Symbol:
Mrps35
Name:
mitochondrial ribosomal protein S35
RGD ID:
1306720
Description:
Predicted to be a structural constituent of ribosome. Predicted to be involved in mitochondrial translation. Predicted to be located in cytosol and mitochondrion. Predicted to be part of mitochondrial small ribosomal subunit. Orthologous to human MRPS35 (mitochondrial ribosomal protein S35); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
28S ribosomal protein S35, mitochondrial; LOC297727; small ribosomal subunit protein mS35
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MRPS35 (mitochondrial ribosomal protein S35) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Mrps35 (mitochondrial ribosomal protein S35) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Mrps35 (mitochondrial ribosomal protein S35) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MRPS35 (mitochondrial ribosomal protein S35) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MRPS35 (mitochondrial ribosomal protein S35) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mrps35 (mitochondrial ribosomal protein S35) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MRPS35 (mitochondrial ribosomal protein S35) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MRPS35 (mitochondrial ribosomal protein S35) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Mrps35 (mitochondrial ribosomal protein S35) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
OR13G1 (olfactory receptor family 13 subfamily G member 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
MRPS35 (mitochondrial ribosomal protein S35)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Mrps35 (mitochondrial ribosomal protein S35)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mrps35 (mitochondrial ribosomal protein S35)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
mrps-35
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RSM24
Alliance
DIOPT (Ensembl Compara|PANTHER)
Drosophila melanogaster (fruit fly):
mRpS35
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
mrps35
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 181,688,715 - 181,719,403 (+) NCBI GRCr8 mRatBN7.2 4 179,958,067 - 179,988,752 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 179,958,083 - 179,987,710 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 186,242,484 - 186,273,380 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 182,026,991 - 182,057,885 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 180,647,436 - 180,678,335 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 181,434,793 - 181,465,318 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 181,434,812 - 181,465,318 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 245,584,679 - 245,615,196 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 184,642,428 - 184,673,097 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 184,887,582 - 184,917,056 (+) NCBI Celera 4 168,451,594 - 168,482,258 (+) NCBI Celera Cytogenetic Map 4 q44 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mrps35 Rat (1->4)-beta-D-glucan multiple interactions ISO Mrps35 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of MRPS35 mRNA CTD PMID:36331819 Mrps35 Rat 1,2-dimethylhydrazine multiple interactions ISO Mrps35 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of MRPS35 mRNA] CTD PMID:22206623 Mrps35 Rat 1,2-dimethylhydrazine increases expression ISO Mrps35 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of MRPS35 mRNA CTD PMID:22206623 Mrps35 Rat 17alpha-ethynylestradiol increases expression ISO Mrps35 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of MRPS35 mRNA CTD PMID:17942748 Mrps35 Rat 17alpha-ethynylestradiol multiple interactions ISO Mrps35 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MRPS35 mRNA CTD PMID:17942748 Mrps35 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Mrps35 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MRPS35 mRNA CTD PMID:17942748 Mrps35 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MRPS35 mRNA CTD PMID:33387578 Mrps35 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mrps35 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MRPS35 mRNA CTD PMID:21570461 Mrps35 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MRPS35 mRNA CTD PMID:21215274 and PMID:32109520 Mrps35 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Mrps35 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of MRPS35 mRNA CTD PMID:18648102 Mrps35 Rat 4,4'-sulfonyldiphenol increases expression ISO Mrps35 (Mus musculus) 6480464 bisphenol S results in increased expression of MRPS35 mRNA CTD PMID:39298647 Mrps35 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of MRPS35 mRNA CTD PMID:36041667 Mrps35 Rat 4,4'-sulfonyldiphenol increases methylation ISO MRPS35 (Homo sapiens) 6480464 bisphenol S results in increased methylation of MRPS35 gene CTD PMID:31601247 Mrps35 Rat aflatoxin B1 decreases methylation ISO MRPS35 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of MRPS35 intron CTD PMID:30157460 Mrps35 Rat Aflatoxin B2 alpha decreases methylation ISO MRPS35 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of MRPS35 intron CTD PMID:30157460 Mrps35 Rat aristolochic acid A decreases expression ISO MRPS35 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of MRPS35 protein CTD PMID:33212167 Mrps35 Rat arsane multiple interactions ISO MRPS35 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MRPS35 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MRPS35 mRNA CTD PMID:39836092 Mrps35 Rat arsenic atom multiple interactions ISO MRPS35 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MRPS35 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MRPS35 mRNA CTD PMID:39836092 Mrps35 Rat arsenite(3-) multiple interactions ISO MRPS35 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to MRPS35 mRNA] CTD PMID:32406909 Mrps35 Rat atrazine decreases expression ISO MRPS35 (Homo sapiens) 6480464 Atrazine results in decreased expression of MRPS35 mRNA CTD PMID:22378314 Mrps35 Rat benzo[a]pyrene affects methylation ISO MRPS35 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of MRPS35 intron CTD PMID:30157460 Mrps35 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MRPS35 mRNA CTD PMID:25181051 Mrps35 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of MRPS35 mRNA CTD PMID:36041667 Mrps35 Rat bisphenol A decreases expression ISO MRPS35 (Homo sapiens) 6480464 bisphenol A results in decreased expression of MRPS35 mRNA CTD PMID:29275510 Mrps35 Rat bisphenol AF increases expression ISO MRPS35 (Homo sapiens) 6480464 bisphenol AF results in increased expression of MRPS35 protein CTD PMID:34186270 Mrps35 Rat Bisphenol B increases expression ISO MRPS35 (Homo sapiens) 6480464 bisphenol B results in increased expression of MRPS35 protein CTD PMID:34186270 Mrps35 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of MRPS35 mRNA CTD PMID:36041667 Mrps35 Rat cadmium dichloride decreases expression ISO MRPS35 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of MRPS35 mRNA CTD PMID:38568856 Mrps35 Rat cyclosporin A increases expression ISO MRPS35 (Homo sapiens) 6480464 Cyclosporine results in increased expression of MRPS35 mRNA CTD PMID:25562108 Mrps35 Rat Dibutyl phosphate affects expression ISO MRPS35 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MRPS35 mRNA CTD PMID:37042841 Mrps35 Rat dibutyl phthalate decreases expression ISO Mrps35 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of MRPS35 mRNA CTD PMID:21266533 Mrps35 Rat doxorubicin increases expression ISO MRPS35 (Homo sapiens) 6480464 Doxorubicin results in increased expression of MRPS35 mRNA CTD PMID:29803840 Mrps35 Rat enzyme inhibitor multiple interactions ISO MRPS35 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of MRPS35 protein CTD PMID:23301498 Mrps35 Rat fenthion increases expression ISO Mrps35 (Mus musculus) 6480464 Fenthion results in increased expression of MRPS35 mRNA CTD PMID:34813904 Mrps35 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of MRPS35 mRNA CTD PMID:24136188 Mrps35 Rat folic acid multiple interactions ISO Mrps35 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of MRPS35 mRNA] CTD PMID:22206623 Mrps35 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of MRPS35 mRNA CTD PMID:33387578 Mrps35 Rat glyphosate affects methylation EXP 6480464 Glyphosate affects the methylation of MRPS35 gene CTD PMID:35440735 Mrps35 Rat hydrogen peroxide affects expression ISO MRPS35 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of MRPS35 mRNA CTD PMID:20044591 Mrps35 Rat ivermectin decreases expression ISO MRPS35 (Homo sapiens) 6480464 Ivermectin results in decreased expression of MRPS35 protein CTD PMID:32959892 Mrps35 Rat lipopolysaccharide multiple interactions ISO MRPS35 (Homo sapiens) 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of MRPS35 mRNA CTD PMID:31059760 Mrps35 Rat manganese atom multiple interactions ISO MRPS35 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MRPS35 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of MRPS35 mRNA CTD PMID:39836092 Mrps35 Rat manganese(0) multiple interactions ISO MRPS35 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MRPS35 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of MRPS35 mRNA CTD PMID:39836092 Mrps35 Rat manganese(II) chloride multiple interactions ISO MRPS35 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MRPS35 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of MRPS35 mRNA CTD PMID:39836092 Mrps35 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of MRPS35 mRNA CTD PMID:24136188 Mrps35 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of MRPS35 mRNA CTD PMID:25729387 Mrps35 Rat ozone multiple interactions ISO Mrps35 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of MRPS35 mRNA CTD PMID:34911549 Mrps35 Rat paracetamol affects expression ISO Mrps35 (Mus musculus) 6480464 Acetaminophen affects the expression of MRPS35 mRNA CTD PMID:17562736 Mrps35 Rat paracetamol multiple interactions ISO MRPS35 (Homo sapiens) 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of MRPS35 mRNA CTD PMID:31059760 Mrps35 Rat paracetamol decreases expression ISO MRPS35 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of MRPS35 mRNA CTD PMID:25704631 and PMID:29067470 Mrps35 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Mrps35 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of MRPS35 mRNA CTD PMID:36331819 Mrps35 Rat sodium arsenite multiple interactions ISO MRPS35 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MRPS35 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MRPS35 mRNA CTD PMID:39836092 Mrps35 Rat sunitinib increases expression ISO MRPS35 (Homo sapiens) 6480464 Sunitinib results in increased expression of MRPS35 mRNA CTD PMID:31533062 Mrps35 Rat testosterone decreases expression ISO MRPS35 (Homo sapiens) 6480464 Testosterone results in decreased expression of MRPS35 mRNA CTD PMID:33359661 Mrps35 Rat tetrachloromethane decreases expression ISO Mrps35 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of MRPS35 mRNA CTD PMID:31919559 Mrps35 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of MRPS35 mRNA CTD PMID:34492290 Mrps35 Rat titanium dioxide decreases methylation ISO Mrps35 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of MRPS35 promoter CTD PMID:35295148 Mrps35 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of MRPS35 mRNA CTD PMID:25729387 Mrps35 Rat triphenyl phosphate affects expression ISO MRPS35 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MRPS35 mRNA CTD PMID:37042841 Mrps35 Rat triptonide decreases expression ISO Mrps35 (Mus musculus) 6480464 triptonide results in decreased expression of MRPS35 mRNA CTD PMID:33045310 Mrps35 Rat valproic acid affects expression ISO MRPS35 (Homo sapiens) 6480464 Valproic Acid affects the expression of MRPS35 mRNA CTD PMID:25979313
Mrps35 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 181,688,715 - 181,719,403 (+) NCBI GRCr8 mRatBN7.2 4 179,958,067 - 179,988,752 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 179,958,083 - 179,987,710 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 186,242,484 - 186,273,380 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 182,026,991 - 182,057,885 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 180,647,436 - 180,678,335 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 181,434,793 - 181,465,318 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 181,434,812 - 181,465,318 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 245,584,679 - 245,615,196 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 184,642,428 - 184,673,097 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 184,887,582 - 184,917,056 (+) NCBI Celera 4 168,451,594 - 168,482,258 (+) NCBI Celera Cytogenetic Map 4 q44 NCBI
MRPS35 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 27,710,832 - 27,756,295 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 27,710,822 - 27,756,295 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 27,863,765 - 27,909,228 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 27,754,996 - 27,800,495 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 27,754,995 - 27,800,494 NCBI Celera 12 33,009,297 - 33,054,807 (+) NCBI Celera Cytogenetic Map 12 p11.22 NCBI HuRef 12 27,632,567 - 27,678,311 (+) NCBI HuRef CHM1_1 12 27,828,692 - 27,874,201 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 27,582,568 - 27,628,010 (+) NCBI T2T-CHM13v2.0
Mrps35 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 146,944,270 - 146,972,399 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 146,944,262 - 146,975,489 (+) Ensembl GRCm39 Ensembl GRCm38 6 147,042,728 - 147,070,906 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 147,042,764 - 147,073,991 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 146,991,292 - 147,019,424 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 146,999,974 - 147,028,071 (+) NCBI MGSCv36 mm8 Celera 6 150,078,704 - 150,106,864 (+) NCBI Celera Cytogenetic Map 6 G3 NCBI cM Map 6 77.7 NCBI
Mrps35 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955505 7,139,870 - 7,181,201 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955505 7,139,870 - 7,181,201 (-) NCBI ChiLan1.0 ChiLan1.0
MRPS35 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 69,058,123 - 69,104,222 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 69,054,522 - 69,099,668 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 58,555,661 - 58,600,799 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 61,175,326 - 61,219,680 (-) NCBI panpan1.1 PanPan1.1 panPan2
MRPS35 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 19,984,220 - 20,025,734 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 19,984,309 - 20,025,734 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 26,374,570 - 26,415,986 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 20,177,752 - 20,219,604 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 20,172,019 - 20,219,599 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 19,984,550 - 20,026,238 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 20,011,245 - 20,052,931 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 26,531,536 - 26,573,313 (+) NCBI UU_Cfam_GSD_1.0
Mrps35
MRPS35 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 45,973,693 - 46,030,453 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 45,973,698 - 46,023,003 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 49,541,791 - 49,591,091 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MRPS35 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 27,432,804 - 27,476,443 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 27,432,871 - 27,476,627 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666069 7,575,534 - 7,619,128 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mrps35
.
Predicted Target Of
Count of predictions: 142 Count of miRNA genes: 112 Interacting mature miRNAs: 123 Transcripts: ENSRNOT00000002520 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
6478754 Anxrr43 Anxiety related response QTL 43 0.14035 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 146370897 184426481 Rat 6478720 Alc23 Alcohol consumption QTL 23 0.00509 drinking behavior trait (VT:0001422) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 155834926 184426481 Rat 6478785 Anxrr53 Anxiety related response QTL 53 0.01397 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 155834926 184426481 Rat 1581566 Eae21 Experimental allergic encephalomyelitis QTL 21 6.2 body mass (VT:0001259) maximum body weight loss to initial body weight ratio (CMO:0001400) 4 137447185 182447185 Rat 6478693 Anxrr32 Anxiety related response QTL 32 0.00092 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 146370897 184426481 Rat 6478757 Anxrr44 Anxiety related response QTL 44 0.01087 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 155834926 184426481 Rat 1578674 Bmd12 Bone mineral density QTL 12 3.8 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 4 137430611 182430611 Rat 6478728 Anxrr36 Anxiety related response QTL 36 0.01061 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 155834926 184426481 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 60916264 184426481 Rat 6478700 Anxrr33 Anxiety related response QTL 33 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 146370897 184426481 Rat 1298524 Oia8 Oil induced arthritis QTL 8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 140059299 184426481 Rat 6478733 Anxrr37 Anxiety related response QTL 37 0.00095 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 155834926 184426481 Rat 10053718 Scort25 Serum corticosterone level QTL 25 2.15 0.0097 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 157292416 184426481 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 60916264 184426481 Rat 61362 Oia2 Oil induced arthritis QTL 2 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 140059299 184426481 Rat 6478737 Anxrr38 Anxiety related response QTL 38 0.00159 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 155834926 184426481 Rat 2293659 Bmd35 Bone mineral density QTL 35 4.5 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 4 160623982 184426481 Rat 10401796 Kidm48 Kidney mass QTL 48 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 147299608 184426481 Rat 6478718 Anxrr34 Anxiety related response QTL 34 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 146370897 184426481 Rat 6478782 Anxrr52 Anxiety related response QTL 52 0.02091 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 155834926 184426481 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 12212457 182430611 Rat 6478748 Anxrr42 Anxiety related response QTL 42 0.28008 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 146370897 184426481 Rat 1300109 Rf13 Renal function QTL 13 3.91 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 4 176806581 181925369 Rat
RH129064
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 179,987,269 - 179,987,487 (+) MAPPER mRatBN7.2 Rnor_6.0 4 181,463,837 - 181,464,054 NCBI Rnor6.0 Rnor_5.0 4 245,613,715 - 245,613,932 UniSTS Rnor5.0 RGSC_v3.4 4 184,671,616 - 184,671,833 UniSTS RGSC3.4 Celera 4 168,480,788 - 168,481,005 UniSTS RH 3.4 Map 4 1090.1 UniSTS Cytogenetic Map 4 q44 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000002520 ⟹ ENSRNOP00000002520
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 179,958,083 - 179,987,710 (+) Ensembl Rnor_6.0 Ensembl 4 181,434,812 - 181,465,318 (+) Ensembl
RefSeq Acc Id:
NM_001106628 ⟹ NP_001100098
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 181,688,736 - 181,719,403 (+) NCBI mRatBN7.2 4 179,958,083 - 179,988,752 (+) NCBI Rnor_6.0 4 181,434,812 - 181,465,318 (+) NCBI Rnor_5.0 4 245,584,679 - 245,615,196 (+) NCBI RGSC_v3.4 4 184,642,428 - 184,673,097 (+) RGD Celera 4 168,451,594 - 168,482,258 (+) RGD
Sequence:
GCTTGTCCGTTCTGGCTCGCCGTCCTTCAGCATGGCTGCCGCTTCGCTGCAGCTAAGGCTGACCCTATACCCGGGAGCGCGCGGCCTGCGCACCTTCTCCTCAGTCGCCAGGCCCGCGGCTCCAAGAG
hide sequence
RefSeq Acc Id:
XM_006237676 ⟹ XP_006237738
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 181,688,715 - 181,718,175 (+) NCBI mRatBN7.2 4 179,958,068 - 179,987,522 (+) NCBI Rnor_6.0 4 181,434,794 - 181,464,089 (+) NCBI Rnor_5.0 4 245,584,679 - 245,615,196 (+) NCBI
Sequence:
CCGCCCCGCCCCCTCAGCGCTTGTCCGTTCTGGCTCGCCGTCCTTCAGCATGGCTGCCGCTTCG
hide sequence
RefSeq Acc Id:
XM_006237677 ⟹ XP_006237739
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 181,688,720 - 181,718,175 (+) NCBI mRatBN7.2 4 179,958,067 - 179,987,522 (+) NCBI Rnor_6.0 4 181,434,793 - 181,464,089 (+) NCBI Rnor_5.0 4 245,584,679 - 245,615,196 (+) NCBI
Sequence:
CCCGCCCCGCCCCCTCAGCGCTTGTCCGTTCTGGCTCGCCGTCCTTCAGCATGGCTGCCGCTTC
hide sequence
RefSeq Acc Id:
XM_017592600 ⟹ XP_017448089
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 181,688,735 - 181,718,175 (+) NCBI mRatBN7.2 4 179,958,082 - 179,987,522 (+) NCBI Rnor_6.0 4 181,434,863 - 181,464,089 (+) NCBI
Sequence:
GCTAAGGCTGACCCTATACCCGGGAGCGCGCGGCCTGCGCACCTTCTCCTCAGTCGCCAGGCCC
hide sequence
RefSeq Acc Id:
XM_039107482 ⟹ XP_038963410
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 181,688,715 - 181,718,175 (+) NCBI mRatBN7.2 4 179,958,093 - 179,987,522 (+) NCBI
RefSeq Acc Id:
XM_039107483 ⟹ XP_038963411
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 181,688,720 - 181,718,041 (+) NCBI mRatBN7.2 4 179,958,067 - 179,987,522 (+) NCBI
RefSeq Acc Id:
XM_063285920 ⟹ XP_063141990
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 181,688,720 - 181,718,175 (+) NCBI
RefSeq Acc Id:
XM_063285921 ⟹ XP_063141991
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 181,688,720 - 181,718,175 (+) NCBI
RefSeq Acc Id:
NP_001100098 ⟸ NM_001106628
- UniProtKB:
D4A9Z6 (UniProtKB/TrEMBL), A6IN39 (UniProtKB/TrEMBL)
- Sequence:
MAAASLQLRLTLYPGARGLRTFSSVARPAAPRAGPRTVSRGERPMRRKALPPRTEKMETDQDWPSVYPTAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNVELLKIPNFLHLTPVAIKRHCGALKDFCT
hide sequence
RefSeq Acc Id:
XP_006237739 ⟸ XM_006237677
- Peptide Label:
isoform X3
- Sequence:
MAAASLQLRLTLYPGARGLRTFSSVARPAAPRAGPRTVSRGERPMRRKALPPRTEKMETDQDWP
hide sequence
RefSeq Acc Id:
XP_006237738 ⟸ XM_006237676
- Peptide Label:
isoform X1
- Sequence:
MAAASLQLRLTLYPGARGLRTFSSVARPAAPRAGPLSRGERPMRRKALPPRTEKMETDQDWPSVYPTAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNVELLKIPNFLHLTPVAIKRHCGALKDFCTEW
hide sequence
RefSeq Acc Id:
XP_017448089 ⟸ XM_017592600
- Peptide Label:
isoform X2
- Sequence:
METDQDWPSVYPTAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNVELLKIPNFLHLTPVAIKRHC
hide sequence
Ensembl Acc Id:
ENSRNOP00000002520 ⟸ ENSRNOT00000002520
RefSeq Acc Id:
XP_038963411 ⟸ XM_039107483
- Peptide Label:
isoform X7
RefSeq Acc Id:
XP_038963410 ⟸ XM_039107482
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063141991 ⟸ XM_063285921
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_063141990 ⟸ XM_063285920
- Peptide Label:
isoform X4
RGD ID: 13693510 Promoter ID: EPDNEW_R4034 Type: multiple initiation site Name: Mrps35_1 Description: mitochondrial ribosomal protein S35 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 181,434,812 - 181,434,872 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Mrps35
mitochondrial ribosomal protein S35
Mrps35_predicted
mitochondrial ribosomal protein S35 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Mrps35_predicted
mitochondrial ribosomal protein S35 (predicted)
Symbol and Name status set to approved
70820 APPROVED
