Symbol:
Abcd4
Name:
ATP binding cassette subfamily D member 4
RGD ID:
1307273
Description:
Predicted to enable ABC-type vitamin B12 transporter activity and identical protein binding activity. Predicted to be involved in cobalamin metabolic process and cobalamin transport. Predicted to act upstream of or within cellular response to leukemia inhibitory factor. Predicted to be located in endoplasmic reticulum membrane and peroxisome. Predicted to be active in lysosomal membrane. Orthologous to human ABCD4 (ATP binding cassette subfamily D member 4); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
ATP-binding cassette sub-family D member 4; ATP-binding cassette, sub-family D (ALD), member 4; ATP-binding cassette, sub-family D, member 4; ATP-binding cassette, subfamily D (ALD), member 4; LOC299196; lysosomal cobalamin transporter ABCD4; MGC105956; Pxmp1l
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ABCD4 (ATP binding cassette subfamily D member 4) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Abcd4 (ATP-binding cassette, sub-family D member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Abcd4 (ATP binding cassette subfamily D member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ABCD4 (ATP binding cassette subfamily D member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ABCD4 (ATP binding cassette subfamily D member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Abcd4 (ATP binding cassette subfamily D member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ABCD4 (ATP binding cassette subfamily D member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ABCD4 (ATP binding cassette subfamily D member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Abcd4 (ATP binding cassette subfamily D member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
ABCD4 (ATP binding cassette subfamily D member 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Abcd4 (ATP-binding cassette, sub-family D member 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
abcd4 (ATP-binding cassette, sub-family D (ALD), member 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pmp-3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pmp-5
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
abcd4
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 109,977,541 - 109,992,050 (-) NCBI GRCr8 mRatBN7.2 6 104,246,459 - 104,260,965 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 104,246,468 - 104,280,276 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 104,415,118 - 104,429,485 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 104,714,203 - 104,728,570 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 104,083,790 - 104,098,157 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 108,315,026 - 108,329,550 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 108,315,035 - 108,329,464 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 117,216,141 - 117,231,218 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 108,667,269 - 108,681,707 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 108,670,724 - 108,679,543 (-) NCBI Celera 6 102,074,425 - 102,088,878 (-) NCBI Celera Cytogenetic Map 6 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Abcd4 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of ABCD4 mRNA] CTD PMID:31150632 Abcd4 Rat 1,2-dimethylhydrazine increases expression ISO Abcd4 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ABCD4 mRNA CTD PMID:22206623 Abcd4 Rat 1,2-dimethylhydrazine multiple interactions ISO Abcd4 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of ABCD4 mRNA] CTD PMID:22206623 Abcd4 Rat 17beta-estradiol decreases expression ISO Abcd4 (Mus musculus) 6480464 Estradiol results in decreased expression of ABCD4 mRNA CTD PMID:39298647 Abcd4 Rat 17beta-estradiol decreases expression ISO ABCD4 (Homo sapiens) 6480464 Estradiol results in decreased expression of ABCD4 mRNA CTD PMID:31614463 Abcd4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Abcd4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ABCD4 mRNA CTD PMID:19770486 Abcd4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ABCD4 mRNA CTD PMID:33387578 Abcd4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Abcd4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ABCD4 mRNA CTD PMID:21570461 Abcd4 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Abcd4 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Abcd4 (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Abcd4 Rat 4,4'-sulfonyldiphenol decreases expression ISO Abcd4 (Mus musculus) 6480464 bisphenol S results in decreased expression of ABCD4 mRNA CTD PMID:39298647 Abcd4 Rat 4,4'-sulfonyldiphenol decreases methylation ISO ABCD4 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of ABCD4 gene CTD PMID:31601247 Abcd4 Rat aflatoxin B1 increases expression ISO Abcd4 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of ABCD4 mRNA CTD PMID:19770486 Abcd4 Rat amiodarone increases expression ISO Abcd4 (Mus musculus) 6480464 Amiodarone results in increased expression of ABCD4 mRNA CTD PMID:24489787 Abcd4 Rat aristolochic acid A increases expression ISO ABCD4 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of ABCD4 mRNA CTD PMID:33212167 Abcd4 Rat arsane multiple interactions ISO ABCD4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ABCD4 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ABCD4 mRNA CTD PMID:39836092 Abcd4 Rat arsenic atom multiple interactions ISO ABCD4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ABCD4 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ABCD4 mRNA CTD PMID:39836092 Abcd4 Rat beta-lapachone decreases expression ISO ABCD4 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of ABCD4 mRNA CTD PMID:38218311 Abcd4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ABCD4 mRNA CTD PMID:25181051 and PMID:30816183 Abcd4 Rat bisphenol A affects splicing ISO Abcd4 (Mus musculus) 6480464 bisphenol A affects the splicing of ABCD4 mRNA CTD PMID:37894381 Abcd4 Rat cadmium dichloride decreases expression ISO ABCD4 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of ABCD4 mRNA CTD PMID:38568856 Abcd4 Rat carbon nanotube increases expression ISO Abcd4 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Abcd4 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of ABCD4 mRNA CTD PMID:20187946 Abcd4 Rat cyanocob(III)alamin affects metabolic processing ISO ABCD4 (Homo sapiens) 6480464 ABCD4 protein affects the metabolism of Vitamin B 12 CTD PMID:22922874 Abcd4 Rat cyclosporin A decreases expression ISO ABCD4 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ABCD4 mRNA CTD PMID:25562108 Abcd4 Rat ethanol increases expression ISO Abcd4 (Mus musculus) 6480464 Ethanol results in increased expression of ABCD4 mRNA CTD PMID:30319688 Abcd4 Rat folic acid multiple interactions ISO Abcd4 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of ABCD4 mRNA] CTD PMID:22206623 Abcd4 Rat lead diacetate decreases expression ISO ABCD4 (Homo sapiens) 6480464 lead acetate results in decreased expression of ABCD4 mRNA CTD PMID:38568856 Abcd4 Rat leflunomide decreases expression ISO ABCD4 (Homo sapiens) 6480464 leflunomide results in decreased expression of ABCD4 mRNA CTD PMID:28988120 Abcd4 Rat manganese atom multiple interactions ISO ABCD4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ABCD4 mRNA CTD PMID:39836092 Abcd4 Rat manganese(0) multiple interactions ISO ABCD4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ABCD4 mRNA CTD PMID:39836092 Abcd4 Rat manganese(II) chloride multiple interactions ISO ABCD4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ABCD4 mRNA CTD PMID:39836092 Abcd4 Rat menadione decreases expression ISO Abcd4 (Mus musculus) 6480464 Vitamin K 3 results in decreased expression of ABCD4 mRNA CTD PMID:25270620 Abcd4 Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of ABCD4 mRNA CTD PMID:19564919 Abcd4 Rat methamphetamine multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in decreased expression of ABCD4 mRNA CTD PMID:19564919 Abcd4 Rat methyl methanesulfonate increases expression ISO ABCD4 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of ABCD4 mRNA CTD PMID:23649840 Abcd4 Rat pregnenolone 16alpha-carbonitrile increases expression ISO Abcd4 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of ABCD4 mRNA CTD PMID:28903501 Abcd4 Rat SCH 23390 multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in decreased expression of ABCD4 mRNA CTD PMID:19564919 Abcd4 Rat sodium arsenite multiple interactions ISO ABCD4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ABCD4 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ABCD4 mRNA CTD PMID:39836092 Abcd4 Rat sunitinib increases expression ISO ABCD4 (Homo sapiens) 6480464 Sunitinib results in increased expression of ABCD4 mRNA CTD PMID:31533062 Abcd4 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of ABCD4 mRNA CTD PMID:31150632 Abcd4 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of ABCD4 mRNA] CTD PMID:31150632 Abcd4 Rat valproic acid decreases expression ISO ABCD4 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ABCD4 mRNA CTD PMID:23179753 and PMID:29154799 Abcd4 Rat vancomycin increases expression ISO Abcd4 (Mus musculus) 6480464 Vancomycin results in increased expression of ABCD4 mRNA CTD PMID:18930951 Abcd4 Rat vinclozolin decreases methylation EXP 6480464 vinclozolin results in decreased methylation of ABCD4 gene CTD PMID:31682807
(+)-schisandrin B (EXP) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',4,4'-tetrachlorobiphenyl (ISO) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (ISO) amiodarone (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) cadmium dichloride (ISO) carbon nanotube (ISO) cocaine (EXP) cyanocob(III)alamin (ISO) cyclosporin A (ISO) ethanol (ISO) folic acid (ISO) lead diacetate (ISO) leflunomide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) menadione (ISO) methamphetamine (EXP) methyl methanesulfonate (ISO) pregnenolone 16alpha-carbonitrile (ISO) SCH 23390 (EXP) sodium arsenite (ISO) sunitinib (ISO) tetrachloromethane (EXP) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP)
Abcd4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 109,977,541 - 109,992,050 (-) NCBI GRCr8 mRatBN7.2 6 104,246,459 - 104,260,965 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 104,246,468 - 104,280,276 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 104,415,118 - 104,429,485 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 104,714,203 - 104,728,570 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 104,083,790 - 104,098,157 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 108,315,026 - 108,329,550 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 108,315,035 - 108,329,464 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 117,216,141 - 117,231,218 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 108,667,269 - 108,681,707 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 108,670,724 - 108,679,543 (-) NCBI Celera 6 102,074,425 - 102,088,878 (-) NCBI Celera Cytogenetic Map 6 q31 NCBI
ABCD4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 74,285,269 - 74,302,934 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 74,285,269 - 74,303,055 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 74,751,972 - 74,769,637 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 73,821,733 - 73,839,512 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 73,821,880 - 73,839,420 NCBI Celera 14 54,789,295 - 54,807,078 (-) NCBI Celera Cytogenetic Map 14 q24.3 NCBI HuRef 14 54,918,955 - 54,936,736 (-) NCBI HuRef CHM1_1 14 74,691,509 - 74,709,296 (-) NCBI CHM1_1 T2T-CHM13v2.0 14 68,493,125 - 68,510,780 (-) NCBI T2T-CHM13v2.0
Abcd4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 84,648,634 - 84,664,259 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 84,648,238 - 84,664,187 (-) Ensembl GRCm39 Ensembl GRCm38 12 84,601,869 - 84,617,485 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 84,601,464 - 84,617,413 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 85,943,481 - 85,958,416 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 85,492,401 - 85,507,118 (-) NCBI MGSCv36 mm8 Celera 12 86,058,137 - 86,073,075 (-) NCBI Celera Cytogenetic Map 12 D1 NCBI cM Map 12 39.3 NCBI
Abcd4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955523 1,170,303 - 1,182,467 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955523 1,170,306 - 1,181,352 (+) NCBI ChiLan1.0 ChiLan1.0
ABCD4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 75,364,069 - 75,381,181 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 74,580,573 - 74,597,671 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 54,833,388 - 54,850,482 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 73,684,109 - 73,701,344 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 73,684,109 - 73,701,344 (-) Ensembl panpan1.1 panPan2
ABCD4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 47,488,414 - 47,507,041 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 47,488,475 - 47,504,654 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 47,173,373 - 47,191,986 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 47,715,766 - 47,732,070 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 8 47,384,860 - 47,403,479 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 47,406,500 - 47,425,091 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 47,793,455 - 47,812,081 (-) NCBI UU_Cfam_GSD_1.0
Abcd4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 28,530,121 - 28,544,921 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936488 3,523,344 - 3,538,858 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936488 3,526,875 - 3,538,851 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ABCD4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 97,568,208 - 97,585,655 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 97,568,193 - 97,585,693 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 103,411,768 - 103,428,256 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ABCD4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 51,497,440 - 51,516,919 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 51,495,790 - 51,516,905 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 39,731,077 - 39,751,694 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Abcd4
.
Predicted Target Of
Count of predictions: 286 Count of miRNA genes: 181 Interacting mature miRNAs: 199 Transcripts: ENSRNOT00000016040 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12801411 Schws8 Schwannoma susceptibility QTL 8 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 94968928 139968928 Rat 1331797 Bp213 Blood pressure QTL 213 3.291 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 104085867 128713626 Rat 1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 1358355 Srcrt4 Stress Responsive Cort QTL 4 6.39 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 100364669 140994061 Rat 2313399 Anxrr28 Anxiety related response QTL 28 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 6 100671796 132340886 Rat 1331789 Rf37 Renal function QTL 37 3.224 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 6 72202632 115200186 Rat 1331725 Bp212 Blood pressure QTL 212 3.52475 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 93701310 128713626 Rat 1331722 Thshl1 Thyroid stimulating hormone level QTL 1 11.7 0.0001 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 6 89762877 106752806 Rat 8552796 Vie3 Viral induced encephalitis QTL 3 2.6 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 6 96833997 140994061 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 61414 Pia3 Pristane induced arthritis QTL 3 4.5 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 6 94968928 137848904 Rat 724524 Uae2 Urinary albumin excretion QTL 2 2.7 0.0005 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 73463459 109394713 Rat 737827 Hcar11 Hepatocarcinoma resistance QTL 11 4.4 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 6 82523650 110548006 Rat 1641904 Alcrsp4 Alcohol response QTL 4 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 6 67262953 112262953 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 2293837 Kiddil1 Kidney dilation QTL 1 3.7 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 2293842 Kiddil3 Kidney dilation QTL 3 4.3 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 70196 BpQTLcluster7 Blood pressure QTL cluster 7 6.82 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 72202632 117202632 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 1576302 Schws4 Schwannoma susceptibility QTL 4 0.0078 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 83190345 106747639 Rat 1300075 Glom7 Glomerulus QTL 7 5.6 0.0000002 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 6 71201409 116201409 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 12801471 Schws9 Schwannoma susceptibility QTL 9 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 61747639 106747639 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat
ABCD4
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 104,252,008 - 104,252,546 (+) MAPPER mRatBN7.2 Rnor_6.0 6 108,320,576 - 108,321,113 NCBI Rnor6.0 Rnor_5.0 6 117,225,131 - 117,225,668 UniSTS Rnor5.0 RGSC_v3.4 6 108,672,819 - 108,673,356 UniSTS RGSC3.4 Celera 6 102,079,975 - 102,080,512 UniSTS Cytogenetic Map 6 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000016040 ⟹ ENSRNOP00000016040
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 104,246,468 - 104,280,276 (-) Ensembl Rnor_6.0 Ensembl 6 108,315,035 - 108,329,464 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000099159 ⟹ ENSRNOP00000077444
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 104,246,468 - 104,252,838 (-) Ensembl
RefSeq Acc Id:
NM_001013100 ⟹ NP_001013118
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 109,977,541 - 109,991,983 (-) NCBI mRatBN7.2 6 104,246,459 - 104,260,898 (-) NCBI Rnor_6.0 6 108,315,026 - 108,329,464 (-) NCBI Rnor_5.0 6 117,216,141 - 117,231,218 (+) NCBI RGSC_v3.4 6 108,667,269 - 108,681,707 (-) RGD Celera 6 102,074,425 - 102,088,878 (-) RGD
Sequence:
CGGGGAGGACACCGGGCTTTCTCGGTTGTCTTGTTGCTCACATCCCAGGTCATGGCGGTCCCGGGACCCACGGCCCGAGCTAGTGCCAGGCCCAGATTAGATCTGCAACTTGTCCAGAAGTTCATAAG
hide sequence
RefSeq Acc Id:
XM_039112036 ⟹ XP_038967964
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 109,982,798 - 109,992,050 (-) NCBI mRatBN7.2 6 104,251,716 - 104,260,965 (-) NCBI
RefSeq Acc Id:
XM_063261737 ⟹ XP_063117807
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 109,977,541 - 109,992,050 (-) NCBI
RefSeq Acc Id:
XM_063261738 ⟹ XP_063117808
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 109,977,541 - 109,987,413 (-) NCBI
RefSeq Acc Id:
XM_063261739 ⟹ XP_063117809
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 109,977,541 - 109,986,969 (-) NCBI
RefSeq Acc Id:
XR_005505483
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 109,978,273 - 109,992,050 (-) NCBI mRatBN7.2 6 104,247,242 - 104,260,965 (-) NCBI
RefSeq Acc Id:
XR_005505485
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 109,978,965 - 109,992,050 (-) NCBI mRatBN7.2 6 104,247,878 - 104,260,965 (-) NCBI
RefSeq Acc Id:
XR_005505486
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 109,978,942 - 109,992,050 (-) NCBI mRatBN7.2 6 104,247,841 - 104,260,965 (-) NCBI
RefSeq Acc Id:
XR_010052070
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 109,978,273 - 109,992,050 (-) NCBI
RefSeq Acc Id:
NP_001013118 ⟸ NM_001013100
- UniProtKB:
A6JDX5 (UniProtKB/TrEMBL)
- Sequence:
MAVPGPTARASARPRLDLQLVQKFIRIQKVFFPSWSSQNVLMFMTLLCVALLEQLVIYQVGLIPSQYYGVLGNKDLDGFKALTFLAVALIVLNSTLKSFDQFTCNLLYVSWRKDLTEHLHQLYFRARV
hide sequence
Ensembl Acc Id:
ENSRNOP00000016040 ⟸ ENSRNOT00000016040
RefSeq Acc Id:
XP_038967964 ⟸ XM_039112036
- Peptide Label:
isoform X4
Ensembl Acc Id:
ENSRNOP00000077444 ⟸ ENSRNOT00000099159
RefSeq Acc Id:
XP_063117807 ⟸ XM_063261737
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063117808 ⟸ XM_063261738
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063117809 ⟸ XM_063261739
- Peptide Label:
isoform X3
RGD ID: 13694729 Promoter ID: EPDNEW_R5253 Type: initiation region Name: Abcd4_1 Description: ATP binding cassette subfamily D member 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 108,329,476 - 108,329,536 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-09
Abcd4
ATP binding cassette subfamily D member 4
Abcd4
ATP-binding cassette, subfamily D (ALD), member 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-11-16
Abcd4
ATP-binding cassette, subfamily D (ALD), member 4
Abcd4
ATP-binding cassette, sub-family D (ALD), member 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Abcd4
ATP-binding cassette, sub-family D (ALD), member 4
Abcd4_predicted
ATP-binding cassette, sub-family D (ALD), member 4 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Abcd4_predicted
ATP-binding cassette, sub-family D (ALD), member 4 (predicted)
Symbol and Name status set to approved
70820 APPROVED
