Symbol:
Cmip
Name:
c-Maf-inducing protein
RGD ID:
1306101
Description:
Predicted to act upstream of or within in utero embryonic development. Predicted to be active in cytosol and nucleoplasm. Orthologous to human CMIP (c-Maf inducing protein); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,4-methylenedioxymethamphetamine; 3-chloropropane-1,2-diol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
c-Mip; LOC292051; RGD1306101; similar to 4933407C03Rik protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 62,213,402 - 62,419,443 (+) NCBI GRCr8 mRatBN7.2 19 45,304,597 - 45,510,653 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 45,304,031 - 45,508,709 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 52,114,762 - 52,320,797 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 52,767,789 - 52,971,951 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 55,012,031 - 55,216,191 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 49,792,273 - 50,000,535 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 49,792,273 - 50,000,535 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 60,579,252 - 60,792,095 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 47,364,495 - 47,572,096 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 47,369,375 - 47,576,808 (+) NCBI Celera 19 44,576,304 - 44,780,101 (+) NCBI Celera Cytogenetic Map 19 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Disease Annotations - ClinVar
Imported Disease Annotations - CTD
Only show annotations with direct experimental evidence (0 objects hidden)
Cmip Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:1603294 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of CMIP mRNA CTD PMID:22079256 Cmip Rat 17beta-estradiol decreases expression ISO RGD:1314521 6480464 Estradiol results in decreased expression of CMIP mRNA CTD PMID:39298647 Cmip Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CMIP mRNA CTD PMID:33387578|PMID:34747641 Cmip Rat 2-hydroxypropanoic acid decreases expression ISO RGD:1603294 6480464 Lactic Acid results in decreased expression of CMIP mRNA CTD PMID:30851411 Cmip Rat 3,4-methylenedioxymethamphetamine affects expression EXP 6480464 N-Methyl-3,4-methylenedioxyamphetamine affects the expression of CMIP mRNA CTD PMID:30071829 Cmip Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of CMIP mRNA CTD PMID:28522335 Cmip Rat 3-methylcholanthrene multiple interactions ISO RGD:1314521 6480464 [Methylcholanthrene co-treated with Nanotubes, Carbon] results in decreased expression of CMIP mRNA CTD PMID:25926378 Cmip Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1314521 6480464 bisphenol S results in decreased expression of CMIP mRNA CTD PMID:39298647 Cmip Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Cmip Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:1314521 6480464 Fenretinide results in increased expression of CMIP mRNA CTD PMID:28973697 Cmip Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of CMIP mRNA CTD PMID:24780913 Cmip Rat aflatoxin B1 affects methylation ISO RGD:1603294 6480464 Aflatoxin B1 affects the methylation of CMIP intron CTD PMID:30157460 Cmip Rat aflatoxin B1 decreases methylation ISO RGD:1603294 6480464 Aflatoxin B1 results in decreased methylation of CMIP promoter CTD PMID:30157460 Cmip Rat Aflatoxin B2 alpha affects methylation ISO RGD:1603294 6480464 aflatoxin B2 affects the methylation of CMIP intron CTD PMID:30157460 Cmip Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of CMIP mRNA CTD PMID:20488242 Cmip Rat all-trans-retinoic acid increases expression ISO RGD:1603294 6480464 Tretinoin results in increased expression of CMIP mRNA CTD PMID:33167477 Cmip Rat antirheumatic drug decreases expression ISO RGD:1603294 6480464 Antirheumatic Agents results in decreased expression of CMIP mRNA CTD PMID:24449571 Cmip Rat arsenous acid increases expression ISO RGD:1603294 6480464 Arsenic Trioxide results in increased expression of CMIP mRNA CTD PMID:25555879 Cmip Rat arsenous acid multiple interactions ISO RGD:1603294 6480464 [Arsenic Trioxide co-treated with Ascorbic Acid] results in increased expression of CMIP mRNA CTD PMID:25555879 Cmip Rat atrazine increases expression ISO RGD:1603294 6480464 Atrazine results in increased expression of CMIP mRNA CTD PMID:22378314 Cmip Rat benzo[a]pyrene decreases expression ISO RGD:1603294 6480464 Benzo(a)pyrene results in decreased expression of CMIP mRNA CTD PMID:20106945|PMID:21632981 Cmip Rat benzo[a]pyrene decreases methylation ISO RGD:1314521 6480464 Benzo(a)pyrene results in decreased methylation of CMIP exon; Benzo(a)pyrene results in decreased methylation of CMIP more ... CTD PMID:27901495 Cmip Rat benzo[a]pyrene affects methylation ISO RGD:1603294 6480464 Benzo(a)pyrene affects the methylation of CMIP intron; Benzo(a)pyrene affects the methylation of CMIP promoter CTD PMID:27901495|PMID:30157460 Cmip Rat benzo[a]pyrene increases methylation ISO RGD:1603294 6480464 Benzo(a)pyrene results in increased methylation of CMIP 3' UTR CTD PMID:27901495 Cmip Rat benzo[e]pyrene affects methylation ISO RGD:1603294 6480464 benzo(e)pyrene affects the methylation of CMIP intron CTD PMID:30157460 Cmip Rat bisphenol A increases expression ISO RGD:1314521 6480464 bisphenol A results in increased expression of CMIP mRNA CTD PMID:26063408|PMID:33221593|PMID:35598803 Cmip Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Cmip Rat bisphenol A decreases methylation ISO RGD:1603294 6480464 bisphenol A results in decreased methylation of CMIP gene CTD PMID:31601247 Cmip Rat bisphenol A multiple interactions ISO RGD:1603294 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of CMIP gene CTD PMID:31601247 Cmip Rat bisphenol A decreases expression ISO RGD:1603294 6480464 bisphenol A results in decreased expression of CMIP protein CTD PMID:33376534 Cmip Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CMIP mRNA CTD PMID:30816183|PMID:32145629 Cmip Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CMIP mRNA CTD PMID:25181051 Cmip Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Cmip Rat buta-1,3-diene decreases expression ISO RGD:1314521 6480464 1,3-butadiene results in decreased expression of CMIP mRNA CTD PMID:29038090 Cmip Rat butan-1-ol multiple interactions ISO RGD:1603294 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ... CTD PMID:29432896 Cmip Rat butanal decreases expression ISO RGD:1603294 6480464 butyraldehyde results in decreased expression of CMIP mRNA CTD PMID:26079696 Cmip Rat cadmium atom multiple interactions ISO RGD:1603294 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CMIP more ... CTD PMID:35301059 Cmip Rat cadmium dichloride increases expression ISO RGD:1603294 6480464 Cadmium Chloride results in increased expression of CMIP mRNA CTD PMID:38382870|PMID:38568856 Cmip Rat cadmium dichloride multiple interactions ISO RGD:1603294 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CMIP more ... CTD PMID:35301059 Cmip Rat caffeine decreases phosphorylation ISO RGD:1603294 6480464 Caffeine results in decreased phosphorylation of CMIP protein CTD PMID:35688186 Cmip Rat calcitriol increases expression ISO RGD:1603294 6480464 Calcitriol results in increased expression of CMIP mRNA CTD PMID:16002434 Cmip Rat carbon nanotube multiple interactions ISO RGD:1314521 6480464 [Methylcholanthrene co-treated with Nanotubes, Carbon] results in decreased expression of CMIP mRNA CTD PMID:25926378 Cmip Rat cefaloridine decreases expression EXP 6480464 Cephaloridine results in decreased expression of CMIP mRNA CTD PMID:18500788 Cmip Rat chlordecone increases expression ISO RGD:1314521 6480464 Chlordecone results in increased expression of CMIP mRNA CTD PMID:29980752 Cmip Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of CMIP mRNA CTD PMID:23125180 Cmip Rat cisplatin decreases expression ISO RGD:1603294 6480464 Cisplatin results in decreased expression of CMIP mRNA CTD PMID:19561079|PMID:27594783 Cmip Rat cobalt dichloride decreases expression ISO RGD:1603294 6480464 cobaltous chloride results in decreased expression of CMIP mRNA CTD PMID:19320972 Cmip Rat coumarin increases phosphorylation ISO RGD:1603294 6480464 coumarin results in increased phosphorylation of CMIP protein CTD PMID:35688186 Cmip Rat daunorubicin affects response to substance ISO RGD:1603294 6480464 CMIP affects the susceptibility to Daunorubicin CTD PMID:17545624 Cmip Rat diarsenic trioxide increases expression ISO RGD:1603294 6480464 Arsenic Trioxide results in increased expression of CMIP mRNA CTD PMID:25555879 Cmip Rat diarsenic trioxide multiple interactions ISO RGD:1603294 6480464 [Arsenic Trioxide co-treated with Ascorbic Acid] results in increased expression of CMIP mRNA CTD PMID:25555879 Cmip Rat Dibutyl phosphate affects expression ISO RGD:1603294 6480464 di-n-butylphosphoric acid affects the expression of CMIP mRNA CTD PMID:37042841 Cmip Rat dicrotophos increases expression ISO RGD:1603294 6480464 dicrotophos results in increased expression of CMIP mRNA CTD PMID:28302478 Cmip Rat diquat decreases expression ISO RGD:1314521 6480464 Diquat results in decreased expression of CMIP protein CTD PMID:36851058 Cmip Rat doxorubicin affects methylation EXP 6480464 Doxorubicin affects the methylation of CMIP gene CTD PMID:28962528 Cmip Rat doxorubicin decreases expression ISO RGD:1603294 6480464 Doxorubicin results in decreased expression of CMIP mRNA CTD PMID:29803840 Cmip Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of CMIP mRNA CTD PMID:29391264 Cmip Rat epoxiconazole affects expression ISO RGD:1314521 6480464 epoxiconazole affects the expression of CMIP mRNA CTD PMID:35436446 Cmip Rat ethanol multiple interactions ISO RGD:1603294 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ... CTD PMID:29432896 Cmip Rat ethanol affects splicing ISO RGD:1314521 6480464 Ethanol affects the splicing of CMIP mRNA CTD PMID:30319688 Cmip Rat fenthion increases expression ISO RGD:1314521 6480464 Fenthion results in increased expression of CMIP mRNA CTD PMID:34813904 Cmip Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of CMIP mRNA CTD PMID:34044035 Cmip Rat fulvestrant multiple interactions ISO RGD:1603294 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of CMIP gene CTD PMID:31601247 Cmip Rat L-ascorbic acid increases expression ISO RGD:1603294 6480464 Ascorbic Acid results in increased expression of CMIP mRNA CTD PMID:25555879 Cmip Rat L-ascorbic acid multiple interactions ISO RGD:1603294 6480464 [arsenic trioxide co-treated with Ascorbic Acid] results in increased expression of CMIP mRNA CTD PMID:25555879 Cmip Rat lead(0) affects expression ISO RGD:1603294 6480464 Lead affects the expression of CMIP mRNA CTD PMID:28903495 Cmip Rat leflunomide increases expression ISO RGD:1603294 6480464 leflunomide results in increased expression of CMIP mRNA CTD PMID:28988120 Cmip Rat manganese atom multiple interactions ISO RGD:1603294 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of CMIP more ... CTD PMID:39836092 Cmip Rat manganese(0) multiple interactions ISO RGD:1603294 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of CMIP more ... CTD PMID:39836092 Cmip Rat manganese(II) chloride multiple interactions ISO RGD:1603294 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of CMIP more ... CTD PMID:39836092 Cmip Rat menadione affects expression ISO RGD:1603294 6480464 Vitamin K 3 affects the expression of CMIP mRNA CTD PMID:20044591 Cmip Rat methapyrilene affects methylation ISO RGD:1603294 6480464 Methapyrilene affects the methylation of CMIP intron CTD PMID:30157460 Cmip Rat methidathion increases expression ISO RGD:1314521 6480464 methidathion results in increased expression of CMIP mRNA CTD PMID:34813904 Cmip Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of CMIP gene CTD PMID:35440735 Cmip Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of CMIP gene CTD PMID:33148267 Cmip Rat nickel sulfate increases expression ISO RGD:1603294 6480464 nickel sulfate results in increased expression of CMIP mRNA CTD PMID:22714537 Cmip Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CMIP mRNA CTD PMID:25729387 Cmip Rat ozone multiple interactions ISO RGD:1603294 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of CMIP mRNA CTD PMID:35430440 Cmip Rat paracetamol increases expression ISO RGD:1603294 6480464 Acetaminophen results in increased expression of CMIP mRNA CTD PMID:29067470 Cmip Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of CMIP mRNA CTD PMID:33387578 Cmip Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of CMIP gene CTD PMID:33148267 Cmip Rat phenobarbital affects expression ISO RGD:1314521 6480464 Phenobarbital affects the expression of CMIP mRNA CTD PMID:23091169 Cmip Rat potassium chromate decreases expression ISO RGD:1603294 6480464 potassium chromate(VI) results in decreased expression of CMIP mRNA CTD PMID:22079256 Cmip Rat potassium chromate multiple interactions ISO RGD:1603294 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of CMIP mRNA CTD PMID:22079256 Cmip Rat rac-lactic acid decreases expression ISO RGD:1603294 6480464 Lactic Acid results in decreased expression of CMIP mRNA CTD PMID:30851411 Cmip Rat sodium arsenite increases expression ISO RGD:1603294 6480464 sodium arsenite results in increased expression of CMIP mRNA CTD PMID:38568856 Cmip Rat sodium arsenite decreases expression ISO RGD:1314521 6480464 sodium arsenite results in decreased expression of CMIP mRNA CTD PMID:37682722 Cmip Rat temozolomide decreases expression ISO RGD:1603294 6480464 Temozolomide results in decreased expression of CMIP mRNA CTD PMID:31758290 Cmip Rat thimerosal decreases expression ISO RGD:1603294 6480464 Thimerosal results in decreased expression of CMIP mRNA CTD PMID:27188386 Cmip Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of CMIP mRNA CTD PMID:34492290 Cmip Rat thiram increases expression ISO RGD:1603294 6480464 Thiram results in increased expression of CMIP mRNA CTD PMID:38568856 Cmip Rat titanium dioxide increases expression ISO RGD:1314521 6480464 titanium dioxide results in increased expression of CMIP mRNA CTD PMID:27760801 Cmip Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CMIP mRNA CTD PMID:25729387 Cmip Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of CMIP mRNA CTD PMID:30589522 Cmip Rat troglitazone decreases expression ISO RGD:1314521 6480464 troglitazone results in decreased expression of CMIP mRNA CTD PMID:28973697 Cmip Rat tungsten decreases expression ISO RGD:1314521 6480464 Tungsten results in decreased expression of CMIP mRNA CTD PMID:30912803 Cmip Rat valproic acid decreases methylation ISO RGD:1603294 6480464 Valproic Acid results in decreased methylation of CMIP gene CTD PMID:29154799 Cmip Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of CMIP mRNA CTD PMID:19015723 Cmip Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of CMIP mRNA CTD PMID:20566332 Cmip Rat vorinostat decreases expression ISO RGD:1603294 6480464 vorinostat results in decreased expression of CMIP mRNA CTD PMID:27188386
(-)-epigallocatechin 3-gallate (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2-hydroxypropanoic acid (ISO) 3,4-methylenedioxymethamphetamine (EXP) 3-chloropropane-1,2-diol (EXP) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (EXP,ISO) antirheumatic drug (ISO) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) buta-1,3-diene (ISO) butan-1-ol (ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) calcitriol (ISO) carbon nanotube (ISO) cefaloridine (EXP) chlordecone (ISO) chloroprene (EXP) cisplatin (ISO) cobalt dichloride (ISO) coumarin (ISO) daunorubicin (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) diquat (ISO) doxorubicin (EXP,ISO) endosulfan (EXP) epoxiconazole (ISO) ethanol (ISO) fenthion (ISO) fipronil (EXP) fulvestrant (ISO) L-ascorbic acid (ISO) lead(0) (ISO) leflunomide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) menadione (ISO) methapyrilene (ISO) methidathion (ISO) methoxychlor (EXP) N,N-diethyl-m-toluamide (EXP) nickel sulfate (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) permethrin (EXP) phenobarbital (ISO) potassium chromate (ISO) rac-lactic acid (ISO) sodium arsenite (ISO) temozolomide (ISO) thimerosal (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) triphenyl phosphate (EXP) troglitazone (ISO) tungsten (ISO) valproic acid (ISO) vinclozolin (EXP) vorinostat (ISO)
References
Additional References at PubMed
Genomics
Comparative Map Data
Cmip Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 62,213,402 - 62,419,443 (+) NCBI GRCr8 mRatBN7.2 19 45,304,597 - 45,510,653 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 45,304,031 - 45,508,709 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 52,114,762 - 52,320,797 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 52,767,789 - 52,971,951 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 55,012,031 - 55,216,191 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 49,792,273 - 50,000,535 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 49,792,273 - 50,000,535 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 60,579,252 - 60,792,095 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 47,364,495 - 47,572,096 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 47,369,375 - 47,576,808 (+) NCBI Celera 19 44,576,304 - 44,780,101 (+) NCBI Celera Cytogenetic Map 19 q12 NCBI
CMIP Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 81,444,808 - 81,711,762 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 81,444,808 - 81,711,762 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 81,478,413 - 81,745,367 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 80,036,395 - 80,302,866 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 16 65,776,243 - 66,042,401 (+) NCBI Celera Cytogenetic Map 16 q23.2-q23.3 NCBI HuRef 16 67,233,330 - 67,498,721 (+) NCBI HuRef CHM1_1 16 82,890,152 - 83,156,504 (+) NCBI CHM1_1 T2T-CHM13v2.0 16 87,505,643 - 87,774,006 (+) NCBI T2T-CHM13v2.0
Cmip Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 117,983,758 - 118,188,245 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 117,983,803 - 118,186,169 (+) Ensembl GRCm39 Ensembl GRCm38 8 117,257,019 - 117,461,506 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 117,257,064 - 117,459,430 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 119,780,919 - 119,985,406 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 120,143,070 - 120,345,490 (+) NCBI MGSCv36 mm8 Celera 8 121,476,876 - 121,681,672 (+) NCBI Celera Cytogenetic Map 8 E1 NCBI cM Map 8 63.87 NCBI
Cmip Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955522 4,128,454 - 4,315,322 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955522 4,128,454 - 4,314,340 (+) NCBI ChiLan1.0 ChiLan1.0
CMIP Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 91,194,615 - 91,462,946 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 97,114,070 - 97,382,470 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 62,048,888 - 62,316,799 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 81,474,986 - 81,739,487 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 81,475,038 - 81,737,518 (+) Ensembl panpan1.1 panPan2
CMIP Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 70,251,032 - 70,376,300 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 70,249,228 - 70,436,213 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 70,263,003 - 70,471,850 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 70,554,031 - 70,785,344 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 70,555,190 - 70,785,344 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 70,496,524 - 70,727,753 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 70,332,332 - 70,563,229 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 70,809,642 - 71,040,961 (-) NCBI UU_Cfam_GSD_1.0
Cmip Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 30,383,366 - 30,457,466 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936475 29,131,720 - 29,205,885 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936475 29,130,483 - 29,205,750 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CMIP Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 6,654,411 - 6,881,813 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 6,653,237 - 6,881,874 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 7,240,291 - 7,279,015 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CMIP
Cmip
.
miRNA Target Status (No longer updated)
Predicted Target Of
Count of predictions: 64 Count of miRNA genes: 59 Interacting mature miRNAs: 64 Transcripts: ENSRNOT00000017941 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
QTLs in Region (GRCr8)
61350 Bp32 Blood pressure QTL 32 0.012 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 19 20483575 57337602 Rat 61447 Tcas1 Tongue tumor susceptibility QTL 1 6.08 tongue integrity trait (VT:0010553) squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875) 19 2316121 47316121 Rat 724546 Kidm3 Kidney mass QTL 3 3.1 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 19 29322490 57337602 Rat 7411549 Bw130 Body weight QTL 130 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 15455860 57337602 Rat 1358200 Insglur2 Insulin/glucose ratio QTL 2 4.1 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 19 33838214 55283146 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 2298478 Eau8 Experimental allergic uveoretinitis QTL 8 0.0163 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 19 17154433 57337602 Rat 8694186 Bw152 Body weight QTL 152 3.34 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 569374 45569374 Rat 1578764 Stresp19 Stress response QTL 19 3.6 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 19 15630201 57337602 Rat 5135224 Leukc1 Leukocyte quantity QTL 1 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 19 44340214 55283277 Rat 1331788 Rf45 Renal function QTL 45 2.818 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 19 15605023 46559041 Rat 2317848 Alcrsp21 Alcohol response QTL 21 1.899999976158142 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 19 3204777 48204777 Rat 9589102 Slep13 Serum leptin concentration QTL 13 4.63 0.001 blood leptin amount (VT:0005667) plasma leptin level (CMO:0000781) 19 569374 45569374 Rat 7247442 Uae39 Urinary albumin excretion QTL 39 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 2187927 46708701 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat
Markers in Region
D19Rat7
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 19 62,290,115 - 62,290,263 (+) Marker Load Pipeline mRatBN7.2 19 45,381,317 - 45,381,467 (+) MAPPER mRatBN7.2 Rnor_6.0 19 49,873,186 - 49,873,333 NCBI Rnor6.0 Rnor_5.0 19 60,662,804 - 60,662,951 UniSTS Rnor5.0 RGSC_v3.4 19 47,444,682 - 47,444,830 RGD RGSC3.4 RGSC_v3.4 19 47,444,683 - 47,444,830 UniSTS RGSC3.4 RGSC_v3.1 19 47,449,564 - 47,449,711 RGD Celera 19 44,652,696 - 44,652,843 UniSTS RH 3.4 Map 19 623.5 UniSTS RH 3.4 Map 19 623.5 RGD RH 2.0 Map 19 629.4 RGD SHRSP x BN Map 19 38.1498 RGD Cytogenetic Map 19 q12 UniSTS
RH139939
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 19 62,293,914 - 62,294,104 (+) Marker Load Pipeline mRatBN7.2 19 45,385,118 - 45,385,308 (+) MAPPER mRatBN7.2 Rnor_6.0 19 49,876,985 - 49,877,174 NCBI Rnor6.0 Rnor_5.0 19 60,666,603 - 60,666,792 UniSTS Rnor5.0 RGSC_v3.4 19 47,448,482 - 47,448,671 UniSTS RGSC3.4 Celera 19 44,656,658 - 44,656,847 UniSTS RH 3.4 Map 19 597.2 UniSTS Cytogenetic Map 19 q12 UniSTS
AU049392
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 45,329,789 - 45,330,044 (+) MAPPER mRatBN7.2 Rnor_6.0 19 49,817,420 - 49,817,674 NCBI Rnor6.0 Rnor_5.0 19 60,604,608 - 60,604,862 UniSTS Rnor5.0 RGSC_v3.4 19 47,392,705 - 47,392,959 UniSTS RGSC3.4 Celera 19 44,601,577 - 44,601,831 UniSTS Cytogenetic Map 19 q12 UniSTS
Expression
RNA-SEQ Expression
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Sequence
Ensembl Acc Id:
ENSRNOT00000017941 ⟹ ENSRNOP00000017940
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 45,397,786 - 45,508,709 (+) Ensembl Rnor_6.0 Ensembl 19 49,792,273 - 50,000,535 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000083991 ⟹ ENSRNOP00000070595
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 45,304,597 - 45,507,226 (+) Ensembl Rnor_6.0 Ensembl 19 49,792,278 - 50,000,095 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000112862 ⟹ ENSRNOP00000087879
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 45,304,031 - 45,508,709 (+) Ensembl
RefSeq Acc Id:
NM_001163273 ⟹ NP_001156745
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 62,213,402 - 62,417,500 (+) NCBI mRatBN7.2 19 45,304,597 - 45,508,709 (+) NCBI Rnor_6.0 19 49,792,273 - 50,000,535 (+) NCBI Rnor_5.0 19 60,579,252 - 60,792,095 (+) NCBI RGSC_v3.4 19 47,364,495 - 47,572,096 (+) RGD Celera 19 44,576,304 - 44,780,101 (+) RGD
Sequence:
ATGGATGTGACGAGCAGCTCGGGCGGCGGCGACCCCCGGCAGATCGAGGAGACCAAGCCGCTGCTAGGGAGCGACGTGTCGGCCCCCGAGGGCACCAAGGTGATGGGCGCCGTGCCTTGCCGCCGGGC
hide sequence
RefSeq Acc Id:
XM_006255684 ⟹ XP_006255746
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 62,357,670 - 62,419,443 (+) NCBI mRatBN7.2 19 45,453,597 - 45,510,653 (+) NCBI Rnor_6.0 19 49,943,580 - 50,000,419 (+) NCBI Rnor_5.0 19 60,579,252 - 60,792,095 (+) NCBI
Sequence:
CACAAGTACGTACACAGAAGCACACATACAAACACACAAGCCCGCATGCCCTTTATAAAGTTGAGTAAGTTAACACTTTTACATTGAGCCACATTCAAGAGGTTCCCTCTTCCTGATGACTCTAGGGC
hide sequence
RefSeq Acc Id:
XM_039097643 ⟹ XP_038953571
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 62,368,730 - 62,419,443 (+) NCBI mRatBN7.2 19 45,460,040 - 45,510,653 (+) NCBI
RefSeq Acc Id:
XM_063277945 ⟹ XP_063134015
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 62,214,194 - 62,419,443 (+) NCBI
RefSeq Acc Id:
NP_001156745 ⟸ NM_001163273
- UniProtKB:
A0A8I6A9M1 (UniProtKB/TrEMBL), A0A0G2JYB9 (UniProtKB/TrEMBL)
- Sequence:
MDVTSSSGGGDPRQIEETKPLLGSDVSAPEGTKVMGAVPCRRALLLCNGMRYKLLQEGDIQVCVIRHPRTFLSKILTSKFLRRWEPHHLTLADNSLASATPSGYMENSVSYSAIEDVQPLSWENAPKY
hide sequence
RefSeq Acc Id:
XP_006255746 ⟸ XM_006255684
- Peptide Label:
isoform X2
- UniProtKB:
F1M8D3 (UniProtKB/TrEMBL)
- Sequence:
MAGVAQKKIYKYKKVLSNPSRWEVVLKEIRTLVDMALTSPLQDDSINQAPLEIVSKLLSENTNL
hide sequence
Ensembl Acc Id:
ENSRNOP00000070595 ⟸ ENSRNOT00000083991
Ensembl Acc Id:
ENSRNOP00000017940 ⟸ ENSRNOT00000017941
RefSeq Acc Id:
XP_038953571 ⟸ XM_039097643
- Peptide Label:
isoform X3
- UniProtKB:
F1M8D3 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000087879 ⟸ ENSRNOT00000112862
RefSeq Acc Id:
XP_063134015 ⟸ XM_063277945
- Peptide Label:
isoform X1
- UniProtKB:
F1M8D3 (UniProtKB/TrEMBL), A6IZH3 (UniProtKB/TrEMBL)
Additional Information
Nomenclature History
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-07
Cmip
c-Maf-inducing protein
RGD1306101_predicted
similar to 4933407C03Rik protein (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
RGD1306101_predicted
similar to 4933407C03Rik protein (predicted)
LOC292051_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC292051_predicted
similar to 4933407C03Rik protein (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
