Advanced Search (OLGA)

Gene: Klhl40 (kelch-like family member 40) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Klhl40

Name:

kelch-like family member 40

RGD ID:

1305368

Description:

Predicted to enable ubiquitin-like ligase-substrate adaptor activity. Predicted to be involved in proteasome-mediated ubiquitin-dependent protein catabolic process; regulation of protein metabolic process; and skeletal muscle fiber development. Predicted to act upstream of or within skeletal muscle fiber differentiation. Predicted to be part of Cul3-RING ubiquitin ligase complex. Predicted to be active in A band and I band. Human ortholog(s) of this gene implicated in nemaline myopathy 8. Orthologous to human KLHL40 (kelch like family member 40); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,7-dihydropurine-6-thione; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Kbtbd5; kelch repeat and BTB (POZ) domain containing 5; kelch repeat and BTB domain-containing protein 5; kelch-like 40; kelch-like 40 (Drosophila); kelch-like protein 40; LOC316088; similar to kelch repeat and BTB (POZ) domain containing 5

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	KLHL40 (kelch like family member 40)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Klhl40 (kelch-like 40)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Klhl40 (kelch like family member 40)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	KLHL40 (kelch like family member 40)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	KLHL40 (kelch like family member 40)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Klhl40 (kelch like family member 40)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	KLHL40 (kelch like family member 40)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	KLHL40 (kelch like family member 40)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Klhl40 (kelch like family member 40)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	KLHL40 (kelch like family member 40)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Klhl40 (kelch-like 40)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	klhl40b (kelch-like family member 40b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	klhl40a (kelch-like family member 40a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	klhl40	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	130,318,793 - 130,324,309 (+)	NCBI		GRCr8
mRatBN7.2	8	121,441,285 - 121,446,801 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	121,441,287 - 121,446,800 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	127,040,450 - 127,045,966 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	125,239,517 - 125,245,033 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	123,068,719 - 123,074,236 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	130,416,265 - 130,421,871 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	130,416,355 - 130,421,871 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	129,596,172 - 129,601,706 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	127,153,472 - 127,159,307 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	127,173,602 - 127,178,958 (-)	NCBI
Celera	8	120,575,465 - 120,580,981 (+)	NCBI		Celera
Cytogenetic Map	8	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Klhl40	Rat	congenital muscular dystrophy-dystroglycanopathy type A8		ISO	KLHL40 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Muscular dystrophy-dystroglycanopathy (congenital with brain and eye anomalies), type a and 8	ClinVar	PMID:28492532
Klhl40	Rat	genetic disease		ISO	KLHL40 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:25741868 more ...
Klhl40	Rat	nemaline myopathy 8		ISO	KLHL40 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Nemaline myopathy 8	ClinVar	PMID:16199547 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Klhl40	Rat	nemaline myopathy 8		ISS	Klhl40 (Mus musculus)	13592920	OMIM:615348	MouseDO

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Klhl40	Rat	nemaline myopathy 8		ISO	KLHL40 (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Klhl40	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of KLHL40 mRNA	CTD	PMID:32109520 and PMID:33387578
Klhl40	Rat	3,4-methylenedioxymethamphetamine	decreases expression	ISO	Klhl40 (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of KLHL40 mRNA	CTD	PMID:26251327
Klhl40	Rat	3,7-dihydropurine-6-thione	increases expression	EXP		6480464	Mercaptopurine results in increased expression of KLHL40 mRNA	CTD	PMID:23358152
Klhl40	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	Klhl40 (Mus musculus)	6480464	bisphenol S affects the methylation of KLHL40 gene	CTD	PMID:31683443
Klhl40	Rat	Aflatoxin B2 alpha	increases methylation	ISO	KLHL40 (Homo sapiens)	6480464	aflatoxin B2 results in increased methylation of KLHL40 polyA tail	CTD	PMID:30157460
Klhl40	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of KLHL40 mRNA	CTD	PMID:35163327
Klhl40	Rat	alpha-Zearalanol	decreases expression	EXP		6480464	Zeranol results in decreased expression of KLHL40 mRNA	CTD	PMID:35163327
Klhl40	Rat	atrazine	decreases expression	EXP		6480464	Atrazine results in decreased expression of KLHL40 mRNA	CTD	PMID:36841081
Klhl40	Rat	benzo[a]pyrene	affects methylation	ISO	KLHL40 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of KLHL40 exon	CTD	PMID:27901495
Klhl40	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of KLHL40 mRNA	CTD	PMID:25181051
Klhl40	Rat	carbofuran	increases expression	EXP		6480464	Carbofuran results in increased expression of KLHL40 mRNA	CTD	PMID:20211217
Klhl40	Rat	dibutyl phthalate	increases expression	EXP		6480464	Dibutyl Phthalate results in increased expression of KLHL40 mRNA	CTD	PMID:21266533
Klhl40	Rat	dichloroacetic acid	decreases expression	ISO	Klhl40 (Mus musculus)	6480464	Dichloroacetic Acid results in decreased expression of KLHL40 mRNA	CTD	PMID:28962523
Klhl40	Rat	doxorubicin	increases expression	EXP		6480464	Doxorubicin results in increased expression of KLHL40 mRNA	CTD	PMID:20211217
Klhl40	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of KLHL40 mRNA	CTD	PMID:29391264
Klhl40	Rat	ethanol	decreases expression	EXP		6480464	Ethanol results in decreased expression of KLHL40 mRNA	CTD	PMID:31078653
Klhl40	Rat	ethanol	affects expression	ISO	Klhl40 (Mus musculus)	6480464	Ethanol affects the expression of KLHL40 mRNA	CTD	PMID:30319688
Klhl40	Rat	fonofos	increases methylation	ISO	KLHL40 (Homo sapiens)	6480464	Fonofos results in increased methylation of KLHL40 promoter	CTD	PMID:22847954
Klhl40	Rat	genistein	decreases expression	ISO	Klhl40 (Mus musculus)	6480464	Genistein results in decreased expression of KLHL40 mRNA	CTD	PMID:32186404
Klhl40	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of KLHL40 mRNA	CTD	PMID:22061828
Klhl40	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of KLHL40 mRNA	CTD	PMID:33387578
Klhl40	Rat	isoprenaline	increases expression	EXP		6480464	Isoproterenol results in increased expression of KLHL40 mRNA	CTD	PMID:20211217
Klhl40	Rat	leflunomide	decreases expression	ISO	Klhl40 (Mus musculus)	6480464	leflunomide results in decreased expression of KLHL40 mRNA	CTD	PMID:19751817
Klhl40	Rat	mercaptopurine	increases expression	EXP		6480464	Mercaptopurine results in increased expression of KLHL40 mRNA	CTD	PMID:23358152
Klhl40	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of KLHL40 mRNA	CTD	PMID:33387578
Klhl40	Rat	parathion	increases methylation	ISO	KLHL40 (Homo sapiens)	6480464	Parathion results in increased methylation of KLHL40 promoter	CTD	PMID:22847954
Klhl40	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of KLHL40 mRNA	CTD	PMID:35163327
Klhl40	Rat	pioglitazone	multiple interactions	ISO	Klhl40 (Mus musculus)	6480464	[N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of KLHL40 mRNA	CTD	PMID:27935865
Klhl40	Rat	purine-6-thiol	increases expression	EXP		6480464	Mercaptopurine results in increased expression of KLHL40 mRNA	CTD	PMID:23358152
Klhl40	Rat	terbufos	increases methylation	ISO	KLHL40 (Homo sapiens)	6480464	terbufos results in increased methylation of KLHL40 promoter	CTD	PMID:22847954
Klhl40	Rat	titanium dioxide	decreases methylation	ISO	Klhl40 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of KLHL40 gene	CTD	PMID:35295148
Klhl40	Rat	titanium dioxide	increases methylation	ISO	Klhl40 (Mus musculus)	6480464	titanium dioxide results in increased methylation of KLHL40 gene	CTD	PMID:35295148
Klhl40	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of KLHL40 mRNA	CTD	PMID:33387578
Klhl40	Rat	triptonide	increases expression	ISO	Klhl40 (Mus musculus)	6480464	triptonide results in increased expression of KLHL40 mRNA	CTD	PMID:33045310
Klhl40	Rat	valproic acid	affects expression	ISO	KLHL40 (Homo sapiens)	6480464	Valproic Acid affects the expression of KLHL40 mRNA	CTD	PMID:25979313

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Klhl40	Rat	negative regulation of proteasomal ubiquitin-dependent protein catabolic process	involved_in	IBA	MGI:1919580 and PANTHER:PTN000697003	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Klhl40	Rat	negative regulation of proteasomal ubiquitin-dependent protein catabolic process	acts_upstream_of_or_within	ISO	Klhl40 (Mus musculus)	1624291	PMID:24960163	RGD	PMID:24960163
Klhl40	Rat	negative regulation of protein ubiquitination	acts_upstream_of_or_within	ISO	Klhl40 (Mus musculus)	1624291	PMID:24960163	RGD	PMID:24960163
Klhl40	Rat	negative regulation of protein ubiquitination	involved_in	IBA	MGI:1919580 and PANTHER:PTN000697003	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Klhl40	Rat	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	involved_in	ISO	Klhl40 (Mus musculus)	1624291	PMID:25940086	RGD	PMID:25940086
Klhl40	Rat	positive regulation of protein ubiquitination	involved_in	ISO	Klhl40 (Mus musculus)	1624291	PMID:25940086	RGD	PMID:25940086
Klhl40	Rat	proteasome-mediated ubiquitin-dependent protein catabolic process	involved_in	IBA	FB:FBgn0037978 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Klhl40	Rat	proteasome-mediated ubiquitin-dependent protein catabolic process	acts_upstream_of	ISO	Klhl40 (Mus musculus)	1624291	PMID:24960163	RGD	PMID:24960163
Klhl40	Rat	protein ubiquitination	acts_upstream_of	ISO	Klhl40 (Mus musculus)	1624291	PMID:24960163	RGD	PMID:24960163
Klhl40	Rat	skeletal muscle fiber development	involved_in	ISO	Klhl40 (Mus musculus)	1624291	PMID:25940086	RGD	PMID:25940086
Klhl40	Rat	skeletal muscle fiber development	acts_upstream_of_or_within	ISO	Klhl40 (Mus musculus)	1624291	MGI:4843038 PMID:24960163	RGD	PMID:24960163
Klhl40	Rat	skeletal muscle fiber development	involved_in	IBA	MGI:1919580 and PANTHER:PTN000697003	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Klhl40	Rat	skeletal muscle fiber differentiation	involved_in	ISO	Klhl40 (Mus musculus)	1624291	PMID:25940086	RGD	PMID:25940086
Klhl40	Rat	skeletal muscle fiber differentiation	acts_upstream_of_or_within	ISO	Klhl40 (Mus musculus)	1624291	PMID:24361185	RGD	PMID:24361185

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Klhl40	Rat	A band	located_in	IEA	UniProtKB-SubCell:SL-0476	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Klhl40	Rat	A band	located_in	ISO	Klhl40 (Mus musculus)	1624291	PMID:24960163	RGD	PMID:24960163
Klhl40	Rat	A band	is_active_in	IBA	MGI:1919580 and PANTHER:PTN000697003	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Klhl40	Rat	Cul3-RING ubiquitin ligase complex	part_of	IBA	FB:FBgn0037978 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Klhl40	Rat	Cul3-RING ubiquitin ligase complex	part_of	ISO	Klhl40 (Mus musculus)	1624291	PMID:24361185	RGD	PMID:24361185
Klhl40	Rat	cytoplasm	is_active_in	IBA	MGI:1858732 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Klhl40	Rat	cytoplasm	located_in	ISO	Klhl40 (Mus musculus)	1624291	PMID:25940086	RGD	PMID:25940086
Klhl40	Rat	I band	is_active_in	IBA	MGI:1919580 and PANTHER:PTN000697003	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Klhl40	Rat	I band	located_in	ISO	Klhl40 (Mus musculus)	1624291	PMID:24960163	RGD	PMID:24960163
Klhl40	Rat	I band	located_in	IEA	UniProtKB-SubCell:SL-0478	1600115	GO_REF:0000044	UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Klhl40	Rat	protein binding	enables	ISO	Klhl40 (Mus musculus)	1624291	MGI:97292 more ...	RGD	PMID:24361185 more ...
Klhl40	Rat	protein binding	enables	ISO	KLHL40 (Homo sapiens)	1624291	UniProtKB:A1L4K1 more ...	RGD	PMID:25416956 more ...
Klhl40	Rat	ubiquitin-like ligase-substrate adaptor activity	enables	IBA	FB:FBgn0037978 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:24361185	PMID:24960163	PMID:25940086

Klhl40
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	130,318,793 - 130,324,309 (+)	NCBI		GRCr8
mRatBN7.2	8	121,441,285 - 121,446,801 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	121,441,287 - 121,446,800 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	127,040,450 - 127,045,966 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	125,239,517 - 125,245,033 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	123,068,719 - 123,074,236 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	130,416,265 - 130,421,871 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	130,416,355 - 130,421,871 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	129,596,172 - 129,601,706 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	127,153,472 - 127,159,307 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	127,173,602 - 127,178,958 (-)	NCBI
Celera	8	120,575,465 - 120,580,981 (+)	NCBI		Celera
Cytogenetic Map	8	q32	NCBI

KLHL40
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	42,685,537 - 42,692,544 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	42,685,537 - 42,692,544 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	42,727,029 - 42,734,036 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	42,702,015 - 42,708,942 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	42,702,014 - 42,708,942	NCBI
Celera	3	42,667,406 - 42,674,333 (+)	NCBI		Celera
Cytogenetic Map	3	p22.1	NCBI
HuRef	3	42,772,653 - 42,779,580 (+)	NCBI		HuRef
CHM1_1	3	42,678,186 - 42,685,113 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	42,703,548 - 42,710,555 (+)	NCBI		T2T-CHM13v2.0

Klhl40
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	121,606,673 - 121,612,885 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	121,606,673 - 121,612,884 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	121,777,499 - 121,791,200 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	121,777,607 - 121,783,818 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	121,686,725 - 121,692,937 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	121,623,722 - 121,632,518 (+)	NCBI		MGSCv36	mm8
Celera	9	122,250,832 - 122,257,196 (+)	NCBI		Celera
Cytogenetic Map	9	F4	NCBI
cM Map	9	72.61	NCBI

Klhl40
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955420	28,117,898 - 28,122,270 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955420	28,117,553 - 28,122,391 (-)	NCBI	ChiLan1.0	ChiLan1.0

KLHL40
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	42,648,634 - 42,657,268 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	42,653,395 - 42,662,029 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	42,592,977 - 42,600,100 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	43,657,128 - 43,664,055 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	43,657,128 - 43,664,055 (+)	Ensembl	panpan1.1		panPan2

KLHL40
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	23	11,812,268 - 11,820,426 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	23	11,813,550 - 11,820,420 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	23	11,788,054 - 11,794,913 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	23	12,103,227 - 12,110,087 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	23	12,103,414 - 12,110,084 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	23	11,905,185 - 11,912,008 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	23	12,047,337 - 12,054,167 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	23	12,051,398 - 12,058,303 (+)	NCBI		UU_Cfam_GSD_1.0

Klhl40
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	200,063,283 - 200,072,287 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936695	2,414,573 - 2,424,702 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936695	2,417,938 - 2,424,622 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

KLHL40
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	26,202,677 - 26,211,522 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	26,202,607 - 26,211,528 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	28,863,095 - 28,876,907 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

KLHL40
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	4,141,759 - 4,149,158 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	4,142,192 - 4,148,710 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	163,051,860 - 163,059,265 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Klhl40
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	77,007,063 - 77,011,413 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624730	77,004,787 - 77,012,643 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Klhl40
9 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	161
Count of miRNA genes:	117
Interacting mature miRNAs:	128
Transcripts:	ENSRNOT00000026234
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
738011	Anxrr9	Anxiety related response QTL 9	6.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	8	93535351	123900184	Rat
1358903	Bp252	Blood pressure QTL 252	7	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	93965141	123900184	Rat
738014	Anxrr15	Anxiety related response QTL 15	3.6	0.005	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	8	95718998	123900184	Rat
2300182	Bmd56	Bone mineral density QTL 56	5.4		femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	95718998	123900184	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	76468691	121468691	Rat
1358893	Bp263	Blood pressure QTL 263	5.01		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	93965141	123900184	Rat
61437	Cia6	Collagen induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	82460758	122812818	Rat

RH138376

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	121,446,501 - 121,446,635 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	130,421,572 - 130,421,705	NCBI	Rnor6.0
Rnor_5.0	8	129,601,407 - 129,601,540	UniSTS	Rnor5.0
RGSC_v3.4	8	127,153,638 - 127,153,771	UniSTS	RGSC3.4
Celera	8	120,580,682 - 120,580,815	UniSTS
RH 3.4 Map	8	1256.49	UniSTS
Cytogenetic Map	8	q32	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
8	11	49	99	51	48	20	16	20	6	135	88	79	11	54	28


RefSeq Transcripts	NM_001108195	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026234 ⟹ ENSRNOP00000026234

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	121,441,287 - 121,446,800 (+)	Ensembl
Rnor_6.0 Ensembl	8	130,416,355 - 130,421,871 (+)	Ensembl

RefSeq Acc Id:

NM_001108195 ⟹ NP_001101665

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	130,318,793 - 130,324,309 (+)	NCBI
mRatBN7.2	8	121,441,285 - 121,446,801 (+)	NCBI
Rnor_6.0	8	130,416,355 - 130,421,871 (+)	NCBI
Rnor_5.0	8	129,596,172 - 129,601,706 (+)	NCBI
RGSC_v3.4	8	127,153,472 - 127,159,307 (-)	RGD
Celera	8	120,575,465 - 120,580,981 (+)	RGD

Sequence:

show sequence

CAGTCAGTGCACTGCCCCACAGGAGAGCAGAGGTGTGCAGGGCAGCCCTTGACAAACAGACTTGCTGAGTTCCAGAGAGCCGCACCATGACGCTGGGCTTGGAGCAGGCGGAGGAGCAGCGTCTGTAC
CAGCAGACGCTCCTGCAGGATGGCCTCAAGGACATGCTGGACCACGGCAAGTTCCTGGACTGCGTAGTGCGTGTGGGTGAGCGCGAGTTCCCGTGCCACCGCCTGGTGCTGGCTGCCTGCAGCCCCTA
CTTCCGTGCGCGTTTCCTGGCTGAGCCAGATGGCGCGGGAGAGCTACGCCTGGAGGAGGTGTCGCCTGATGTAGTGTCCCAGGTGCTGCACTACCTGTACACATCGGAGATCGCGCTGGACGAGGCAA
GCGTTCAGGACCTGTTTGCCGCGGCGCATCGATTCCAGATCCCGTCCATCTTCACCATCTGCGTGTCGTTCCTGCAGAAGCGCCTGTGCTTGGCTAATTGCCTGGCTGTCTTCCGCCTCGGCCTCCTG
CTGGACTGTGCGCGTCTAGCTGTGGCCGCGCGCGACTTCATCTGCGCACGTTTCCCGCTGGTGGCACGCGACAACGACTTCCTGGGACTCTCAGCTGATGAGCTGATCGCCATCATCTCCAGCGATGG
CCTCAACGTGGAGAAGGAGGAGGCAGTGTTCGAGGCTGTGATGCGCTGGGCCAGCAGCGGCGATGCCGATGTGCAGGCCGAGCACCAGCGTGCGTTGCCCACGGTCTTCGAGAGCATTCGCTGCCGCC
TGCTGCCTCGTGCTTTCCTGGAGAGCCGCGTGGAGCGCCACCCACTTGTGCGCTCCCAGCCTGAGCTGTTGCGCAAGGTACAGATGGTGAAGGACGCACACGAGGGCCGCCTCACTACGCTGCGCAAG
AAAAAGAAGGAGAAGGGTGAGCAGACAGCTCGGACCAAGGAGGCCAACCAGGGCACAGAAGACACCAAGGCTGAGGATGATGAGGAACGAGTGCTGCCCGGGATACTCAATGATACTCTGCGCTTCGG
CATGTTCCTGCAGGATCTCATCTTCATGATCAGCGAGGAGGGCGCTGTGGCGTACGACCCAGCTGCCAACGAGTGCTACTGTGCATCCCTGTCCACCCAGATCCCCAAAAACCATGTCAGTCTCGTGA
CCAAGGAGAACCAAGTCTTCGTGGCCGGTGGCCTCTTCTACAACGAGGACAACAAGGAAGACCCTATGAGTGCTTACTTCCTGCAGTTTGACCACTTGGACTCTGAGTGGCTGGGGATGCCGCCTCTC
CCCTCACCTCGCTGCCTCTTCGGCCTGGGGGAGGCTCTTAATGCCATCTACGTGGTCGGCGGCCGGGAGCTCAAGGACAGCGAAGACAGCCTGGACTCAGTCCTGTGCTACGACAGGCTGTCATTCAA
ATGGGGTGAGTCAGACCCGCTGCCCTATGCGGTTTACGGCCATTCCGTGCTTTCACACATGGACCTTGTCTATGTCATTGGCGGCAAAGGCAAAGACAGGAAATGTCTGAACAAGATGTGTGTCTACG
ACCCCAAGAAGTTTGAGTGGAAGGAGCTAGCACCCATGAAGACAGCCCGCTCACTCTTTGGGGCCACCGTCCATGATGGCCGCATCTTTGTGGCTGCAGGGGTGACAGACACAGGGCTTACCAGCTCC
ACAGAGGTGTACAGCATCGCAGACAACAAGTGGACCCCCTTTGAGGCCTTCCCTCAGGAACGCAGCTCGCTCAGCCTGGTCAGCCTGGCTGGCACCATTCAATGAGGATGAGAAAAAATGGGAGGGGG
TCCTACGAGAGATCGCCTACGCGGCCGGAGCCACCTTCCTCCCTGTGCGCCTCAACGTGCTTCGCCTGACCAAGATGTGACCAGTGCAGGACCCTCACTGAGCCTTCCTCCTGTCCTGTGGCCTCAGA
AAAAAAAGCATCGTGGGACTCAGAGTGGATCTGGGAGAGGCCAGAGCCCTTCTGGTTCCCAGTATGAGTCAGAAAGGGTACTCCAGTCAGGAAAGGGACATTGCTACCTGCTTTCCGGTGTCCCTCTG
GGGTCGCCATGTCTTCTCAAGGACTGCAAAGCTACAGGCAGGCATCCTAGATTGTGTCTTGGCCCTGCCCGGGCTGGCTGTGTGTGCCATACAGTCTCTTGAGGGACTCAGTGCCCGTGCCAGTCAGA
TGGGAGTGTCTCCGTCGATGGCACCTTCTTGTGCTAACCCAGACCTCCCTTAGGAATCTCAGGAACAATAAAGTGCTTTCTGAGCATCTA

hide sequence


Protein RefSeqs	NP_001101665	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL76818	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026234
	ENSRNOP00000026234.6

RefSeq Acc Id:

NP_001101665 ⟸ NM_001108195

- UniProtKB:

D4AA43 (UniProtKB/TrEMBL), A6I459 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTLGLEQAEEQRLYQQTLLQDGLKDMLDHGKFLDCVVRVGEREFPCHRLVLAACSPYFRARFLAEPDGAGELRLEEVSPDVVSQVLHYLYTSEIALDEASVQDLFAAAHRFQIPSIFTICVSFLQKRL
CLANCLAVFRLGLLLDCARLAVAARDFICARFPLVARDNDFLGLSADELIAIISSDGLNVEKEEAVFEAVMRWASSGDADVQAEHQRALPTVFESIRCRLLPRAFLESRVERHPLVRSQPELLRKVQM
VKDAHEGRLTTLRKKKKEKGEQTARTKEANQGTEDTKAEDDEERVLPGILNDTLRFGMFLQDLIFMISEEGAVAYDPAANECYCASLSTQIPKNHVSLVTKENQVFVAGGLFYNEDNKEDPMSAYFLQ
FDHLDSEWLGMPPLPSPRCLFGLGEALNAIYVVGGRELKDSEDSLDSVLCYDRLSFKWGESDPLPYAVYGHSVLSHMDLVYVIGGKGKDRKCLNKMCVYDPKKFEWKELAPMKTARSLFGATVHDGRI
FVAAGVTDTGLTSSTEVYSIADNKWTPFEAFPQERSSLSLVSLAGTIQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000026234 ⟸ ENSRNOT00000026234

Protein Domains

BTB

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4AA43-F1-model_v2	AlphaFold	D4AA43	1-560	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13696391

Promoter ID:

EPDNEW_R6915

Type:

single initiation site

Name:

Klhl40_1

Description:

kelch-like family member 40

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	130,416,356 - 130,416,416	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-28680	BioCyc
Ensembl Genes	ENSRNOG00000019390	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000026234	ENTREZGENE
	ENSRNOT00000026234.6	UniProtKB/TrEMBL
Gene3D-CATH	1.25.40.420	UniProtKB/TrEMBL
	2.120.10.80	UniProtKB/TrEMBL
	Potassium Channel Kv1.1, Chain A	UniProtKB/TrEMBL
InterPro	BACK	UniProtKB/TrEMBL
	BTB/POZ-like	UniProtKB/TrEMBL
	BTB/POZ_fold	UniProtKB/TrEMBL
	Kelch-like_gigaxonin	UniProtKB/TrEMBL
	Kelch-typ_b-propeller	UniProtKB/TrEMBL
	Kelch_1	UniProtKB/TrEMBL
KEGG Report	rno:316088	UniProtKB/TrEMBL
NCBI Gene	316088	ENTREZGENE
PANTHER	KELCH PROTEIN	UniProtKB/TrEMBL
	PTHR24412:SF22	UniProtKB/TrEMBL
Pfam	BACK	UniProtKB/TrEMBL
	BTB	UniProtKB/TrEMBL
	Kelch_1	UniProtKB/TrEMBL
PhenoGen	Klhl40	PhenoGen
PIRSF	Kelch-like_protein_gigaxonin	UniProtKB/TrEMBL
PROSITE	BTB	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000019390	RatGTEx
SMART	BACK	UniProtKB/TrEMBL
	BTB	UniProtKB/TrEMBL
	Kelch	UniProtKB/TrEMBL
Superfamily-SCOP	BTB/POZ_fold	UniProtKB/TrEMBL
	SSF117281	UniProtKB/TrEMBL
UniProt	A6I459	ENTREZGENE, UniProtKB/TrEMBL
	D4AA43	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-05-24	Klhl40	kelch-like family member 40	LOC686128	similar to kelch repeat and BTB (POZ) domain containing 5	Data merged from RGD:1585471	1643240	APPROVED
2013-02-27	Klhl40	kelch-like family member 40	Klhl40	kelch-like 40 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-01-17	Klhl40	kelch-like 40 (Drosophila)	Kbtbd5	kelch repeat and BTB (POZ) domain containing 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Kbtbd5	kelch repeat and BTB (POZ) domain containing 5	Kbtbd5_predicted	kelch repeat and BTB (POZ) domain containing 5 (predicted)	'predicted' is removed	2292626	APPROVED
2006-11-19	LOC686128	similar to kelch repeat and BTB (POZ) domain containing 5			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-01-12	Kbtbd5_predicted	kelch repeat and BTB (POZ) domain containing 5 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM