Advanced Search (OLGA)

Gene: Gin1 (gypsy retrotransposon integrase 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Gin1

Name:

gypsy retrotransposon integrase 1

RGD ID:

1307449

Description:

Predicted to enable nucleic acid binding activity. Predicted to be involved in DNA integration. Orthologous to human GIN1 (gypsy retrotransposon integrase 1); INTERACTS WITH 4,4'-diaminodiphenylmethane; atrazine; azoxystrobin.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

GIN-1; gypsy retrotransposon integrase-like protein 1; LOC316687; RGD1307449; similar to RIKEN cDNA 4930429M06Rik

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	105,740,914 - 105,762,357 (-)	NCBI		GRCr8
mRatBN7.2	9	98,293,596 - 98,315,155 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	98,293,597 - 98,315,848 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	106,708,493 - 106,728,718 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	111,836,476 - 111,856,701 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	110,179,867 - 110,200,092 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	111,200,285 - 111,220,738 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	111,199,141 - 111,220,693 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	110,750,567 - 110,770,987 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	97,070,918 - 97,091,577 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	97,280,493 - 97,293,502 (-)	NCBI
Celera	9	95,736,354 - 95,756,618 (-)	NCBI		Celera
Cytogenetic Map	9	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gin1	Rat	familial adenomatous polyposis 1		ISO	GIN1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial adenomatous polyposis 1	ClinVar	PMID:17963004 more ...
Gin1	Rat	Hereditary Neoplastic Syndromes		ISO	GIN1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary cancer-predisposing syndrome	ClinVar	PMID:17963004 more ...
Gin1	Rat	Neurodevelopmental Disorders		ISO	GIN1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gin1	Rat	rheumatoid arthritis		ISO	GIN1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:23143596

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gin1	Rat	(-)-epigallocatechin 3-gallate	multiple interactions	ISO	GIN1 (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of GIN1 mRNA	CTD	PMID:22079256
Gin1	Rat	(-)-epigallocatechin 3-gallate	decreases expression	ISO	GIN1 (Homo sapiens)	6480464	epigallocatechin gallate results in decreased expression of GIN1 mRNA	CTD	PMID:22079256
Gin1	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Gin1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of GIN1 mRNA	CTD	PMID:22206623
Gin1	Rat	17beta-estradiol	decreases expression	ISO	Gin1 (Mus musculus)	6480464	Estradiol results in decreased expression of GIN1 mRNA	CTD	PMID:39298647
Gin1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Gin1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of GIN1 mRNA	CTD	PMID:19770486
Gin1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Gin1 (Mus musculus)	6480464	[TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression of GIN1 mRNA	CTD	PMID:25975270
Gin1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Gin1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of GIN1 mRNA	CTD	PMID:21570461
Gin1	Rat	2-hydroxypropanoic acid	decreases expression	ISO	GIN1 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of GIN1 mRNA	CTD	PMID:30851411
Gin1	Rat	4,4'-diaminodiphenylmethane	decreases expression	EXP		6480464	4 and 4'-diaminodiphenylmethane results in decreased expression of GIN1 mRNA	CTD	PMID:30723492
Gin1	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	Gin1 (Mus musculus)	6480464	bisphenol S results in decreased expression of GIN1 mRNA	CTD	PMID:33297965 and PMID:39298647
Gin1	Rat	aflatoxin B1	increases expression	ISO	Gin1 (Mus musculus)	6480464	Aflatoxin B1 results in increased expression of GIN1 mRNA	CTD	PMID:19770486
Gin1	Rat	aflatoxin M1	decreases expression	ISO	GIN1 (Homo sapiens)	6480464	Aflatoxin M1 results in decreased expression of GIN1 mRNA	CTD	PMID:30928695
Gin1	Rat	all-trans-retinoic acid	decreases expression	ISO	GIN1 (Homo sapiens)	6480464	Tretinoin results in decreased expression of GIN1 mRNA	CTD	PMID:21934132
Gin1	Rat	atrazine	affects methylation	EXP		6480464	Atrazine affects the methylation of GIN1 gene	CTD	PMID:28931070 and PMID:35440735
Gin1	Rat	azoxystrobin	multiple interactions	EXP		6480464	[azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of GIN1 mRNA	CTD	PMID:33854195
Gin1	Rat	benzo[a]pyrene	increases expression	ISO	Gin1 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of GIN1 mRNA	CTD	PMID:19770486
Gin1	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	Gin1 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of GIN1 mRNA	CTD	PMID:34319233
Gin1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of GIN1 mRNA	CTD	PMID:25181051 and PMID:30816183
Gin1	Rat	bisphenol A	decreases expression	ISO	Gin1 (Mus musculus)	6480464	bisphenol A results in decreased expression of GIN1 mRNA	CTD	PMID:37894381
Gin1	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with tributyltin] results in increased expression of GIN1 mRNA	CTD	PMID:31129395
Gin1	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of GIN1 gene	CTD	PMID:28505145
Gin1	Rat	bisphenol A	increases expression	ISO	Gin1 (Mus musculus)	6480464	bisphenol A results in increased expression of GIN1 mRNA	CTD	PMID:25594700
Gin1	Rat	bisphenol F	decreases expression	ISO	Gin1 (Mus musculus)	6480464	bisphenol F results in decreased expression of GIN1 mRNA	CTD	PMID:38685157
Gin1	Rat	carbon nanotube	decreases expression	ISO	Gin1 (Mus musculus)	6480464	Nanotubes and Carbon analog results in decreased expression of GIN1 mRNA	CTD	PMID:25554681
Gin1	Rat	chlorpyrifos	multiple interactions	EXP		6480464	[azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of GIN1 mRNA	CTD	PMID:33854195
Gin1	Rat	cisplatin	decreases expression	ISO	GIN1 (Homo sapiens)	6480464	Cisplatin results in decreased expression of GIN1 mRNA	CTD	PMID:27392435
Gin1	Rat	copper(II) sulfate	decreases expression	ISO	GIN1 (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of GIN1 mRNA	CTD	PMID:19549813
Gin1	Rat	cyclosporin A	increases expression	ISO	GIN1 (Homo sapiens)	6480464	Cyclosporine results in increased expression of GIN1 mRNA	CTD	PMID:20106945
Gin1	Rat	Dibutyl phosphate	affects expression	ISO	GIN1 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of GIN1 mRNA	CTD	PMID:37042841
Gin1	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of GIN1 mRNA	CTD	PMID:24136188
Gin1	Rat	folic acid	decreases expression	ISO	Gin1 (Mus musculus)	6480464	Folic Acid results in decreased expression of GIN1 mRNA	CTD	PMID:25629700
Gin1	Rat	formaldehyde	decreases expression	ISO	GIN1 (Homo sapiens)	6480464	Formaldehyde results in decreased expression of GIN1 mRNA	CTD	PMID:23649840
Gin1	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of GIN1 mRNA	CTD	PMID:33387578
Gin1	Rat	glyphosate	multiple interactions	EXP		6480464	[azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of GIN1 mRNA	CTD	PMID:33854195
Gin1	Rat	imidacloprid	multiple interactions	EXP		6480464	[azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of GIN1 mRNA	CTD	PMID:33854195
Gin1	Rat	methapyrilene	decreases expression	EXP		6480464	Methapyrilene results in decreased expression of GIN1 mRNA	CTD	PMID:30467583
Gin1	Rat	methylmercury chloride	decreases expression	ISO	GIN1 (Homo sapiens)	6480464	methylmercuric chloride results in decreased expression of GIN1 mRNA	CTD	PMID:28001369
Gin1	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of GIN1 mRNA	CTD	PMID:25729387
Gin1	Rat	oxaliplatin	decreases expression	EXP		6480464	oxaliplatin results in decreased expression of GIN1 mRNA	CTD	PMID:25729387
Gin1	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of GIN1 mRNA	CTD	PMID:33387578
Gin1	Rat	phenobarbital	affects expression	ISO	Gin1 (Mus musculus)	6480464	Phenobarbital affects the expression of GIN1 mRNA	CTD	PMID:23091169
Gin1	Rat	potassium chromate	decreases expression	ISO	GIN1 (Homo sapiens)	6480464	potassium chromate(VI) results in decreased expression of GIN1 mRNA	CTD	PMID:22079256
Gin1	Rat	potassium chromate	multiple interactions	ISO	GIN1 (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of GIN1 mRNA	CTD	PMID:22079256
Gin1	Rat	pregnenolone 16alpha-carbonitrile	increases expression	ISO	Gin1 (Mus musculus)	6480464	Pregnenolone Carbonitrile results in increased expression of GIN1 mRNA	CTD	PMID:28903501
Gin1	Rat	rac-lactic acid	decreases expression	ISO	GIN1 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of GIN1 mRNA	CTD	PMID:30851411
Gin1	Rat	resorcinol	decreases expression	ISO	GIN1 (Homo sapiens)	6480464	resorcinol results in decreased expression of GIN1 mRNA	CTD	PMID:22623647
Gin1	Rat	sodium arsenite	decreases expression	ISO	GIN1 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of GIN1 mRNA	CTD	PMID:38568856
Gin1	Rat	sodium fluoride	decreases expression	ISO	Gin1 (Mus musculus)	6480464	Sodium Fluoride results in decreased expression of GIN1 mRNA	CTD	PMID:27862939
Gin1	Rat	thiabendazole	multiple interactions	EXP		6480464	[azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of GIN1 mRNA	CTD	PMID:33854195
Gin1	Rat	thimerosal	increases expression	ISO	GIN1 (Homo sapiens)	6480464	Thimerosal results in increased expression of GIN1 mRNA	CTD	PMID:27188386
Gin1	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of GIN1 mRNA	CTD	PMID:25729387
Gin1	Rat	topotecan	decreases expression	EXP		6480464	Topotecan results in decreased expression of GIN1 mRNA	CTD	PMID:25729387
Gin1	Rat	tributylstannane	multiple interactions	EXP		6480464	[bisphenol A co-treated with tributyltin] results in increased expression of GIN1 mRNA	CTD	PMID:31129395
Gin1	Rat	triphenyl phosphate	affects expression	ISO	GIN1 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of GIN1 mRNA	CTD	PMID:37042841
Gin1	Rat	tungsten	increases expression	ISO	Gin1 (Mus musculus)	6480464	Tungsten results in increased expression of GIN1 mRNA	CTD	PMID:30912803
Gin1	Rat	urethane	decreases expression	ISO	GIN1 (Homo sapiens)	6480464	Urethane results in decreased expression of GIN1 mRNA	CTD	PMID:28818685
Gin1	Rat	vorinostat	increases expression	ISO	GIN1 (Homo sapiens)	6480464	vorinostat results in increased expression of GIN1 mRNA	CTD	PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gin1	Rat	DNA integration	involved_in	IEA	InterPro:IPR001584	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gin1	Rat	nucleic acid binding	enables	IEA	InterPro:IPR036397	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Gin1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	105,740,914 - 105,762,357 (-)	NCBI		GRCr8
mRatBN7.2	9	98,293,596 - 98,315,155 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	98,293,597 - 98,315,848 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	106,708,493 - 106,728,718 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	111,836,476 - 111,856,701 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	110,179,867 - 110,200,092 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	111,200,285 - 111,220,738 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	111,199,141 - 111,220,693 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	110,750,567 - 110,770,987 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	97,070,918 - 97,091,577 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	97,280,493 - 97,293,502 (-)	NCBI
Celera	9	95,736,354 - 95,756,618 (-)	NCBI		Celera
Cytogenetic Map	9	q36	NCBI

GIN1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	103,086,000 - 103,120,138 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	103,086,000 - 103,120,138 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	102,421,704 - 102,455,842 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	102,449,603 - 102,483,741 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	5	98,369,538 - 98,403,680 (-)	NCBI		Celera
Cytogenetic Map	5	q21.1	NCBI
HuRef	5	97,602,973 - 97,637,114 (-)	NCBI		HuRef
CHM1_1	5	101,854,334 - 101,888,476 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	103,594,035 - 103,628,240 (-)	NCBI		T2T-CHM13v2.0

Gin1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	97,697,894 - 97,721,435 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	97,697,897 - 97,721,434 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	97,770,172 - 97,793,710 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	97,770,172 - 97,793,709 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	99,666,756 - 99,689,548 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	99,600,606 - 99,623,375 (+)	NCBI		MGSCv36	mm8
Celera	1	100,649,677 - 100,673,455 (+)	NCBI		Celera
Cytogenetic Map	1	D	NCBI
cM Map	1	47.76	NCBI

Gin1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955418	10,898,293 - 10,918,544 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955418	10,898,069 - 10,918,460 (+)	NCBI	ChiLan1.0	ChiLan1.0

GIN1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	98,363,395 - 98,404,407 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	96,364,376 - 96,690,507 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	98,440,271 - 98,475,300 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	104,143,456 - 104,175,826 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	104,124,849 - 104,175,826 (-)	Ensembl	panpan1.1		panPan2

GIN1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	8,088,719 - 8,116,461 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	8,088,515 - 8,116,436 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	9,490,244 - 9,518,001 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	7,976,941 - 8,004,710 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	7,977,034 - 8,004,701 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	7,917,409 - 7,945,154 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	7,936,158 - 7,964,988 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	8,095,976 - 8,123,752 (+)	NCBI		UU_Cfam_GSD_1.0

Gin1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	163,232,989 - 163,258,059 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936523	1,418,316 - 1,443,618 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936523	1,418,387 - 1,443,322 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GIN1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	108,561,387 - 108,597,262 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	108,561,132 - 108,599,017 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	112,579,162 - 112,614,955 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GIN1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	6,528,728 - 6,562,314 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	6,526,425 - 6,563,044 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666036	7,766,036 - 7,801,636 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gin1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624743	21,212,688 - 21,236,882 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Gin1
75 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	79
Count of miRNA genes:	73
Interacting mature miRNAs:	74
Transcripts:	ENSRNOT00000016028
Prediction methods:	Microtar, Miranda
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578760	Cm53	Cardiac mass QTL 53	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	56771635	101771635	Rat
1582203	Gluco19	Glucose level QTL 19	3.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	92491589	100929786	Rat
1300134	Bp185	Blood pressure QTL 185	3.73		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	61381434	104821652	Rat
1354626	Bvd1	Brain ventricular dilatation QTL 1	3.73	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	9	75712843	111552878	Rat
4889852	Pur26	Proteinuria QTL 26	15	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	77813894	101597663	Rat
7794784	Mcs31	Mammary carcinoma susceptibility QTL 31	2.98		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	9	77813894	111552878	Rat
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	25661188	100929786	Rat
724515	Uae16	Urinary albumin excretion QTL 16	8		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	58163035	100929646	Rat
731171	Glom6	Glomerulus QTL 6	2.8	0.0003	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	9	64573531	109573531	Rat
724547	Cm21	Cardiac mass QTL 21	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	9	79271511	102910209	Rat
61385	Edpm9	Estrogen-dependent pituitary mass QTL 9	3.43	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	63869687	108869687	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	25268044	114175309	Rat

RH143019

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	98,314,374 - 98,314,520 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	111,219,984 - 111,220,129	NCBI	Rnor6.0
Rnor_5.0	9	110,770,234 - 110,770,379	UniSTS	Rnor5.0
RGSC_v3.4	9	97,090,910 - 97,091,055	UniSTS	RGSC3.4
Celera	9	95,755,951 - 95,756,096	UniSTS
RH 3.4 Map	9	818.49	UniSTS
Cytogenetic Map	9	q36	UniSTS

AW532587

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	98,317,204 - 98,317,362 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	111,222,813 - 111,222,970	NCBI	Rnor6.0
Rnor_5.0	9	110,773,063 - 110,773,220	UniSTS	Rnor5.0
RGSC_v3.4	9	97,093,739 - 97,093,896	UniSTS	RGSC3.4
Celera	9	95,758,343 - 95,758,500	UniSTS
RH 3.4 Map	9	818.49	UniSTS
Cytogenetic Map	9	q36	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001025012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008767377	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008767378	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039083782	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039083784	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039083785	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063267333	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC099126	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC082058	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473997	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000016028 ⟹ ENSRNOP00000016028

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	98,294,776 - 98,315,042 (-)	Ensembl
Rnor_6.0 Ensembl	9	111,200,383 - 111,220,651 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076441

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	9	111,218,699 - 111,220,693 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000077052

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	9	111,206,795 - 111,209,286 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000087355 ⟹ ENSRNOP00000073007

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	98,293,597 - 98,315,848 (-)	Ensembl
Rnor_6.0 Ensembl	9	111,199,141 - 111,213,098 (-)	Ensembl

RefSeq Acc Id:

NM_001025012 ⟹ NP_001020183

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	105,742,089 - 105,762,357 (-)	NCBI
mRatBN7.2	9	98,294,771 - 98,315,042 (-)	NCBI
Rnor_6.0	9	111,200,383 - 111,220,651 (-)	NCBI
Rnor_5.0	9	110,750,567 - 110,770,987 (-)	NCBI
RGSC_v3.4	9	97,070,918 - 97,091,577 (-)	RGD
Celera	9	95,736,354 - 95,756,618 (-)	RGD

Sequence:

show sequence

TGCATTTAGGACCACTTCGAAGCAGCAGTTGATGAACTACGTAAAACAATAAGTCATTATAAAGTCCATACACTGGGAGGCTGAGGCAGGAGGATCACCATGAGTGTGAAGCCAGCCCCATCTACCTA
GTTCCAGGACAGCTTTGGCTACAGATACCCTGAAAAGGGACAGGGGGAAAAAAAGGTCACGATGGTCCGTAGTGGGAAAAACGGTGACCTTCATCTTAAACAGATCGCGTACTATAAGCGCACAGGCG
AGTACCACCCGACCACACTGTCGAGTGAGAGAAGCGGCATCAGAAGGGCGGCTAAGAAATTTGTCTTCAAAGAAAAAAAGCTGTTTTATGTTGGAAAAGACAGAAAACAAAATCGTTTGGTAGTTGTT
TCGGAAGAGGAAAAAAAGAAAGTGTTGAGAGAGTGCCATGAAAATGGCCCTGGTGTCCATCACGGCATCTCCAGAACCCTCACTCTAGTGGAGTCCAGCTACTATTGGACATCCGTGACCAATGATGT
CAAGCAGTGGGTATATGCTTGTCAGCATTGCCAAGTAGCGAAAAGCACAGTTATCGTAGCACCACAGCAGCACCTTTCCGTGGTGGGAAACCCGTGGAGTGTAGTTACTGTTGATCTGATGGGACCTT
TCCATACAAGCAGCAGAAGTCATGTGTATGCTATGATCATGACAGACTTGTTCACAAAATGGGTTATGATTTTGCCTTTATGTGATGTTTCAGCATCAGAAATTTCTAAAGCTATTATCAATATATTT
TTCCTATATGGACCTCCTCAGAAAATAATAATGGACCAAAGAGATGAATTCATTGATCAGATCAATGTAGAACTGTATAGATTATTTGGTGCAAAGGAGATTGTAATTTCTCAAGCGTCTGGAAGTGT
GAATCCATCTGAAAGCACGCCCAGCACGGTGAAAACATTCCTCTCCAAACACTGCGCCGAGCACCCCGAGACCTGGGACGAGGAGCTGCCAGCTCTCTCCTTTGCCTTCAACGTGACCCGCGTGGAGC
CTACTAAAAACTCGCCGTATTTCCAAATGTTCAACCGGAACCCTTGCTTGCTCGAGTGTCCTCATGAAGGGGGAGGCGAAGGCACAAGCGTGTTCGCCAGAATCGTGGCTGCGGTTAGAGAGGCTGAT
GGCGTGGTGGAGAACCAGACACCAGCAGCAGGCCAGATGGAGAGCAGCACTTCAGAGGAGCTGAGTAAAAGCAAAGTTGCTAAGAAGAAACCAAAGCAGCTAAACCCCTTCCACTTGAAAGTGGGTCA
CGAGGTGTTAAGGCAGAGGAAGAACTGGTGGAAGGATGGCCGCTTCCAATCTGAGTGGGTTGGTCCTTGTGTCATCGACTACATTACAGACAGCGGATGCGCTGTCCTCAGAGACAACACTGGAACCA
GACTCAAACGACCTATCAAAATGTCCCACCTCAGGCCTTACGTGAGAGAGCCAAGTGAGCAGGACAGTCTTTATCTCCTGCAAGGTTCCATAGTGGCGGATCACGACTACATTGGATTACCTGAAATC
CCAGTTGGAACATACCAGGCTAATATTCTGGTGGAAGATGCAACGATCGGGATTGTTGATAATGAATTATTGATATCAAGCAAGGATCATGAACTCTTAGAATATAGAAATTCAAAAATCTCTGCGTT
GGTAGAAGACCACAGTTCTCTTGAGAAACAGACTTTCAGTCTACTGGATTCTTCAAATCAAGTTCTTGAGTACCTCAGTTAGTGAATACCAGAATGAACTTCGAATGCTTGCATAGAATGTACATATT
TCTAGTTTGTAAGTATTTTATCTATTAAAATAGGTTGTATAGAAGAGAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039083782 ⟹ XP_038939710

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	105,740,914 - 105,757,837 (-)	NCBI
mRatBN7.2	9	98,293,596 - 98,313,538 (-)	NCBI

RefSeq Acc Id:

XM_039083784 ⟹ XP_038939712

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	105,740,914 - 105,752,654 (-)	NCBI
mRatBN7.2	9	98,293,596 - 98,305,361 (-)	NCBI

RefSeq Acc Id:

XM_039083785 ⟹ XP_038939713

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	105,740,914 - 105,752,737 (-)	NCBI
mRatBN7.2	9	98,293,596 - 98,305,422 (-)	NCBI

RefSeq Acc Id:

XM_063267333 ⟹ XP_063123403

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	105,740,914 - 105,754,794 (-)	NCBI


Protein RefSeqs	NP_001020183	(Get FASTA)	NCBI Sequence Viewer
	XP_038939710	(Get FASTA)	NCBI Sequence Viewer
	XP_038939712	(Get FASTA)	NCBI Sequence Viewer
	XP_038939713	(Get FASTA)	NCBI Sequence Viewer
	XP_063123403	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH82058	(Get FASTA)	NCBI Sequence Viewer
	EDL91856	(Get FASTA)	NCBI Sequence Viewer
	EDL91857	(Get FASTA)	NCBI Sequence Viewer
	EDL91858	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016028
	ENSRNOP00000016028.6
	ENSRNOP00000073007
GenBank Protein	Q66H30	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001020183 ⟸ NM_001025012

- UniProtKB:

Q66H30 (UniProtKB/Swiss-Prot), A6JR80 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVRSGKNGDLHLKQIAYYKRTGEYHPTTLSSERSGIRRAAKKFVFKEKKLFYVGKDRKQNRLVVVSEEEKKKVLRECHENGPGVHHGISRTLTLVESSYYWTSVTNDVKQWVYACQHCQVAKSTVIVA
PQQHLSVVGNPWSVVTVDLMGPFHTSSRSHVYAMIMTDLFTKWVMILPLCDVSASEISKAIINIFFLYGPPQKIIMDQRDEFIDQINVELYRLFGAKEIVISQASGSVNPSESTPSTVKTFLSKHCAE
HPETWDEELPALSFAFNVTRVEPTKNSPYFQMFNRNPCLLECPHEGGGEGTSVFARIVAAVREADGVVENQTPAAGQMESSTSEELSKSKVAKKKPKQLNPFHLKVGHEVLRQRKNWWKDGRFQSEWV
GPCVIDYITDSGCAVLRDNTGTRLKRPIKMSHLRPYVREPSEQDSLYLLQGSIVADHDYIGLPEIPVGTYQANILVEDATIGIVDNELLISSKDHELLEYRNSKISALVEDHSSLEKQTFSLLDSSNQ
VLEYLS

hide sequence

Ensembl Acc Id:

ENSRNOP00000016028 ⟸ ENSRNOT00000016028

Ensembl Acc Id:

ENSRNOP00000073007 ⟸ ENSRNOT00000087355

RefSeq Acc Id:	XP_038939710 ⟸ XM_039083782
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2R6L5 (UniProtKB/TrEMBL), A6JR80 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038939713 ⟸ XM_039083785
- Peptide Label:	isoform X2

Protein Domains

Integrase catalytic

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q66H30-F1-model_v2	AlphaFold	Q66H30	1-518	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13696898

Promoter ID:

EPDNEW_R7421

Type:

initiation region

Name:

Gin1_1

Description:

gypsy retrotransposon integrase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	9	111,220,702 - 111,220,762	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-26582	BioCyc
Ensembl Genes	ENSRNOG00000011962	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000016028	ENTREZGENE
	ENSRNOT00000016028.8	UniProtKB/Swiss-Prot
	ENSRNOT00000087355	ENTREZGENE
Gene3D-CATH	1.10.340.70	UniProtKB/Swiss-Prot
	3.30.420.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7132420	IMAGE-MGC_LOAD
InterPro	Integrase_cat-core	UniProtKB/Swiss-Prot
	Integrase_H2C2	UniProtKB/Swiss-Prot
	Retrovirus_Pol_polyprotein	UniProtKB/Swiss-Prot
	RNaseH-like_sf	UniProtKB/Swiss-Prot
	RNaseH_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:316687	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:95212	IMAGE-MGC_LOAD
NCBI Gene	316687	ENTREZGENE
PANTHER	PROTEIN CBG26694	UniProtKB/Swiss-Prot
	PROTEIN NYNRIN-LIKE	UniProtKB/Swiss-Prot
Pfam	Integrase_H2C2	UniProtKB/Swiss-Prot
PhenoGen	Gin1	PhenoGen
PROSITE	INTEGRASE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000011962	RatGTEx
Superfamily-SCOP	SSF53098	UniProtKB/Swiss-Prot
UniProt	A0A8L2R6L5	ENTREZGENE, UniProtKB/TrEMBL
	A6JR80	ENTREZGENE, UniProtKB/TrEMBL
	GIN1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-07	Gin1	gypsy retrotransposon integrase 1	RGD1307449	similar to RIKEN cDNA 4930429M06Rik	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1307449	similar to RIKEN cDNA 4930429M06Rik	RGD1307449_predicted	similar to RIKEN cDNA 4930429M06Rik (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1307449_predicted	similar to RIKEN cDNA 4930429M06Rik (predicted)	LOC316687_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC316687_predicted	similar to RIKEN cDNA 4930429M06Rik (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD