amnionless; amnionless homolog; amnionless homolog (mouse); LOC314459; protein amnionless
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 136,132,567 - 136,140,008 (+) NCBI GRCr8 mRatBN7.2 6 130,311,372 - 130,318,815 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 130,311,372 - 130,318,815 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 130,482,175 - 130,489,610 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 130,778,168 - 130,785,603 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 130,141,430 - 130,148,872 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 135,724,455 - 135,731,896 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 135,724,455 - 135,731,896 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 144,682,579 - 144,690,020 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 136,031,478 - 136,038,919 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 136,035,629 - 136,044,796 (+) NCBI Celera 6 127,868,669 - 127,876,110 (+) NCBI Celera Cytogenetic Map 6 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Amn Rat Charcot-Marie-Tooth disease axonal type 2O ISO RGD:1318522 8554872 ClinVar Annotator: match by term: Charcot-Marie-Tooth disease axonal type 2O ClinVar PMID:28492532|PMID:30510536 Amn Rat genetic disease ISO RGD:1318522 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:25741868|PMID:28492532 Amn Rat Imerslund-Grasbeck Syndrome ISO RGD:1318522 8554872 ClinVar Annotator: match by term: Imerslund-Grasbeck syndrome ClinVar PMID:12590260|PMID:13852753|PMID:15024727|PMID:16199547|PMID:17114957|PMID:17285242|PMID:17576681|PMID:18181028|PMID:21750092|PMID:22078000|PMID:22631584|PMID:22929189|PMID:24044590|PMID:24156255|PMID:25741868|PMID:26040326|PMID:28492532|PMID:30523278|PMID:30691194|PMID:32045704|PMID:33491342|PMID:6741523|PMID:9536098 Amn Rat Imerslund-Grasbeck Syndrome 1 ISO RGD:1318522 8554872 ClinVar Annotator: match by term: Enterocyte cobalamin malabsorption | ClinVar Annotator: match by term: Enterocyte more ... ClinVar PMID:12590260|PMID:13852753|PMID:15024727|PMID:16199547|PMID:17114957|PMID:17285242|PMID:17576681|PMID:21750092|PMID:22078000|PMID:22929189|PMID:24044590|PMID:24156255|PMID:25741868|PMID:26040326|PMID:28492532|PMID:30523278|PMID:32045704|PMID:6741523|PMID:9536098 Amn Rat Imerslund-Grasbeck Syndrome 2 ISO RGD:1318522 8554872 ClinVar Annotator: match by term: MEGALOBLASTIC ANEMIA, NORWEGIAN TYPE | ClinVar Annotator: match by term: more ... ClinVar PMID:12590260|PMID:13852753|PMID:15024727|PMID:16199547|PMID:17114957|PMID:17285242|PMID:17576681|PMID:22078000|PMID:22929189|PMID:24044590|PMID:24156255|PMID:25741868|PMID:26040326|PMID:28492532|PMID:30523278|PMID:32045704|PMID:6741523|PMID:9536098 Amn Rat immunodeficiency 132A ISO RGD:1318522 8554872 ClinVar Annotator: match by term: Herpes simplex encephalitis, susceptibility to, 3 ClinVar PMID:28492532 Amn Rat megaloblastic anemia ISO RGD:1318522 8554872 ClinVar Annotator: match by term: Megaloblastic anemia | ClinVar Annotator: match by term: Megaloblastic anemia more ... ClinVar PMID:12590260|PMID:13852753|PMID:15024727|PMID:16199547|PMID:17114957|PMID:17285242|PMID:17576681|PMID:21750092|PMID:22078000|PMID:22929189|PMID:24044590|PMID:24156255|PMID:25741868|PMID:26040326|PMID:28492532|PMID:30523278|PMID:32045704|PMID:6741523|PMID:9536098 Amn Rat mitochondrial complex IV deficiency nuclear type 17 ISO RGD:1318522 8554872 ClinVar Annotator: match by term: MITOCHONDRIAL COMPLEX IV DEFICIENCY, NUCLEAR TYPE 17 ClinVar PMID:25175347|PMID:25741868|PMID:29577824 Amn Rat vitamin B12 deficiency ISO RGD:1318522 8554872 ClinVar Annotator: match by term: Vitamin B12 deficiency ClinVar PMID:25741868
Only show annotations with direct experimental evidence (0 objects hidden)
Amn Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1318523 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of AMN mRNA CTD PMID:36331819 Amn Rat 1,2-dichloroethane increases expression ISO RGD:1318523 6480464 ethylene dichloride results in increased expression of AMN mRNA CTD PMID:28960355 Amn Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1318523 6480464 1,2-Dimethylhydrazine results in decreased expression of AMN mRNA CTD PMID:22206623 Amn Rat 17beta-estradiol multiple interactions ISO RGD:1318522 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of AMN mRNA CTD PMID:30165855 Amn Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1318523 6480464 Tetrachlorodibenzodioxin affects the expression of AMN mRNA CTD PMID:18343893|PMID:21570461|PMID:26377647 Amn Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO RGD:1318523 6480464 2,3,7,8-tetrachlorodibenzofuran affects the expression of AMN mRNA CTD PMID:18343893 Amn Rat 4,4'-sulfonyldiphenol affects expression ISO RGD:1318523 6480464 bisphenol S affects the expression of AMN mRNA CTD PMID:30951980 Amn Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:1318523 6480464 Fenretinide results in increased expression of AMN mRNA CTD PMID:28973697 Amn Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of AMN mRNA CTD PMID:24780913 Amn Rat aflatoxin B1 increases expression ISO RGD:1318523 6480464 Aflatoxin B1 results in increased expression of AMN mRNA CTD PMID:19770486 Amn Rat all-trans-retinoic acid affects expression ISO RGD:1318522 6480464 Tretinoin affects the expression of AMN mRNA CTD PMID:31600526 Amn Rat aristolochic acid A increases expression ISO RGD:1318522 6480464 aristolochic acid I results in increased expression of AMN mRNA CTD PMID:33212167 Amn Rat benzo[a]pyrene increases expression ISO RGD:1318523 6480464 Benzo(a)pyrene results in increased expression of AMN mRNA CTD PMID:19770486 Amn Rat benzo[a]pyrene decreases expression ISO RGD:1318522 6480464 Benzo(a)pyrene results in decreased expression of AMN mRNA CTD PMID:32234424 Amn Rat benzo[a]pyrene increases methylation ISO RGD:1318522 6480464 Benzo(a)pyrene results in increased methylation of AMN exon; Benzo(a)pyrene results in increased methylation of AMN more ... CTD PMID:27901495 Amn Rat benzo[a]pyrene decreases expression ISO RGD:1318523 6480464 Benzo(a)pyrene results in decreased expression of AMN mRNA CTD PMID:27195522 Amn Rat benzo[a]pyrene multiple interactions ISO RGD:1318523 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to AMN promoter] CTD PMID:19654925 Amn Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of AMN mRNA CTD PMID:25181051 Amn Rat bisphenol A increases expression ISO RGD:1318523 6480464 bisphenol A results in increased expression of AMN mRNA CTD PMID:34585602 Amn Rat bisphenol A decreases methylation ISO RGD:1318523 6480464 bisphenol A results in decreased methylation of AMN promoter CTD PMID:27312807 Amn Rat bisphenol F affects expression ISO RGD:1318523 6480464 bisphenol F affects the expression of AMN mRNA CTD PMID:30951980 Amn Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of AMN mRNA CTD PMID:19167457 Amn Rat cadmium atom multiple interactions ISO RGD:1318522 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of AMN more ... CTD PMID:35301059 Amn Rat cadmium dichloride increases expression ISO RGD:1318523 6480464 Cadmium Chloride results in increased expression of AMN mRNA CTD PMID:24982889 Amn Rat cadmium dichloride multiple interactions ISO RGD:1318522 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of AMN more ... CTD PMID:35301059 Amn Rat capsaicin multiple interactions EXP 6480464 AMN protein inhibits the reaction [Capsaicin results in increased expression of SST protein]; AMN protein more ... CTD PMID:16938409 Amn Rat capsaicin increases expression EXP 6480464 Capsaicin results in increased expression of AMN protein CTD PMID:16938409 Amn Rat carbon nanotube increases expression ISO RGD:1318523 6480464 Nanotubes, Carbon analog results in increased expression of AMN mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Amn Rat CGP 52608 multiple interactions ISO RGD:1318522 6480464 CGP 52608 promotes the reaction [RORA protein binds to AMN gene] CTD PMID:28238834 Amn Rat choline multiple interactions ISO RGD:1318523 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Amn Rat chromium(6+) affects expression ISO RGD:1318523 6480464 chromium hexavalent ion affects the expression of AMN mRNA CTD PMID:28472532 Amn Rat cisplatin multiple interactions ISO RGD:1318522 6480464 AMN protein inhibits the reaction [Cisplatin results in increased expression of TNF protein]; AMN protein more ... CTD PMID:20514524 Amn Rat cyclosporin A decreases expression ISO RGD:1318522 6480464 Cyclosporine results in decreased expression of AMN mRNA CTD PMID:25562108 Amn Rat DDE decreases expression ISO RGD:1318522 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of AMN mRNA CTD PMID:38568856 Amn Rat dicrotophos decreases expression ISO RGD:1318522 6480464 dicrotophos results in decreased expression of AMN mRNA CTD PMID:28302478 Amn Rat folic acid multiple interactions ISO RGD:1318523 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Amn Rat folic acid decreases expression ISO RGD:1318522 6480464 Folic Acid results in decreased expression of AMN mRNA CTD PMID:21867686 Amn Rat furan increases expression ISO RGD:1318523 6480464 furan results in increased expression of AMN mRNA CTD PMID:24183702 Amn Rat furan increases expression EXP 6480464 furan results in increased expression of AMN mRNA CTD PMID:25539665 Amn Rat L-methionine multiple interactions ISO RGD:1318523 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Amn Rat lead(0) decreases expression ISO RGD:1318522 6480464 Lead results in decreased expression of AMN mRNA CTD PMID:19921347 Amn Rat maneb multiple interactions ISO RGD:1318523 6480464 [Paraquat co-treated with Maneb] affects the expression of AMN mRNA CTD PMID:22563483 Amn Rat methotrexate decreases expression ISO RGD:1318522 6480464 Methotrexate results in decreased expression of AMN mRNA CTD PMID:24449571 Amn Rat methylmercury(1+) increases expression EXP 6480464 methylmercury II results in increased expression of AMN mRNA CTD PMID:17905399 Amn Rat obeticholic acid decreases expression ISO RGD:1318522 6480464 obeticholic acid results in decreased expression of AMN mRNA CTD PMID:27939613 Amn Rat okadaic acid decreases expression ISO RGD:1318522 6480464 Okadaic Acid results in decreased expression of AMN mRNA CTD PMID:38832940 Amn Rat paracetamol decreases expression ISO RGD:1318522 6480464 Acetaminophen results in decreased expression of AMN mRNA CTD PMID:29067470 Amn Rat paraquat multiple interactions ISO RGD:1318523 6480464 [Paraquat co-treated with Maneb] affects the expression of AMN mRNA CTD PMID:22563483 Amn Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1318523 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of AMN mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 Amn Rat perfluorooctanoic acid decreases expression ISO RGD:1318522 6480464 perfluorooctanoic acid results in decreased expression of AMN mRNA CTD PMID:36326898 Amn Rat phenobarbital multiple interactions ISO RGD:1318523 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of AMN mRNA] CTD PMID:19482888 Amn Rat phenobarbital affects expression ISO RGD:1318523 6480464 Phenobarbital affects the expression of AMN mRNA CTD PMID:23091169 Amn Rat phenobarbital increases expression ISO RGD:1318523 6480464 Phenobarbital results in increased expression of AMN mRNA CTD PMID:19482888 Amn Rat pirinixic acid increases expression ISO RGD:1318523 6480464 pirinixic acid results in increased expression of AMN mRNA CTD PMID:18301758|PMID:20813756|PMID:23811191 Amn Rat pyridaben decreases expression ISO RGD:1318523 6480464 pyridaben results in decreased expression of AMN mRNA CTD PMID:22563483 Amn Rat sodium arsenite decreases expression ISO RGD:1318523 6480464 sodium arsenite results in decreased expression of AMN mRNA CTD PMID:37682722 Amn Rat sodium fluoride increases expression ISO RGD:1318523 6480464 Sodium Fluoride results in increased expression of AMN mRNA CTD PMID:27862939 Amn Rat titanium dioxide increases methylation ISO RGD:1318523 6480464 titanium dioxide results in increased methylation of AMN gene CTD PMID:35295148 Amn Rat titanium dioxide decreases methylation ISO RGD:1318523 6480464 titanium dioxide results in decreased methylation of AMN gene CTD PMID:35295148 Amn Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of AMN mRNA CTD PMID:33387578 Amn Rat valproic acid increases methylation ISO RGD:1318522 6480464 Valproic Acid results in increased methylation of AMN gene CTD PMID:29154799 Amn Rat valproic acid decreases expression ISO RGD:1318522 6480464 Valproic Acid results in decreased expression of AMN mRNA CTD PMID:29501571 Amn Rat valproic acid affects methylation ISO RGD:1318522 6480464 Valproic Acid affects the methylation of AMN gene CTD PMID:29501571
(1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) capsaicin (EXP) carbon nanotube (ISO) CGP 52608 (ISO) choline (ISO) chromium(6+) (ISO) cisplatin (ISO) cyclosporin A (ISO) DDE (ISO) dicrotophos (ISO) folic acid (ISO) furan (EXP,ISO) L-methionine (ISO) lead(0) (ISO) maneb (ISO) methotrexate (ISO) methylmercury(1+) (EXP) obeticholic acid (ISO) okadaic acid (ISO) paracetamol (ISO) paraquat (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) pyridaben (ISO) sodium arsenite (ISO) sodium fluoride (ISO) titanium dioxide (ISO) trichloroethene (EXP) valproic acid (ISO)
Cellular Component
apical part of cell (IEA,ISO) apical plasma membrane (IBA,IEA,ISO) brush border membrane (IDA) endocytic vesicle (IBA,IDA,IEA,ISO) extracellular space (IEA,ISO) membrane (IEA,ISO) microvillus membrane (IEA,ISO) plasma membrane (IEA) protein-containing complex (IDA) receptor complex (IEA,ISO)
1.
Interactions of cubilin with megalin and the product of the amnionless gene (AMN): effect on its stability.
Ahuja R, etal., Biochem J. 2008 Mar 1;410(2):301-8.
2.
Imerslund-Grasbeck syndrome associated with recurrent aphthous stomatitis and defective neutrophil function.
Broides A, etal., J Pediatr Hematol Oncol. 2006 Nov;28(11):715-9.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
6.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Comprehensive gene review and curation
RGD comprehensive gene curation
9.
Amnionless, essential for mouse gastrulation, is mutated in recessive hereditary megaloblastic anemia.
Tanner SM, etal., Nat Genet. 2003 Mar;33(3):426-9. Epub 2003 Feb 18.
10.
Dab2, megalin, cubilin and amnionless receptor complex might mediate intestinal endocytosis in the suckling rat.
Vazquez-Carretero MD, etal., J Cell Biochem. 2014 Mar;115(3):510-22. doi: 10.1002/jcb.24685.
Amn Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 136,132,567 - 136,140,008 (+) NCBI GRCr8 mRatBN7.2 6 130,311,372 - 130,318,815 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 130,311,372 - 130,318,815 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 130,482,175 - 130,489,610 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 130,778,168 - 130,785,603 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 130,141,430 - 130,148,872 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 135,724,455 - 135,731,896 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 135,724,455 - 135,731,896 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 144,682,579 - 144,690,020 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 136,031,478 - 136,038,919 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 136,035,629 - 136,044,796 (+) NCBI Celera 6 127,868,669 - 127,876,110 (+) NCBI Celera Cytogenetic Map 6 q32 NCBI
AMN Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 102,922,663 - 102,930,842 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 102,922,663 - 102,933,596 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 103,389,000 - 103,397,179 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 102,458,747 - 102,467,282 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 102,458,756 - 102,467,282 NCBI Celera 14 83,443,115 - 83,451,301 (+) NCBI Celera Cytogenetic Map 14 q32.32 NCBI HuRef 14 83,564,008 - 83,572,214 (+) NCBI HuRef CHM1_1 14 103,326,435 - 103,334,619 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 97,158,908 - 97,167,087 (+) NCBI T2T-CHM13v2.0
Amn Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 111,237,530 - 111,242,860 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 111,237,529 - 111,242,860 (+) Ensembl GRCm39 Ensembl GRCm38 12 111,271,096 - 111,276,426 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 111,271,095 - 111,276,426 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 112,509,322 - 112,514,637 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 111,718,919 - 111,724,234 (+) NCBI MGSCv36 mm8 Celera 12 112,465,414 - 112,470,727 (+) NCBI Celera Cytogenetic Map 12 F1 NCBI cM Map 12 60.94 NCBI
Amn Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955538 2,017,476 - 2,021,890 (+) NCBI ChiLan1.0 ChiLan1.0
AMN Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 104,076,211 - 104,083,152 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 103,292,709 - 103,299,650 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 83,541,891 - 83,550,346 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 103,356,523 - 103,364,163 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 103,356,773 - 103,365,352 (+) Ensembl panpan1.1 panPan2
AMN Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 70,800,435 - 70,807,835 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 70,312,298 - 70,320,278 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 71,077,067 - 71,085,111 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 71,077,060 - 71,088,041 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 70,740,802 - 70,748,789 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 70,805,229 - 70,813,173 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 71,205,503 - 71,213,499 (+) NCBI UU_Cfam_GSD_1.0
Amn
AMN Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa10.2 7 128,896,585 - 128,904,655 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
AMN Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 80,884,149 - 80,895,977 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 80,883,911 - 80,893,066 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 68,081,278 - 68,085,885 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Amn
.
Predicted Target Of
Count of predictions: 263 Count of miRNA genes: 184 Interacting mature miRNAs: 204 Transcripts: ENSRNOT00000012469 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12801411 Schws8 Schwannoma susceptibility QTL 8 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 94968928 139968928 Rat 4145118 Mcs26 Mammary carcinoma susceptibility QTL 26 0.0001 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 106752656 132339866 Rat 1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 1641917 Colcr5 Colorectal carcinoma resistance QTL 5 3.18 0.0009 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 6 122549046 137801795 Rat 61414 Pia3 Pristane induced arthritis QTL 3 4.5 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 6 94968928 137848904 Rat 71111 Iddm8 Insulin dependent diabetes mellitus QTL 8 1.9 0.002 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 6 105156861 140994061 Rat 1358355 Srcrt4 Stress Responsive Cort QTL 4 6.39 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 100364669 140994061 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 61329 Eae9 Experimental allergic encephalomyelitis QTL 9 3.7 body mass (VT:0001259) change in body weight (CMO:0002045) 6 122549046 140994061 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 737976 Pia24 Pristane induced arthritis QTL 24 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 6 112636280 140994061 Rat 2312560 Pur20 Proteinuria QTL 20 2.1 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 125628133 137801795 Rat 2313399 Anxrr28 Anxiety related response QTL 28 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 6 100671796 132340886 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 8552796 Vie3 Viral induced encephalitis QTL 3 2.6 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 6 96833997 140994061 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat 2293085 Iddm29 Insulin dependent diabetes mellitus QTL 29 7.66 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 6 122549046 140286318 Rat
RH140666
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 6 136,138,599 - 136,138,982 (+) Marker Load Pipeline mRatBN7.2 6 130,317,406 - 130,317,789 (+) MAPPER mRatBN7.2 Rnor_6.0 6 135,730,488 - 135,730,870 NCBI Rnor6.0 Rnor_5.0 6 144,683,605 - 144,683,987 UniSTS Rnor5.0 RGSC_v3.4 6 136,037,511 - 136,037,893 UniSTS RGSC3.4 Celera 6 127,874,702 - 127,875,084 UniSTS RH 3.4 Map 6 781.8 UniSTS Cytogenetic Map 6 q32 UniSTS
BI276097
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 130,318,434 - 130,318,570 (+) MAPPER mRatBN7.2 Rnor_6.0 6 135,731,516 - 135,731,651 NCBI Rnor6.0 Rnor_5.0 6 144,682,824 - 144,682,959 UniSTS Rnor5.0 RGSC_v3.4 6 136,038,539 - 136,038,674 UniSTS RGSC3.4 Celera 6 127,875,730 - 127,875,865 UniSTS RH 3.4 Map 6 782.2 UniSTS Cytogenetic Map 6 q32 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
3
21
96
66
65
42
22
42
6
153
58
81
41
53
23
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012469 ⟹ ENSRNOP00000012469
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 130,311,372 - 130,318,815 (+) Ensembl Rnor_6.0 Ensembl 6 135,724,455 - 135,731,896 (+) Ensembl
RefSeq Acc Id:
NM_001108061 ⟹ NP_001101531
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 136,132,567 - 136,140,008 (+) NCBI mRatBN7.2 6 130,311,372 - 130,318,815 (+) NCBI Rnor_6.0 6 135,724,455 - 135,731,896 (+) NCBI Rnor_5.0 6 144,682,579 - 144,690,020 (-) NCBI RGSC_v3.4 6 136,031,478 - 136,038,919 (+) RGD Celera 6 127,868,669 - 127,876,110 (+) RGD
Sequence:
CCCCGCCCGGTCACGTGGGGACCTCGGAGCGAAGTCCGCGCCGGTGAGAGCCTGGGCGGCGGCGGAGAGATGGGTGCCCTGGGCCGGGTGCTGCTGTGGCTGCAGCTCTGTGCACTGACTCGGGCCGC
hide sequence
RefSeq Acc Id:
XM_006240588 ⟹ XP_006240650
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 136,132,622 - 136,139,826 (+) NCBI mRatBN7.2 6 130,311,427 - 130,318,633 (+) NCBI Rnor_6.0 6 135,724,472 - 135,731,714 (+) NCBI Rnor_5.0 6 144,682,579 - 144,690,020 (-) NCBI
Sequence:
GGGACCTCGGAGCGAAGTCCGCGCCGGTGAGAGCCTGGGCGGCGGCGGAGAGATGGGTGCCCTGGGCCGGGTGCTGCTGTGGCTGCAGCTCTGTGCACTGACTCGGGCCGCCTACAAACTTTGGGTCC
hide sequence
RefSeq Acc Id:
NP_001101531 ⟸ NM_001108061
- Peptide Label:
precursor
- UniProtKB:
D3ZFK9 (UniProtKB/TrEMBL), A6KBQ1 (UniProtKB/TrEMBL)
- Sequence:
MGALGRVLLWLQLCALTRAAYKLWVPNTSFDTASNWNQNRTPCAGDAVQFPADKMVSVLVRDSHAISDMLLPLNGEFVLASGAAFSAAGGDSDPACNPGAPLLFRNPDRFSWLDPHLWSSGTQESGIF
hide sequence
RefSeq Acc Id:
XP_006240650 ⟸ XM_006240588
- Peptide Label:
isoform X1
- Sequence:
MGALGRVLLWLQLCALTRAAYKLWVPNTSFDTASNWNQNRTPCAGDAVQFPADKMVSVLVRDSHAISDMLLPLNGEFVLASGAAFSAAGGDSDPACNPGAPLLFRNPDRFSWLDPHLWSSGTQESGIF
hide sequence
Ensembl Acc Id:
ENSRNOP00000012469 ⟸ ENSRNOT00000012469
RGD ID: 13694835 Promoter ID: EPDNEW_R5360 Type: multiple initiation site Name: Amn_1 Description: amnion associated transmembrane protein SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 135,724,501 - 135,724,561 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-12-18
Amn
amnion associated transmembrane protein
Amn
amnionless homolog (mouse)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-26
Amn
amnionless homolog (mouse)
Amn
amnionless
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Amn
amnionless
Amn_predicted
amnionless (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Amn_predicted
amnionless (predicted)
Symbol and Name status set to approved
70820 APPROVED
