Advanced Search (OLGA)

Gene: Gsg1 (germ cell associated 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Gsg1

Name:

germ cell associated 1

RGD ID:

1306546

Description:

Predicted to enable RNA polymerase binding activity. Predicted to be located in endoplasmic reticulum. Predicted to be active in plasma membrane. Orthologous to human GSG1 (germ cell associated 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acrylamide; amphetamine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

germ cell-specific gene 1 protein; LOC312793

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GSG1 (germ cell associated 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Gsg1 (germ cell associated 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gsg1 (germ cell associated 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GSG1 (germ cell associated 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GSG1 (germ cell associated 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gsg1 (germ cell associated 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GSG1 (germ cell associated 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GSG1 (germ cell associated 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gsg1 (germ cell associated 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	OR9Q2 (olfactory receptor family 9 subfamily Q member 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	GSG1 (germ cell associated 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gsg1 (germ cell associated 1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gsg1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	169,822,111 - 169,838,379 (-)	NCBI		GRCr8
mRatBN7.2	4	168,090,773 - 168,107,039 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	168,090,776 - 168,107,039 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	174,385,996 - 174,402,270 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	170,167,236 - 170,183,512 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	168,792,705 - 168,808,969 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	169,020,680 - 169,037,021 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	169,020,683 - 169,036,950 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	233,291,206 - 233,307,476 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	172,191,997 - 172,208,267 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	172,436,935 - 172,453,203 (-)	NCBI
Celera	4	156,689,909 - 156,706,133 (-)	NCBI		Celera
Cytogenetic Map	4	q43	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gsg1	Rat	autosomal dominant intellectual developmental disorder 6		ISO	GSG1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability and autosomal dominant 6	ClinVar	PMID:23918416 more ...

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gsg1	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Gsg1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of GSG1 mRNA	CTD	PMID:22206623
Gsg1	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	Gsg1 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GSG1 mRNA	CTD	PMID:17942748
Gsg1	Rat	17alpha-ethynylestradiol	increases expression	ISO	Gsg1 (Mus musculus)	6480464	Ethinyl Estradiol results in increased expression of GSG1 mRNA	CTD	PMID:17942748
Gsg1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Gsg1 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GSG1 mRNA	CTD	PMID:17942748
Gsg1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of GSG1 mRNA	CTD	PMID:33387578
Gsg1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Gsg1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of GSG1 mRNA	CTD	PMID:21570461
Gsg1	Rat	2-palmitoylglycerol	increases expression	ISO	GSG1 (Homo sapiens)	6480464	2-palmitoylglycerol results in increased expression of GSG1 mRNA	CTD	PMID:37199045
Gsg1	Rat	acrylamide	decreases expression	EXP		6480464	Acrylamide results in decreased expression of GSG1 mRNA	CTD	PMID:28959563
Gsg1	Rat	aflatoxin B1	decreases methylation	ISO	GSG1 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of GSG1 gene	CTD	PMID:27153756
Gsg1	Rat	aflatoxin B1	increases methylation	ISO	GSG1 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of GSG1 intron	CTD	PMID:30157460
Gsg1	Rat	amphetamine	increases expression	EXP		6480464	Amphetamine results in increased expression of GSG1 mRNA	CTD	PMID:30779732
Gsg1	Rat	benzo[a]pyrene	affects methylation	ISO	GSG1 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of GSG1 intron	CTD	PMID:30157460
Gsg1	Rat	benzo[a]pyrene diol epoxide I	increases expression	ISO	GSG1 (Homo sapiens)	6480464	7 more ...	CTD	PMID:20382639
Gsg1	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	Gsg1 (Mus musculus)	6480464	Diethylhexyl Phthalate results in decreased expression of GSG1 mRNA	CTD	PMID:33162236
Gsg1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of GSG1 mRNA	CTD	PMID:25181051 more ...
Gsg1	Rat	bisphenol A	increases methylation	ISO	Gsg1 (Mus musculus)	6480464	bisphenol A results in increased methylation of GSG1 promoter	CTD	PMID:27312807
Gsg1	Rat	butanal	increases expression	ISO	GSG1 (Homo sapiens)	6480464	butyraldehyde results in increased expression of GSG1 mRNA	CTD	PMID:26079696
Gsg1	Rat	CGP 52608	multiple interactions	ISO	GSG1 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to GSG1 gene]	CTD	PMID:28238834
Gsg1	Rat	chlorpyrifos	increases expression	ISO	Gsg1 (Mus musculus)	6480464	Chlorpyrifos results in increased expression of GSG1 mRNA	CTD	PMID:32715474
Gsg1	Rat	cisplatin	decreases expression	ISO	GSG1 (Homo sapiens)	6480464	Cisplatin results in decreased expression of GSG1 mRNA	CTD	PMID:27392435
Gsg1	Rat	clofibrate	decreases expression	ISO	Gsg1 (Mus musculus)	6480464	Clofibrate results in decreased expression of GSG1 mRNA	CTD	PMID:17585979
Gsg1	Rat	copper atom	increases expression	EXP		6480464	Copper deficiency results in increased expression of GSG1 mRNA	CTD	PMID:26033743
Gsg1	Rat	copper(0)	increases expression	EXP		6480464	Copper deficiency results in increased expression of GSG1 mRNA	CTD	PMID:26033743
Gsg1	Rat	copper(II) sulfate	increases expression	ISO	GSG1 (Homo sapiens)	6480464	Copper Sulfate results in increased expression of GSG1 mRNA	CTD	PMID:19549813
Gsg1	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of GSG1 mRNA	CTD	PMID:29391264
Gsg1	Rat	fipronil	multiple interactions	ISO	GSG1 (Homo sapiens)	6480464	[fipronil co-treated with DEET] results in decreased expression of GSG1 mRNA	CTD	PMID:27091632
Gsg1	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of GSG1 mRNA	CTD	PMID:33387578
Gsg1	Rat	lead nitrate	decreases expression	EXP		6480464	lead nitrate results in decreased expression of GSG1 mRNA	CTD	PMID:21628963
Gsg1	Rat	lidocaine	increases expression	EXP		6480464	Lidocaine results in increased expression of GSG1 mRNA	CTD	PMID:35283115
Gsg1	Rat	N,N-diethyl-m-toluamide	multiple interactions	ISO	GSG1 (Homo sapiens)	6480464	[fipronil co-treated with DEET] results in decreased expression of GSG1 mRNA	CTD	PMID:27091632
Gsg1	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of GSG1 mRNA	CTD	PMID:33387578
Gsg1	Rat	pirinixic acid	decreases expression	ISO	Gsg1 (Mus musculus)	6480464	pirinixic acid results in decreased expression of GSG1 mRNA	CTD	PMID:20813756
Gsg1	Rat	resveratrol	multiple interactions	ISO	GSG1 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of GSG1 mRNA	CTD	PMID:23557933
Gsg1	Rat	silicon dioxide	increases expression	ISO	GSG1 (Homo sapiens)	6480464	Silicon Dioxide analog results in increased expression of GSG1 mRNA	CTD	PMID:25895662
Gsg1	Rat	sodium fluoride	increases expression	ISO	Gsg1 (Mus musculus)	6480464	Sodium Fluoride results in increased expression of GSG1 mRNA	CTD	PMID:27862939
Gsg1	Rat	succimer	multiple interactions	ISO	Gsg1 (Mus musculus)	6480464	[Succimer binds to Magnetite Nanoparticles] which results in increased expression of GSG1 mRNA	CTD	PMID:21641980
Gsg1	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of GSG1 mRNA	CTD	PMID:34492290
Gsg1	Rat	titanium dioxide	increases expression	EXP		6480464	titanium dioxide results in increased expression of GSG1 mRNA	CTD	PMID:30012374
Gsg1	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of GSG1 mRNA	CTD	PMID:33387578
Gsg1	Rat	valproic acid	decreases methylation	ISO	GSG1 (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of GSG1 gene	CTD	PMID:29154799

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gsg1	Rat	endoplasmic reticulum	located_in	ISO	Gsg1 (Mus musculus)	1624291	PMID:18325338	RGD	PMID:18325338
Gsg1	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gsg1	Rat	endoplasmic reticulum membrane	located_in	IEA	UniProtKB-SubCell:SL-0097	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Gsg1	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Gsg1	Rat	membrane	located_in	IEA	InterPro:IPR004031	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Gsg1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gsg1	Rat	plasma membrane	is_active_in	IBA	MGI:1098726 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gsg1	Rat	protein binding	enables	ISO	GSG1 (Homo sapiens) and UniProtKB:Q2KHT4-3	1624291	UniProtKB:O00560 more ...	RGD	PMID:32296183
Gsg1	Rat	protein binding	enables	ISO	Gsg1 (Mus musculus)	1624291	UniProtKB:Q9WVP6 and PMID:18325338	RGD	PMID:18325338
Gsg1	Rat	protein binding	enables	ISO	GSG1 (Homo sapiens)	1624291	UniProtKB:Q12933 and PMID:25416956	RGD	PMID:25416956
Gsg1	Rat	RNA polymerase binding	enables	ISO	Gsg1 (Mus musculus)	1624291	PR:Q9WVP6 PMID:18325338	RGD	PMID:18325338

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

PMID:18325338

Gsg1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	169,822,111 - 169,838,379 (-)	NCBI		GRCr8
mRatBN7.2	4	168,090,773 - 168,107,039 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	168,090,776 - 168,107,039 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	174,385,996 - 174,402,270 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	170,167,236 - 170,183,512 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	168,792,705 - 168,808,969 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	169,020,680 - 169,037,021 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	169,020,683 - 169,036,950 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	233,291,206 - 233,307,476 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	172,191,997 - 172,208,267 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	172,436,935 - 172,453,203 (-)	NCBI
Celera	4	156,689,909 - 156,706,133 (-)	NCBI		Celera
Cytogenetic Map	4	q43	NCBI

GSG1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	13,083,532 - 13,103,667 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	13,083,532 - 13,103,683 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	13,236,466 - 13,256,601 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	13,128,309 - 13,147,886 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	13,127,760 - 13,139,876	NCBI
Celera	12	18,385,909 - 18,405,482 (-)	NCBI		Celera
Cytogenetic Map	12	p13.1	NCBI
HuRef	12	13,006,565 - 13,026,721 (-)	NCBI		HuRef
CHM1_1	12	13,201,867 - 13,222,050 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	12,957,742 - 12,977,872 (-)	NCBI		T2T-CHM13v2.0

Gsg1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	135,214,327 - 135,231,334 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	135,214,324 - 135,231,349 (-)	Ensembl		GRCm39 Ensembl
GRCm39 Ensembl	6	135,219,094 - 135,231,150 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	135,237,329 - 135,254,336 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	135,237,326 - 135,254,351 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	135,187,347 - 135,204,354 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	135,203,023 - 135,219,908 (-)	NCBI		MGSCv36	mm8
Celera	6	138,191,336 - 138,208,391 (-)	NCBI		Celera
Cytogenetic Map	6	G1	NCBI
cM Map	6	66.07	NCBI

Gsg1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955413	9,932,831 - 9,949,607 (-)	NCBI	ChiLan1.0	ChiLan1.0

GSG1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	18,539,270 - 18,566,238 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	18,536,030 - 18,556,614 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	13,094,993 - 13,115,653 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	13,500,276 - 13,519,134 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	13,500,276 - 13,519,134 (-)	Ensembl	panpan1.1		panPan2

GSG1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	33,286,460 - 33,302,080 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	33,286,571 - 33,426,458 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	13,142,528 - 13,158,117 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	33,592,412 - 33,608,004 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	33,592,524 - 33,608,001 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	33,486,784 - 33,502,365 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	33,436,093 - 33,451,678 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	12,877,759 - 12,893,337 (-)	NCBI		UU_Cfam_GSD_1.0

Gsg1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	94,503,717 - 94,517,814 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936587	4,237,698 - 4,245,736 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936587	4,237,760 - 4,245,449 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GSG1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	59,391,338 - 59,411,230 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	59,391,069 - 59,413,835 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	62,756,186 - 62,760,902 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GSG1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	12,990,515 - 13,009,239 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	12,990,594 - 13,009,062 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666069	22,309,606 - 22,329,877 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gsg1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624752	24,900,087 - 24,917,442 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624752	24,898,998 - 24,916,096 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Gsg1
49 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	59
Count of miRNA genes:	54
Interacting mature miRNAs:	57
Transcripts:	ENSRNOT00000011295
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	144639524	182687754	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	132422778	177422778	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	144639524	182687754	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	26775591	168368347	Rat
631683	Bp116	Blood pressure QTL 116		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	124303370	169303370	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	138503169	179293946	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
10053718	Scort25	Serum corticosterone level QTL 25	2.15	0.0097	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	155561574	182687754	Rat
1549827	Scl46	Serum cholesterol level QTL 46	3.5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	132396220	177396220	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	125590636	170590636	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	124778595	169778595	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	145568712	182687754	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
1300109	Rf13	Renal function QTL 13	3.91		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	4	157710145	182687754	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	123143783	168143783	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
2303623	Vencon2	Ventilatory control QTL 2	3.8		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	4	135204660	180204660	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	135699135	180699135	Rat
634342	Cia24	Collagen induced arthritis QTL 24	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	146565735	175236377	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
2293659	Bmd35	Bone mineral density QTL 35	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	4	137755016	181392681	Rat
1331759	Hrtrt13	Heart rate QTL 13	3.54628		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	110275411	168266883	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat

D4Rat245

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	4	169,837,923 - 169,838,148 (+)	Marker Load Pipeline
mRatBN7.2	4	168,106,584 - 168,106,808 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	169,036,495 - 169,036,719	NCBI	Rnor6.0
Rnor_5.0	4	233,307,021 - 233,307,245	UniSTS	Rnor5.0
RGSC_v3.4	4	172,207,811 - 172,208,036	RGD	RGSC3.4
RGSC_v3.4	4	172,207,812 - 172,208,036	UniSTS	RGSC3.4
RGSC_v3.1	4	172,452,747 - 172,452,972	RGD
Celera	4	156,705,678 - 156,705,902	UniSTS
FHH x ACI Map	4	106.6799	UniSTS
FHH x ACI Map	4	106.6799	RGD
Cytogenetic Map	4	q43	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	33	75	76	75	45	25	45	6	186	79	55	45	58	30


RefSeq Transcripts	NM_001013166	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592663	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592664	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592665	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592666	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC079000	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000011295 ⟹ ENSRNOP00000011295

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	168,090,776 - 168,107,039 (-)	Ensembl
Rnor_6.0 Ensembl	4	169,020,683 - 169,036,950 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107520 ⟹ ENSRNOP00000089420

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	168,090,776 - 168,097,760 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113676 ⟹ ENSRNOP00000092262

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	168,090,776 - 168,101,192 (-)	Ensembl

RefSeq Acc Id:

NM_001013166 ⟹ NP_001013184

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	169,822,111 - 169,838,379 (-)	NCBI
mRatBN7.2	4	168,090,773 - 168,107,039 (-)	NCBI
Rnor_6.0	4	169,020,680 - 169,036,950 (-)	NCBI
Rnor_5.0	4	233,291,206 - 233,307,476 (-)	NCBI
RGSC_v3.4	4	172,191,997 - 172,208,267 (-)	RGD
Celera	4	156,689,909 - 156,706,133 (-)	RGD

Sequence:

show sequence

CACCACCTTACCCCTCTGCTGGCAAGAGGGGGGCCTGGTGCATCCTCTCCCTCAACATCTGAGCCACGAAACTAATTAAGACCTGTCGGAGCAGAAACTGAGACACCTGTTTCAGAACCTCAACAGTG
AATGAGCGACTCCTGTCAGCTGACTCAAAATGTTTGTCTCACCCAGGAGATGGAGTTCCAGAAGGGTCCCTCTGACCAGCGGACCTTCGTTTCTGCCATCCTCAACATGCTATCACTCGGCCTCTCCA
CAGCATCCCTGCTCAGCAGCGAGTGGTTTGTGGGGGCACAGAAGGTGCCCAAGCCCCTGTGCGGGCAAAGTCTGGCAGCCAAGTGCTTTGACATGCCGATGTCCTTGGATGGGGGCATCACCAACGCA
TCAGCCCAGGAGGTGGTACAATACACCTGGGAGGCTGGGGATGACCGCTTCTCCTTCCTTACCTTCCGCAGTGGCATGTGGCTATCCTGTGAGGAAACCGTGGAAGAGCCAGGGGAGAAGTGCCGACG
TTTCATTGAACTCACACCACCAGCCCAGAGAGGTGAGAAAGGACTACTGGAATTTGCCACGTTGCAAGGCTCATGTCACCCCACTCTCCGATTTGGAGGGGAGTGGCTAATGGAGATGGCTTCTCTCC
TCTACCTCCCCTGGGGGCCCTTGGCAAAGGTCCTCTGGCTGTCGCTGGGAGCACAAACTGCCTATATCGGACTTCAATTCATCAGCTTCCTCCTGCTACTGACAGATCTGCTGCTCACCAGCAACCCT
GGCTGTGGGCTCAAGCTAAGCGCTTTTGCAGCAGTCTCCTTGGTCCTGTCAGGCCTGCTGGGGATGGTAGCTCATATGCTATATTTGCAAGTCTTCCAGGCAACTGCCAACTTGGGTCCGGAGGACTG
GAGACCACACTCTTGGAATTATGGCTGGGCTTTCTACACGGCCTGGGTTTCCTTCACCTGCTGTATGGTATCAGCAGTCACCACCTTCAACACCTACACCAGGATGGTGCTGGAGTTCAAGTGTAGGC
ACGGTACAAGTTTTAACACCAACCCCAGTTGCCGGGCACAGCACCACCGCTGTTTCCTTCCTCCGTTGACCTGCGCAGTCCACGCAGGGGAACCTTCGACCAGTTGCCATCAGCACCCCAGCCATCCC
ATCCGCTCTGTCTCCGAAAGTATAGACCTCTACTCGGCCGCCGCGCTACAGGACAAGAAGTTTCAACAAGAAAACAGCCAGGAGCTAAAGGAAGCGACCGAGTCATCTGTAGAAGAGCAGTGTTAGGA
GTTAAGTGGGTTTGGGAAGCAGGCTAAGCCCTACCATAGGTGTCATTCGCTATCAACATCTGCTTAAGCAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001013184	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79000	(Get FASTA)	NCBI Sequence Viewer
	EDM01626	(Get FASTA)	NCBI Sequence Viewer
	EDM01627	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000011295
	ENSRNOP00000011295.4
GenBank Protein	Q6AYL2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001013184 ⟸ NM_001013166

- UniProtKB:

A6IMG2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSDSCQLTQNVCLTQEMEFQKGPSDQRTFVSAILNMLSLGLSTASLLSSEWFVGAQKVPKPLCGQSLAAKCFDMPMSLDGGITNASAQEVVQYTWEAGDDRFSFLTFRSGMWLSCEETVEEPGEKCRR
FIELTPPAQRGEKGLLEFATLQGSCHPTLRFGGEWLMEMASLLYLPWGPLAKVLWLSLGAQTAYIGLQFISFLLLLTDLLLTSNPGCGLKLSAFAAVSLVLSGLLGMVAHMLYLQVFQATANLGPEDW
RPHSWNYGWAFYTAWVSFTCCMVSAVTTFNTYTRMVLEFKCRHGTSFNTNPSCRAQHHRCFLPPLTCAVHAGEPSTSCHQHPSHPIRSVSESIDLYSAAALQDKKFQQENSQELKEATESSVEEQC

hide sequence

Ensembl Acc Id:

ENSRNOP00000011295 ⟸ ENSRNOT00000011295

Ensembl Acc Id:

ENSRNOP00000092262 ⟸ ENSRNOT00000113676

Ensembl Acc Id:

ENSRNOP00000089420 ⟸ ENSRNOT00000107520

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AYL2-F1-model_v2	AlphaFold	Q6AYL2	1-325	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13693459

Promoter ID:

EPDNEW_R3984

Type:

initiation region

Name:

Gsg1_1

Description:

germ cell associated 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	169,036,975 - 169,037,035	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-42630	BioCyc
Ensembl Genes	ENSRNOG00000008518	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000011295	ENTREZGENE
	ENSRNOT00000011295.5	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.140.150	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7112802	IMAGE-MGC_LOAD
InterPro	GSG-1	UniProtKB/Swiss-Prot
	PMP-22/EMP/MP20	UniProtKB/Swiss-Prot
KEGG Report	rno:312793	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93908	IMAGE-MGC_LOAD
NCBI Gene	312793	ENTREZGENE
PANTHER	EPITHELIAL MEMBRANE PROTEIN-RELATED	UniProtKB/Swiss-Prot
	GERM CELL-SPECIFIC GENE 1 PROTEIN	UniProtKB/Swiss-Prot
Pfam	GSG-1	UniProtKB/Swiss-Prot
PhenoGen	Gsg1	PhenoGen
RatGTEx	ENSRNOG00000008518	RatGTEx
UniProt	A0A8I6ACL7_RAT	UniProtKB/TrEMBL
	A0A8I6ADC1_RAT	UniProtKB/TrEMBL
	A6IMG2	ENTREZGENE, UniProtKB/TrEMBL
	A6IMG3_RAT	UniProtKB/TrEMBL
	GSG1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Gsg1	germ cell associated 1	Gsg1_predicted	germ cell associated 1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Gsg1_predicted	germ cell associated 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar