Symbol:
Arsj
Name:
arylsulfatase family, member J
RGD ID:
1307640
Description:
Predicted to enable sulfuric ester hydrolase activity. Predicted to be located in actin cytoskeleton. Orthologous to human ARSJ (arylsulfatase family member J); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
arylsulfatase J; LOC311013; RGD1307640; similar to RIKEN cDNA 9330196J05
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 217,449,147 - 217,529,142 (+) NCBI GRCr8 mRatBN7.2 2 214,774,631 - 214,854,614 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 214,774,654 - 214,854,612 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 222,432,586 - 222,517,509 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 220,332,519 - 220,417,442 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 215,186,721 - 215,271,647 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 230,163,014 - 230,662,084 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_5.0 2 249,516,525 - 249,516,927 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 2 250,012,102 - 250,013,503 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 223,574,825 - 223,666,259 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 223,561,467 - 223,652,939 (+) NCBI Celera 2 207,110,820 - 207,186,084 (+) NCBI Celera Cytogenetic Map 2 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Arsj Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:1606235 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ARSJ mRNA CTD PMID:22079256 Arsj Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO RGD:1316948 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Arsj Rat 17beta-estradiol increases expression ISO RGD:1606235 6480464 Estradiol results in increased expression of ARSJ mRNA CTD PMID:21185374 Arsj Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of ARSJ mRNA CTD PMID:26496021 Arsj Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:1316948 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Arsj Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO RGD:1316948 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Arsj Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ARSJ mRNA CTD PMID:22298810 Arsj Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO RGD:1316948 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Arsj Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of ARSJ mRNA CTD PMID:31881176 Arsj Rat aflatoxin B1 increases expression ISO RGD:1606235 6480464 Aflatoxin B1 results in increased expression of ARSJ mRNA CTD PMID:22100608 Arsj Rat aflatoxin B1 decreases methylation ISO RGD:1606235 6480464 Aflatoxin B1 results in decreased methylation of ARSJ gene CTD PMID:27153756 Arsj Rat aldehydo-D-glucose multiple interactions ISO RGD:1316948 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 Arsj Rat all-trans-retinoic acid decreases expression ISO RGD:1606235 6480464 Tretinoin results in decreased expression of ARSJ mRNA CTD PMID:23724009 Arsj Rat aristolochic acid A decreases expression ISO RGD:1606235 6480464 aristolochic acid I results in decreased expression of ARSJ mRNA CTD PMID:33212167 Arsj Rat arsane increases methylation ISO RGD:1606235 6480464 Arsenic results in increased methylation of ARSJ promoter CTD PMID:21291286 Arsj Rat arsane multiple interactions ISO RGD:1606235 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ARSJ more ... CTD PMID:39836092 Arsj Rat arsenic atom increases methylation ISO RGD:1606235 6480464 Arsenic results in increased methylation of ARSJ promoter CTD PMID:21291286 Arsj Rat arsenic atom multiple interactions ISO RGD:1606235 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ARSJ more ... CTD PMID:39836092 Arsj Rat atrazine decreases expression ISO RGD:1606235 6480464 Atrazine results in decreased expression of ARSJ mRNA CTD PMID:22378314 Arsj Rat benzo[a]pyrene affects expression ISO RGD:1606235 6480464 Benzo(a)pyrene affects the expression of ARSJ mRNA CTD PMID:22316170 Arsj Rat benzo[a]pyrene increases methylation ISO RGD:1606235 6480464 Benzo(a)pyrene results in increased methylation of ARSJ exon CTD PMID:27901495 Arsj Rat benzo[a]pyrene decreases expression ISO RGD:1316948 6480464 Benzo(a)pyrene results in decreased expression of ARSJ mRNA CTD PMID:21569818|PMID:22228805 Arsj Rat benzo[b]fluoranthene decreases expression ISO RGD:1316948 6480464 benzo(b)fluoranthene results in decreased expression of ARSJ mRNA CTD PMID:26377693 Arsj Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of ARSJ mRNA CTD PMID:26496021 Arsj Rat bisphenol A decreases expression ISO RGD:1606235 6480464 bisphenol A results in decreased expression of ARSJ mRNA CTD PMID:29275510 Arsj Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ARSJ gene CTD PMID:28505145 Arsj Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ARSJ mRNA CTD PMID:25181051|PMID:30816183|PMID:32528016 Arsj Rat chloroprene decreases expression ISO RGD:1316948 6480464 Chloroprene results in decreased expression of ARSJ mRNA CTD PMID:23125180 Arsj Rat cisplatin multiple interactions ISO RGD:1606235 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of ARSJ mRNA CTD PMID:27392435 Arsj Rat cisplatin decreases expression ISO RGD:1606235 6480464 Cisplatin results in decreased expression of ARSJ mRNA CTD PMID:27392435 Arsj Rat cobalt dichloride decreases expression ISO RGD:1606235 6480464 cobaltous chloride results in decreased expression of ARSJ mRNA CTD PMID:19320972 Arsj Rat copper atom multiple interactions EXP 6480464 [Copper co-treated with Dietary Sucrose] results in increased expression of ARSJ mRNA CTD PMID:26033743 Arsj Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of ARSJ mRNA CTD PMID:26033743 Arsj Rat copper(0) multiple interactions EXP 6480464 [Copper co-treated with Dietary Sucrose] results in increased expression of ARSJ mRNA CTD PMID:26033743 Arsj Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of ARSJ mRNA CTD PMID:26033743 Arsj Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of ARSJ mRNA CTD PMID:27523638 Arsj Rat D-glucose multiple interactions ISO RGD:1316948 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 Arsj Rat divanadium pentaoxide affects expression ISO RGD:1316948 6480464 vanadium pentoxide affects the expression of ARSJ mRNA CTD PMID:26210822 Arsj Rat doxorubicin decreases expression ISO RGD:1606235 6480464 Doxorubicin results in decreased expression of ARSJ mRNA CTD PMID:29803840 Arsj Rat fluoranthene multiple interactions ISO RGD:1316948 6480464 [1-methylanthracene co-treated with fluoranthene] results in decreased expression of ARSJ mRNA CTD PMID:28329830 Arsj Rat fructose multiple interactions ISO RGD:1316948 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 Arsj Rat genistein decreases expression ISO RGD:1316948 6480464 Genistein results in decreased expression of ARSJ mRNA CTD PMID:32186404 Arsj Rat glucose multiple interactions ISO RGD:1316948 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 Arsj Rat glyphosate multiple interactions ISO RGD:1316948 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 Arsj Rat lipopolysaccharide increases expression ISO RGD:1606235 6480464 Lipopolysaccharides results in increased expression of ARSJ mRNA CTD PMID:35811015 Arsj Rat lipopolysaccharide multiple interactions ISO RGD:1606235 6480464 S-(1,2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of ARSJ mRNA] CTD PMID:35811015 Arsj Rat methylmercury chloride increases expression ISO RGD:1606235 6480464 methylmercuric chloride results in increased expression of ARSJ mRNA CTD PMID:28001369 Arsj Rat okadaic acid increases expression ISO RGD:1606235 6480464 Okadaic Acid results in increased expression of ARSJ mRNA CTD PMID:38832940 Arsj Rat PCB138 multiple interactions ISO RGD:1316948 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Arsj Rat pirinixic acid multiple interactions ISO RGD:1316948 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Arsj Rat potassium chromate multiple interactions ISO RGD:1606235 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ARSJ mRNA CTD PMID:22079256 Arsj Rat potassium chromate decreases expression ISO RGD:1606235 6480464 potassium chromate(VI) results in decreased expression of ARSJ mRNA CTD PMID:22079256 Arsj Rat rifampicin decreases expression ISO RGD:1606235 6480464 Rifampin results in decreased expression of ARSJ mRNA CTD PMID:24552687 Arsj Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:1606235 6480464 S-(1,2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of ARSJ mRNA] CTD PMID:35811015 Arsj Rat sodium arsenite decreases expression ISO RGD:1606235 6480464 sodium arsenite results in decreased expression of ARSJ mRNA CTD PMID:38568856 Arsj Rat sodium arsenite multiple interactions ISO RGD:1606235 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ARSJ more ... CTD PMID:39836092 Arsj Rat sulforaphane increases expression ISO RGD:1606235 6480464 sulforaphane results in increased expression of ARSJ mRNA CTD PMID:31838189 Arsj Rat sunitinib decreases expression ISO RGD:1606235 6480464 Sunitinib results in decreased expression of ARSJ mRNA CTD PMID:31533062 Arsj Rat tetrachloromethane affects expression ISO RGD:1316948 6480464 Carbon Tetrachloride affects the expression of ARSJ mRNA CTD PMID:17484886 Arsj Rat trichostatin A increases expression ISO RGD:1606235 6480464 trichostatin A results in increased expression of ARSJ mRNA CTD PMID:24935251 Arsj Rat triclosan decreases expression ISO RGD:1606235 6480464 Triclosan results in decreased expression of ARSJ mRNA CTD PMID:30510588 Arsj Rat valproic acid decreases expression ISO RGD:1606235 6480464 Valproic Acid results in decreased expression of ARSJ mRNA CTD PMID:29154799 Arsj Rat valproic acid increases expression ISO RGD:1606235 6480464 Valproic Acid results in increased expression of ARSJ mRNA CTD PMID:28001369
(-)-epigallocatechin 3-gallate (ISO) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4,4'-trichlorobiphenyl (ISO) acetamide (EXP) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bisphenol A (EXP,ISO) chloroprene (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper atom (EXP) copper(0) (EXP) Cuprizon (EXP) D-glucose (ISO) divanadium pentaoxide (ISO) doxorubicin (ISO) fluoranthene (ISO) fructose (ISO) genistein (ISO) glucose (ISO) glyphosate (ISO) lipopolysaccharide (ISO) methylmercury chloride (ISO) okadaic acid (ISO) PCB138 (ISO) pirinixic acid (ISO) potassium chromate (ISO) rifampicin (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) sodium arsenite (ISO) sulforaphane (ISO) sunitinib (ISO) tetrachloromethane (ISO) trichostatin A (ISO) triclosan (ISO) valproic acid (ISO)
Arsj Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 217,449,147 - 217,529,142 (+) NCBI GRCr8 mRatBN7.2 2 214,774,631 - 214,854,614 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 214,774,654 - 214,854,612 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 222,432,586 - 222,517,509 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 220,332,519 - 220,417,442 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 215,186,721 - 215,271,647 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 230,163,014 - 230,662,084 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_5.0 2 249,516,525 - 249,516,927 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 2 250,012,102 - 250,013,503 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 223,574,825 - 223,666,259 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 223,561,467 - 223,652,939 (+) NCBI Celera 2 207,110,820 - 207,186,084 (+) NCBI Celera Cytogenetic Map 2 q42 NCBI
ARSJ Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 113,900,284 - 113,979,647 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 113,900,284 - 113,979,727 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 114,821,440 - 114,900,803 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 115,040,889 - 115,120,327 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 4 112,113,187 - 112,192,557 (-) NCBI Celera Cytogenetic Map 4 q26 NCBI HuRef 4 110,549,726 - 110,629,095 (-) NCBI HuRef CHM1_1 4 114,797,941 - 114,877,327 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 117,209,000 - 117,288,314 (-) NCBI T2T-CHM13v2.0
Arsj Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 126,157,566 - 126,234,025 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 126,157,333 - 126,234,024 (+) Ensembl GRCm39 Ensembl GRCm38 3 126,363,852 - 126,440,374 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 126,363,684 - 126,440,375 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 126,066,770 - 126,143,292 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 126,355,874 - 126,432,396 (+) NCBI MGSCv36 mm8 Celera 3 132,806,992 - 132,894,155 (+) NCBI Celera Cytogenetic Map 3 G1 NCBI cM Map 3 55.97 NCBI
Arsj Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955428 25,373,664 - 25,437,506 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955428 25,373,664 - 25,436,251 (+) NCBI ChiLan1.0 ChiLan1.0
ARSJ Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 112,001,869 - 112,082,620 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 112,285,049 - 112,374,062 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 106,413,083 - 106,493,804 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 116,977,450 - 117,055,778 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 116,977,450 - 117,055,778 (-) Ensembl panpan1.1 panPan2
ARSJ Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 32 33,636,117 - 33,715,867 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 32 33,635,467 - 33,716,434 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 32 8,316,578 - 8,396,341 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 32 33,862,066 - 33,942,038 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 32 33,861,117 - 33,942,038 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 32 33,840,343 - 33,920,028 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 32 33,609,619 - 33,689,546 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 32 6,172,634 - 6,252,363 (+) NCBI UU_Cfam_GSD_1.0
Arsj Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405301 7,180,989 - 7,256,670 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936563 4,652,711 - 4,728,884 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936563 4,653,070 - 4,728,820 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ARSJ Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 108,726,113 - 108,803,559 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 108,710,636 - 108,804,846 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 16 82,531,767 - 82,538,491 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ARSJ Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 61,710,123 - 61,787,875 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 61,712,063 - 61,786,876 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 40,473,821 - 40,559,290 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Arsj
.
Predicted Target Of
Count of predictions: 27 Count of miRNA genes: 23 Interacting mature miRNAs: 26 Transcripts: ENSRNOT00000055633 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 2301408 Kidm36 Kidney mass QTL 36 0.002 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 190613715 226808892 Rat 1598813 Memor9 Memory QTL 9 2.7 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 199341726 234244620 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 1298075 Scl17 Serum cholesterol level QTL 17 3.4 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 211744537 249053267 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 2298479 Eau5 Experimental allergic uveoretinitis QTL 5 0.0021 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 2 202446871 237938339 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 1300126 Bp175 Blood pressure QTL 175 3.46 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 214226044 247136170 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 7207484 Bss108 Bone structure and strength QTL 108 5.3 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 2 211744537 249053267 Rat 61458 Bp10 Blood pressure QTL 10 3.42 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189020722 215287351 Rat 738013 Alc15 Alcohol consumption QTL 15 4.1 0.00022 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 2 184165752 229165752 Rat 61398 Bp50 Blood pressure QTL 50 4.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189599258 234599258 Rat 7207482 Bss107 Bone structure and strength QTL 107 7 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 2 211744537 249053267 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 2317752 Glom23 Glomerulus QTL 23 3.6 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 2 193452645 245889826 Rat 1549836 Bss2 Bone structure and strength QTL 2 7.5 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 2 211744537 249053267 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 2317885 Alcrsp28 Alcohol response QTL 28 2.1 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 212828222 249053267 Rat 1359031 Bp275 Blood pressure QTL 275 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 185876309 219753474 Rat 1581499 Esta2 Estrogen-induced thymic atrophy QTL 2 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 189599258 226936289 Rat 9589044 Scfw1 Subcutaneous fat weight QTL 1 5.8 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 2 182171407 227171407 Rat 8694435 Bw166 Body weight QTL 166 14.08 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 2 182171407 227171407 Rat 61417 Cia10 Collagen induced arthritis QTL 10 3.4 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 2 179946951 224946951 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631203 Gluco14 Glucose level QTL 14 0.0001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 2 206665645 219003804 Rat 8694383 Bw158 Body weight QTL 158 7.69 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 2 182171407 227171407 Rat 1598835 Anxrr18 Anxiety related response QTL 18 2.98 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 2 200990457 245990457 Rat 7207490 Bss111 Bone structure and strength QTL 111 6.4 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 2 211744537 249053267 Rat 1298083 Bp158 Blood pressure QTL 158 2.62 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189020722 215287351 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1331745 Bp203 Blood pressure QTL 203 4.377 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 189599258 218414891 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 8694194 Abfw1 Abdominal fat weight QTL 1 11.7 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 2 182171407 227171407 Rat 61366 Iddm3 Insulin dependent diabetes mellitus QTL 3 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 189599258 234599258 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 2299161 Iddm33 Insulin dependent diabetes mellitus QTL 33 2.98 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 206312063 220876787 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 2300189 Bmd48 Bone mineral density QTL 48 5.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 179335906 224335906 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat
WI-21570
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 214,853,226 - 214,853,492 (+) MAPPER mRatBN7.2 Rnor_6.0 2 230,661,656 - 230,661,921 NCBI Rnor6.0 Rnor_5.0 2 250,013,075 - 250,013,340 UniSTS Rnor5.0 RGSC_v3.4 2 223,665,831 - 223,666,096 UniSTS RGSC3.4 Celera 2 207,185,656 - 207,185,921 UniSTS Cytogenetic Map 2 q42 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSRNOT00000055633 ⟹ ENSRNOP00000092332
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 214,774,654 - 214,854,612 (+) Ensembl
RefSeq Acc Id:
NM_001047887 ⟹ NP_001041352
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 217,449,147 - 217,529,142 (+) NCBI mRatBN7.2 2 214,774,631 - 214,854,614 (+) NCBI Rnor_6.0 2 230,163,014 - 230,662,084 (+) NCBI Rnor_5.0 2 249,516,525 - 249,516,927 (+) NCBI Rnor_5.0 2 250,012,102 - 250,013,503 (+) NCBI RGSC_v3.4 2 223,574,825 - 223,666,259 (+) RGD Celera 2 207,110,820 - 207,186,084 (+) RGD
Sequence:
ATGGCCCCCAGGGACAGTGCGGAGCCTCTGCCTCCGCTCTTTCCACAGGCCAGGGTCTGGCCTGGAAAGATGGTAGCGATGGGTGCCCTGGCAGGCTTCTGGGTCCTCAGCCTGATCACCTATGGCTA
hide sequence
RefSeq Acc Id:
NP_001041352 ⟸ NM_001047887
- UniProtKB:
Q32KJ7 (UniProtKB/TrEMBL), A0A8I6GJP1 (UniProtKB/TrEMBL)
- Sequence:
MAPRDSAEPLPPLFPQARVWPGKMVAMGALAGFWVLSLITYGYLSWGQDLEEEGSLRAQVEERPEAGTAVTSQPHLIFILADDQGFRDVGYHGSEIKTPTLDKLAAEGVKLENYYVQPICTPSRSQFI
hide sequence
Ensembl Acc Id:
ENSRNOP00000092332 ⟸ ENSRNOT00000055633
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-09-25
Arsj
arylsulfatase family, member J
Arsj
arylsulfatase J
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Arsj
arylsulfatase J
RGD1307640
similar to RIKEN cDNA 9330196J05
Symbol and Name updated
1299863 APPROVED
2005-12-06
RGD1307640
similar to RIKEN cDNA 9330196J05
RGD1307640_predicted
similar to RIKEN cDNA 9330196J05 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1307640_predicted
similar to RIKEN cDNA 9330196J05 (predicted)
LOC311013_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC311013_predicted
similar to RIKEN cDNA 9330196J05 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
