Symbol:
Anapc2
Name:
anaphase promoting complex subunit 2
RGD ID:
1305546
Description:
Predicted to enable ubiquitin protein ligase binding activity. Involved in negative regulation of gene expression; positive regulation of axon extension; and positive regulation of dendrite morphogenesis. Predicted to be part of anaphase-promoting complex. Orthologous to human ANAPC2 (anaphase promoting complex subunit 2); PARTICIPATES IN cell cycle pathway, mitotic; ubiquitin/proteasome degradation pathway; INTERACTS WITH 2,4-dinitrotoluene; 2,6-dinitrotoluene; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
anaphase-promoting complex subunit 2; LOC296558
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Candidate Gene For:
Arunc3
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 28,484,590 - 28,496,338 (+) NCBI GRCr8 mRatBN7.2 3 8,086,434 - 8,098,182 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 8,086,462 - 8,098,178 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 11,190,969 - 11,202,704 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 19,777,199 - 19,788,934 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 17,967,042 - 17,978,777 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 2,490,496 - 2,502,247 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 2,490,518 - 2,502,248 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 2,471,951 - 2,483,660 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 3,436,569 - 3,448,278 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 3,436,404 - 3,448,589 (+) NCBI Celera 3 2,913,015 - 2,924,724 (+) NCBI Celera Cytogenetic Map 3 p13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Anapc2 Rat 1,2-dimethylhydrazine increases expression ISO Anapc2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ANAPC2 mRNA CTD PMID:22206623 Anapc2 Rat 1,2-dimethylhydrazine multiple interactions ISO Anapc2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of ANAPC2 mRNA CTD PMID:22206623 Anapc2 Rat 17beta-estradiol increases expression ISO Anapc2 (Mus musculus) 6480464 Estradiol results in increased expression of ANAPC2 mRNA CTD PMID:39298647 Anapc2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Anapc2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ANAPC2 mRNA CTD PMID:21570461 Anapc2 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of ANAPC2 mRNA CTD PMID:21346803 Anapc2 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of ANAPC2 mRNA CTD PMID:21346803 Anapc2 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Anapc2 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of ANAPC2 mRNA CTD PMID:18648102 Anapc2 Rat 4,4'-sulfonyldiphenol increases expression ISO Anapc2 (Mus musculus) 6480464 bisphenol S results in increased expression of ANAPC2 mRNA CTD PMID:39298647 Anapc2 Rat 4,4'-sulfonyldiphenol affects methylation ISO Anapc2 (Mus musculus) 6480464 bisphenol S affects the methylation of ANAPC2 gene CTD PMID:31683443 Anapc2 Rat acrolein decreases expression ISO ANAPC2 (Homo sapiens) 6480464 Acrolein results in decreased expression of ANAPC2 mRNA CTD PMID:26719373 Anapc2 Rat aflatoxin B1 increases methylation ISO ANAPC2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of ANAPC2 intron CTD PMID:30157460 Anapc2 Rat Aflatoxin B2 alpha affects methylation ISO ANAPC2 (Homo sapiens) 6480464 aflatoxin B2 affects the methylation of ANAPC2 intron CTD PMID:30157460 Anapc2 Rat aristolochic acid A increases expression ISO ANAPC2 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of ANAPC2 mRNA CTD PMID:33212167 Anapc2 Rat Benoxacor increases expression ISO Anapc2 (Mus musculus) 6480464 benoxacor results in increased expression of ANAPC2 mRNA CTD PMID:34850242 Anapc2 Rat benzo[e]pyrene increases methylation ISO ANAPC2 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of ANAPC2 intron CTD PMID:30157460 Anapc2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ANAPC2 mRNA CTD PMID:25181051 and PMID:30816183 Anapc2 Rat bisphenol A affects expression ISO ANAPC2 (Homo sapiens) 6480464 bisphenol A affects the expression of ANAPC2 mRNA CTD PMID:35628146 Anapc2 Rat bisphenol F multiple interactions ISO ANAPC2 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of ANAPC2 gene CTD PMID:31601247 Anapc2 Rat caffeine affects phosphorylation ISO ANAPC2 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of ANAPC2 protein CTD PMID:35688186 Anapc2 Rat cobalt dichloride increases expression ISO ANAPC2 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of ANAPC2 mRNA CTD PMID:19376846 Anapc2 Rat copper atom multiple interactions ISO ANAPC2 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of ANAPC2 mRNA CTD PMID:30911355 Anapc2 Rat copper(0) multiple interactions ISO ANAPC2 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of ANAPC2 mRNA CTD PMID:30911355 Anapc2 Rat coumarin increases phosphorylation ISO ANAPC2 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of ANAPC2 protein CTD PMID:35688186 Anapc2 Rat doxorubicin multiple interactions ISO ANAPC2 (Homo sapiens) 6480464 Doxorubicin promotes the reaction [CCAR1 protein binds to ANAPC2 protein] CTD PMID:21903591 Anapc2 Rat Echimidine multiple interactions ISO ANAPC2 (Homo sapiens) 6480464 [CYP3A4 protein results in increased metabolism of echimidine] which results in decreased expression of ANAPC2 mRNA CTD PMID:33884520 Anapc2 Rat elemental selenium increases expression ISO ANAPC2 (Homo sapiens) 6480464 Selenium results in increased expression of ANAPC2 mRNA CTD PMID:19244175 Anapc2 Rat ethanol affects splicing ISO Anapc2 (Mus musculus) 6480464 Ethanol affects the splicing of ANAPC2 mRNA CTD PMID:30319688 Anapc2 Rat fenthion decreases expression ISO Anapc2 (Mus musculus) 6480464 Fenthion results in decreased expression of ANAPC2 mRNA CTD PMID:34813904 Anapc2 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of ANAPC2 mRNA CTD PMID:24136188 Anapc2 Rat folic acid multiple interactions ISO Anapc2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of ANAPC2 mRNA CTD PMID:22206623 Anapc2 Rat FR900359 increases phosphorylation ISO ANAPC2 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of ANAPC2 protein CTD PMID:37730182 Anapc2 Rat fulvestrant multiple interactions ISO ANAPC2 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of ANAPC2 gene CTD PMID:31601247 Anapc2 Rat fulvestrant increases methylation ISO ANAPC2 (Homo sapiens) 6480464 Fulvestrant results in increased methylation of ANAPC2 gene CTD PMID:31601247 Anapc2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ANAPC2 mRNA CTD PMID:22061828 Anapc2 Rat ivermectin decreases expression ISO ANAPC2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of ANAPC2 protein CTD PMID:32959892 Anapc2 Rat Lasiocarpine multiple interactions ISO ANAPC2 (Homo sapiens) 6480464 [CYP3A4 protein results in increased metabolism of lasiocarpine] which results in decreased expression of ANAPC2 mRNA CTD PMID:33884520 Anapc2 Rat lead(0) decreases expression ISO ANAPC2 (Homo sapiens) 6480464 Lead results in decreased expression of ANAPC2 mRNA CTD PMID:19921347 Anapc2 Rat methapyrilene increases methylation ISO ANAPC2 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of ANAPC2 intron CTD PMID:30157460 Anapc2 Rat methidathion decreases expression ISO Anapc2 (Mus musculus) 6480464 methidathion results in decreased expression of ANAPC2 mRNA CTD PMID:34813904 Anapc2 Rat monocrotaline multiple interactions ISO ANAPC2 (Homo sapiens) 6480464 [CYP3A4 protein results in increased metabolism of Monocrotaline] which results in decreased expression of ANAPC2 mRNA CTD PMID:33884520 Anapc2 Rat nitrates multiple interactions ISO Anapc2 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of ANAPC2 mRNA CTD PMID:35964746 Anapc2 Rat nocodazole multiple interactions ISO ANAPC2 (Homo sapiens) 6480464 Nocodazole promotes the reaction [CCAR1 protein binds to ANAPC2 protein] CTD PMID:21903591 Anapc2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ANAPC2 mRNA CTD PMID:33387578 Anapc2 Rat phlorizin decreases expression ISO Anapc2 (Mus musculus) 6480464 Phlorhizin results in decreased expression of ANAPC2 mRNA CTD PMID:22538082 Anapc2 Rat selenium atom increases expression ISO ANAPC2 (Homo sapiens) 6480464 Selenium results in increased expression of ANAPC2 mRNA CTD PMID:19244175 Anapc2 Rat senecionine increases expression ISO Anapc2 (Mus musculus) 6480464 senecionine results in increased expression of ANAPC2 protein CTD PMID:35357534 Anapc2 Rat sodium arsenite decreases expression ISO Anapc2 (Mus musculus) 6480464 sodium arsenite results in decreased expression of ANAPC2 mRNA CTD PMID:16014739 Anapc2 Rat sodium fluoride decreases expression ISO Anapc2 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of ANAPC2 mRNA CTD PMID:27862939 Anapc2 Rat sunitinib decreases expression ISO ANAPC2 (Homo sapiens) 6480464 Sunitinib results in decreased expression of ANAPC2 mRNA CTD PMID:31533062 Anapc2 Rat titanium dioxide decreases methylation ISO Anapc2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ANAPC2 gene CTD PMID:35295148 Anapc2 Rat triphenyl phosphate affects expression ISO ANAPC2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ANAPC2 mRNA CTD PMID:37042841 Anapc2 Rat valproic acid increases methylation ISO ANAPC2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of ANAPC2 gene CTD PMID:29154799
Imported Annotations - KEGG (archival)
1.
Loss-of-Function Mutation in APC2 Causes Sotos Syndrome Features.
Almuriekhi M, etal., Cell Rep. 2015 Mar 3. pii: S2211-1247(15)00139-4. doi: 10.1016/j.celrep.2015.02.011.
2.
Molecular profiling of mouse lung tumors: association with tumor progression, lung development, and human lung adenocarcinomas.
Bonner AE, etal., Oncogene. 2004 Feb 5;23(5):1166-76.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Expression of the CDH1-associated form of the anaphase-promoting complex in postmitotic neurons.
Gieffers C, etal., Proc Natl Acad Sci U S A. 1999 Sep 28;96(20):11317-22.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Liprinalpha1 degradation by calcium/calmodulin-dependent protein kinase II regulates LAR receptor tyrosine phosphatase distribution and dendrite development.
Hoogenraad CC, etal., Dev Cell. 2007 Apr;12(4):587-602. doi: 10.1016/j.devcel.2007.02.006.
7.
Comparative evaluation of the aqueous humor proteome of primary angle closure and primary open angle glaucomas and age-related cataract eyes.
Kaur I, etal., Int Ophthalmol. 2019 Jan;39(1):69-104. doi: 10.1007/s10792-017-0791-0. Epub 2018 Jan 13.
8.
A centrosomal Cdc20-APC pathway controls dendrite morphogenesis in postmitotic neurons.
Kim AH, etal., Cell. 2009 Jan 23;136(2):322-36.
9.
The anaphase promoting complex is required for memory function in mice.
Kuczera T, etal., Learn Mem. 2010 Dec 22;18(1):49-57. doi: 10.1101/lm.1998411. Print 2011 Jan.
10.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
11.
Laser capture microdissection and microarray expression analysis of lung adenocarcinoma reveals tobacco smoking- and prognosis-related molecular profiles.
Miura K, etal., Cancer Res. 2002 Jun 1;62(11):3244-50.
12.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
13.
The expression pattern of APC2 and APC7 in various cancer cell lines and AML patients.
Rahimi H, etal., Adv Med Sci. 2015 Sep;60(2):259-63. doi: 10.1016/j.advms.2015.04.007. Epub 2015 May 13.
14.
GOA pipeline
RGD automated data pipeline
15.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
16.
Comprehensive gene review and curation
RGD comprehensive gene curation
17.
Alterations of protein expression in serum of infants with intrauterine growth restriction and different gestational ages.
Ruis-González MD, etal., J Proteomics. 2015 Apr 24;119:169-82. doi: 10.1016/j.jprot.2015.02.003. Epub 2015 Feb 25.
18.
APC/C is essential for hematopoiesis and impaired in aplastic anemia.
Wang J, etal., Oncotarget. 2017 Jun 28;8(38):63360-63369. doi: 10.18632/oncotarget.18808. eCollection 2017 Sep 8.
Anapc2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 28,484,590 - 28,496,338 (+) NCBI GRCr8 mRatBN7.2 3 8,086,434 - 8,098,182 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 8,086,462 - 8,098,178 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 11,190,969 - 11,202,704 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 19,777,199 - 19,788,934 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 17,967,042 - 17,978,777 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 2,490,496 - 2,502,247 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 2,490,518 - 2,502,248 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 2,471,951 - 2,483,660 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 3,436,569 - 3,448,278 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 3,436,404 - 3,448,589 (+) NCBI Celera 3 2,913,015 - 2,924,724 (+) NCBI Celera Cytogenetic Map 3 p13 NCBI
ANAPC2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 137,174,784 - 137,188,560 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 137,174,784 - 137,188,560 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 140,069,236 - 140,083,012 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 139,189,057 - 139,202,878 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 137,345,072 - 137,358,894 NCBI Celera 9 110,583,566 - 110,597,088 (-) NCBI Celera Cytogenetic Map 9 q34.3 NCBI HuRef 9 109,529,253 - 109,543,074 (-) NCBI HuRef CHM1_1 9 140,217,925 - 140,231,746 (-) NCBI CHM1_1 T2T-CHM13v2.0 9 149,412,464 - 149,426,223 (-) NCBI T2T-CHM13v2.0
Anapc2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 25,162,469 - 25,175,928 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 25,162,490 - 25,175,927 (+) Ensembl GRCm39 Ensembl GRCm38 2 25,272,466 - 25,285,916 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 25,272,478 - 25,285,915 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 25,127,986 - 25,141,436 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 25,094,508 - 25,107,924 (+) NCBI MGSCv36 mm8 Celera 2 25,000,157 - 25,013,426 (+) NCBI Celera Cytogenetic Map 2 A3 NCBI cM Map 2 17.12 NCBI
Anapc2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955513 5,183,472 - 5,194,253 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955513 5,183,472 - 5,194,253 (-) NCBI ChiLan1.0 ChiLan1.0
ANAPC2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 2,210,577 - 2,224,304 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 2,213,159 - 2,226,638 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 108,234,949 - 108,248,227 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 137,204,356 - 137,217,652 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 137,204,356 - 137,217,652 (-) Ensembl panpan1.1 panPan2
ANAPC2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 48,475,777 - 48,486,715 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 48,471,584 - 48,609,303 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 47,666,446 - 47,677,538 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 49,341,288 - 49,352,382 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 49,341,432 - 49,355,653 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 48,117,700 - 48,128,794 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 48,416,513 - 48,427,605 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 48,463,672 - 48,474,764 (+) NCBI UU_Cfam_GSD_1.0
Anapc2
ANAPC2 No map positions available.
ANAPC2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 1,000,885 - 1,014,710 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 1,000,952 - 1,016,261 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666058 4,290,548 - 4,304,375 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Anapc2
.
Predicted Target Of
Count of predictions: 83 Count of miRNA genes: 67 Interacting mature miRNAs: 70 Transcripts: ENSRNOT00000015099 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631545 Bp85 Blood pressure QTL 85 3.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 1 33278763 Rat 4889966 Bss95 Bone structure and strength QTL 95 4.4 tibia area (VT:1000281) tibia-fibula cross-sectional area (CMO:0001718) 3 1 36847613 Rat 2292615 Ept17 Estrogen-induced pituitary tumorigenesis QTL 17 6.7 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 6537645 10778823 Rat 631679 Cm10 Cardiac mass QTL 10 7.34 0.0001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 1 31158234 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 631568 Bp92 Blood pressure QTL 92 2.2 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 1 39874793 Rat 70202 Alc19 Alcohol consumption QTL 19 2.5 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 3 1 27494778 Rat 2312664 Scl62 Serum cholesterol level QTL 62 0.05 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 1 38710544 Rat 61468 Bp15 Blood pressure QTL 15 4.4 blood pressure trait (VT:0000183) pulse pressure (CMO:0000292) 3 1 33278763 Rat 1358185 Ept6 Estrogen-induced pituitary tumorigenesis QTL 6 6.7 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 6537645 10778823 Rat 631831 Alc8 Alcohol consumption QTL 8 2.7 consumption behavior trait (VT:0002069) calculated ethanol drink intake rate (CMO:0001615) 3 1 33230976 Rat
RH128511
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 8,085,113 - 8,085,304 (+) MAPPER mRatBN7.2 Rnor_6.0 3 2,489,182 - 2,489,372 NCBI Rnor6.0 Rnor_5.0 3 2,470,595 - 2,470,785 UniSTS Rnor5.0 RGSC_v3.4 3 3,435,213 - 3,435,403 UniSTS RGSC3.4 Celera 3 2,911,659 - 2,911,849 UniSTS Cytogenetic Map 3 p13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000015099 ⟹ ENSRNOP00000015099
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 8,086,462 - 8,098,178 (+) Ensembl Rnor_6.0 Ensembl 3 2,490,518 - 2,502,248 (+) Ensembl
RefSeq Acc Id:
NM_001100532 ⟹ NP_001094002
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 28,484,628 - 28,496,338 (+) NCBI mRatBN7.2 3 8,086,470 - 8,098,181 (+) NCBI Rnor_6.0 3 2,490,538 - 2,502,247 (+) NCBI Rnor_5.0 3 2,471,951 - 2,483,660 (+) NCBI RGSC_v3.4 3 3,436,569 - 3,448,278 (+) RGD Celera 3 2,913,015 - 2,924,724 (+) RGD
Sequence:
CAGTGATGGAGGCCGAGGGTGTGGCGGTATCGGTGGCGGCGGCGGCGGCGGCGACAACGACAATTGTCGCCACGGATGACTGCGACTCTAGGCCTGGACAGGAGCTCGTGGTTGCCTGGAATACTGTG
hide sequence
RefSeq Acc Id:
XM_063283461 ⟹ XP_063139531
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 28,484,590 - 28,495,890 (+) NCBI
RefSeq Acc Id:
NP_001094002 ⟸ NM_001100532
- UniProtKB:
B2RYJ1 (UniProtKB/TrEMBL), F7EWF8 (UniProtKB/TrEMBL)
- Sequence:
MEAEGVAVSVAAAAAATTTIVATDDCDSRPGQELVVAWNTVSTGLVPPAALGLASSRTSGAVPPKEEELRAAVEVLRAHGLHSVLEEWFVEVLQNDLQGNIATEFWNAISLRENSVDEPQCLVLLLDA
hide sequence
Ensembl Acc Id:
ENSRNOP00000015099 ⟸ ENSRNOT00000015099
RefSeq Acc Id:
XP_063139531 ⟸ XM_063283461
- Peptide Label:
isoform X1
RGD ID: 13691867 Promoter ID: EPDNEW_R2392 Type: multiple initiation site Name: Anapc2_1 Description: anaphase promoting complex subunit 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 2,490,528 - 2,490,588 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-12-06
Anapc2
anaphase promoting complex subunit 2
Anapc2_predicted
anaphase promoting complex subunit 2 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Anapc2_predicted
anaphase promoting complex subunit 2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
