Symbol:
Alpk1
Name:
alpha-kinase 1
RGD ID:
1304613
Description:
Predicted to enable monosaccharide binding activity and protein serine/threonine kinase activity. Predicted to be involved in several processes, including cilium assembly; cytoplasmic pattern recognition receptor signaling pathway; and positive regulation of canonical NF-kappaB signal transduction. Predicted to act upstream of or within response to bacterium. Predicted to be located in cytosol; microtubule cytoskeleton; and photoreceptor connecting cilium. Predicted to be active in cilium. Orthologous to human ALPK1 (alpha kinase 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-diaminodiphenylmethane; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
alpha-protein kinase 1; LOC310879; RGD1304613; similar to lymphocyte alpha-kinase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ALPK1 (alpha kinase 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Alpk1 (alpha-kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Alpk1 (alpha kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ALPK1 (alpha kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ALPK1 (alpha kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Alpk1 (alpha kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ALPK1 (alpha kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ALPK1 (alpha kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Alpk1 (alpha kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
SHCBP1 (SHC binding and spindle associated 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
ALPK1 (alpha kinase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Alpk1 (alpha-kinase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
alpk1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 218,801,425 - 218,924,013 (-) NCBI GRCr8 mRatBN7.2 2 216,126,939 - 216,247,180 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 216,128,825 - 216,247,157 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 2 231,997,360 - 232,117,471 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 231,996,088 - 232,117,134 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 251,345,268 - 251,462,165 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 224,934,194 - 224,989,819 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 224,888,846 - 224,988,527 (-) NCBI Celera 2 208,443,568 - 208,559,107 (-) NCBI Celera Cytogenetic Map 2 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Alpk1 Rat (1->4)-beta-D-glucan multiple interactions ISO Alpk1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ALPK1 mRNA CTD PMID:36331819 Alpk1 Rat 17beta-estradiol multiple interactions ISO ALPK1 (Homo sapiens) 6480464 [Estradiol co-treated with Norethindrone Acetate] results in increased expression of ALPK1 mRNA CTD PMID:22217510 Alpk1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Alpk1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ALPK1 mRNA CTD PMID:21889950 Alpk1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ALPK1 mRNA CTD PMID:33387578 Alpk1 Rat 2-hydroxypropanoic acid decreases expression ISO ALPK1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of ALPK1 mRNA CTD PMID:30851411 Alpk1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO ALPK1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of ALPK1 mRNA more ... CTD PMID:28628672 Alpk1 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of ALPK1 mRNA CTD PMID:30723492 Alpk1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO ALPK1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of ALPK1 mRNA CTD PMID:28628672 Alpk1 Rat 4-hydroxynon-2-enal decreases expression ISO Alpk1 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in decreased expression of ALPK1 mRNA CTD PMID:19191707 Alpk1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ALPK1 mRNA CTD PMID:30047161 Alpk1 Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione increases expression ISO Alpk1 (Mus musculus) 6480464 Uric Acid results in increased expression of ALPK1 mRNA CTD PMID:27542954 Alpk1 Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione increases response to substance ISO ALPK1 (Homo sapiens) 6480464 ALPK1 protein results in increased susceptibility to Uric Acid CTD PMID:27542954 Alpk1 Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione increases expression ISO ALPK1 (Homo sapiens) 6480464 Uric Acid results in increased expression of ALPK1 mRNA CTD PMID:27542954 Alpk1 Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione multiple interactions ISO ALPK1 (Homo sapiens) 6480464 ALPK1 protein promotes the reaction [Uric Acid results in increased secretion of TGFB1 protein] CTD PMID:27542954 Alpk1 Rat acrolein multiple interactions ISO ALPK1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of ALPK1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of ALPK1 mRNA CTD PMID:32699268 Alpk1 Rat acrylamide increases expression ISO Alpk1 (Mus musculus) 6480464 Acrylamide results in increased expression of ALPK1 mRNA CTD PMID:35032568 Alpk1 Rat aflatoxin B1 decreases expression ISO ALPK1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of ALPK1 mRNA CTD PMID:21641981 and PMID:22100608 Alpk1 Rat aflatoxin B1 increases methylation ISO ALPK1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of ALPK1 gene CTD PMID:27153756 Alpk1 Rat all-trans-retinoic acid increases expression ISO ALPK1 (Homo sapiens) 6480464 Tretinoin results in increased expression of ALPK1 mRNA CTD PMID:33167477 Alpk1 Rat alpha-pinene multiple interactions ISO ALPK1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of ALPK1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of ALPK1 mRNA CTD PMID:32699268 Alpk1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of ALPK1 mRNA CTD PMID:30047161 Alpk1 Rat antirheumatic drug decreases expression ISO ALPK1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of ALPK1 mRNA CTD PMID:24449571 Alpk1 Rat aristolochic acid A decreases expression ISO ALPK1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of ALPK1 mRNA CTD PMID:33212167 Alpk1 Rat arsenite(3-) multiple interactions ISO ALPK1 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to ALPK1 mRNA] CTD PMID:32406909 Alpk1 Rat benzo[a]pyrene increases mutagenesis ISO ALPK1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of ALPK1 gene CTD PMID:25435355 Alpk1 Rat benzo[a]pyrene increases methylation ISO Alpk1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of ALPK1 exon CTD PMID:27901495 Alpk1 Rat benzo[a]pyrene increases methylation ISO ALPK1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ALPK1 5' UTR CTD PMID:27901495 Alpk1 Rat benzo[a]pyrene decreases expression ISO ALPK1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ALPK1 mRNA CTD PMID:20064835 Alpk1 Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of ALPK1 mRNA CTD PMID:29945229 Alpk1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ALPK1 mRNA CTD PMID:25181051 Alpk1 Rat bisphenol A decreases expression ISO Alpk1 (Mus musculus) 6480464 bisphenol A results in decreased expression of ALPK1 mRNA CTD PMID:38074096 Alpk1 Rat bisphenol A increases expression ISO Alpk1 (Mus musculus) 6480464 bisphenol A results in increased expression of ALPK1 mRNA CTD PMID:30951980 Alpk1 Rat bisphenol A increases expression ISO ALPK1 (Homo sapiens) 6480464 bisphenol A results in increased expression of ALPK1 mRNA CTD PMID:29275510 Alpk1 Rat bisphenol A multiple interactions ISO ALPK1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ALPK1 gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of ALPK1 mRNA CTD PMID:28628672 and PMID:31601247 Alpk1 Rat bisphenol F multiple interactions ISO ALPK1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of ALPK1 mRNA CTD PMID:28628672 Alpk1 Rat bisphenol F decreases expression ISO Alpk1 (Mus musculus) 6480464 bisphenol F results in decreased expression of ALPK1 mRNA CTD PMID:38685157 Alpk1 Rat butanal decreases expression ISO ALPK1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of ALPK1 mRNA CTD PMID:26079696 Alpk1 Rat carbon nanotube increases expression ISO Alpk1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Alpk1 Rat CGP 52608 multiple interactions ISO ALPK1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ALPK1 gene] CTD PMID:28238834 Alpk1 Rat copper atom multiple interactions ISO ALPK1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of ALPK1 mRNA CTD PMID:20971185 Alpk1 Rat copper(0) multiple interactions ISO ALPK1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of ALPK1 mRNA CTD PMID:20971185 Alpk1 Rat cyclosporin A increases expression ISO ALPK1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of ALPK1 mRNA CTD PMID:27989131 Alpk1 Rat dexamethasone multiple interactions ISO ALPK1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of ALPK1 mRNA more ... CTD PMID:28628672 Alpk1 Rat Dibutyl phosphate affects expression ISO ALPK1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ALPK1 mRNA CTD PMID:37042841 Alpk1 Rat dimethylarsinic acid multiple interactions ISO Alpk1 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of ALPK1 mRNA CTD PMID:34876320 Alpk1 Rat doxorubicin decreases expression ISO ALPK1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ALPK1 mRNA CTD PMID:29803840 Alpk1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of ALPK1 mRNA CTD PMID:29391264 Alpk1 Rat entinostat increases expression ISO ALPK1 (Homo sapiens) 6480464 entinostat results in increased expression of ALPK1 mRNA CTD PMID:26272509 Alpk1 Rat formaldehyde increases expression ISO ALPK1 (Homo sapiens) 6480464 Formaldehyde results in increased expression of ALPK1 mRNA CTD PMID:27664576 Alpk1 Rat fulvestrant multiple interactions ISO ALPK1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ALPK1 gene CTD PMID:31601247 Alpk1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ALPK1 mRNA CTD PMID:33387578 Alpk1 Rat glufosinate decreases expression ISO Alpk1 (Mus musculus) 6480464 phosphinothricin results in decreased expression of ALPK1 mRNA CTD PMID:34597628 Alpk1 Rat hydroquinone increases expression ISO ALPK1 (Homo sapiens) 6480464 hydroquinone results in increased expression of ALPK1 mRNA CTD PMID:31256213 Alpk1 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of ALPK1 mRNA CTD PMID:21396975 Alpk1 Rat indometacin multiple interactions ISO ALPK1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of ALPK1 mRNA more ... CTD PMID:28628672 Alpk1 Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of ALPK1 mRNA CTD PMID:35283115 Alpk1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of ALPK1 mRNA CTD PMID:30047161 Alpk1 Rat methylarsonic acid multiple interactions ISO Alpk1 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of ALPK1 mRNA CTD PMID:34876320 Alpk1 Rat methylparaben increases expression ISO ALPK1 (Homo sapiens) 6480464 methylparaben results in increased expression of ALPK1 mRNA CTD PMID:31745603 Alpk1 Rat ozone multiple interactions ISO ALPK1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of ALPK1 mRNA more ... CTD PMID:32699268 and PMID:35430440 Alpk1 Rat paracetamol increases expression ISO ALPK1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of ALPK1 mRNA CTD PMID:26690555 Alpk1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ALPK1 mRNA CTD PMID:33387578 Alpk1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Alpk1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ALPK1 mRNA CTD PMID:36331819 Alpk1 Rat potassium dichromate increases expression ISO Alpk1 (Mus musculus) 6480464 Potassium Dichromate results in increased expression of ALPK1 mRNA CTD PMID:23608068 Alpk1 Rat rac-lactic acid decreases expression ISO ALPK1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of ALPK1 mRNA CTD PMID:30851411 Alpk1 Rat resveratrol multiple interactions ISO ALPK1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of ALPK1 mRNA CTD PMID:23557933 Alpk1 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of ALPK1 mRNA CTD PMID:28374803 Alpk1 Rat silicon dioxide decreases expression ISO ALPK1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of ALPK1 mRNA CTD PMID:23806026 and PMID:25895662 Alpk1 Rat sodium arsenate multiple interactions ISO Alpk1 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of ALPK1 mRNA CTD PMID:34876320 Alpk1 Rat sodium arsenite increases expression ISO ALPK1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ALPK1 mRNA CTD PMID:38568856 Alpk1 Rat sodium arsenite multiple interactions ISO Alpk1 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of ALPK1 mRNA CTD PMID:34876320 Alpk1 Rat sodium arsenite affects expression ISO ALPK1 (Homo sapiens) 6480464 sodium arsenite affects the expression of ALPK1 mRNA CTD PMID:34032870 Alpk1 Rat streptozocin multiple interactions ISO ALPK1 (Homo sapiens) 6480464 [ALPK1 protein results in increased susceptibility to Streptozocin] which results in decreased expression of PRKG2 mRNA more ... CTD PMID:27542954 Alpk1 Rat streptozocin increases response to substance ISO ALPK1 (Homo sapiens) 6480464 ALPK1 protein results in increased susceptibility to Streptozocin CTD PMID:27542954 Alpk1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ALPK1 mRNA CTD PMID:23411599 Alpk1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of ALPK1 mRNA CTD PMID:33387578 Alpk1 Rat triclosan increases expression ISO ALPK1 (Homo sapiens) 6480464 Triclosan results in increased expression of ALPK1 mRNA CTD PMID:30510588 Alpk1 Rat triphenyl phosphate affects expression ISO ALPK1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ALPK1 mRNA CTD PMID:37042841 Alpk1 Rat triptonide affects expression ISO Alpk1 (Mus musculus) 6480464 triptonide affects the expression of ALPK1 mRNA CTD PMID:33045310 Alpk1 Rat valproic acid decreases expression ISO ALPK1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ALPK1 mRNA CTD PMID:28001369 Alpk1 Rat valproic acid increases expression ISO ALPK1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ALPK1 mRNA CTD PMID:28001369 and PMID:29154799 Alpk1 Rat vinclozolin decreases methylation EXP 6480464 vinclozolin results in decreased methylation of ALPK1 gene CTD PMID:31079544
(1->4)-beta-D-glucan (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 6-propyl-2-thiouracil (EXP) 7,9-dihydro-1H-purine-2,6,8(3H)-trione (ISO) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) amitrole (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) carbon nanotube (ISO) CGP 52608 (ISO) copper atom (ISO) copper(0) (ISO) cyclosporin A (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dimethylarsinic acid (ISO) doxorubicin (ISO) endosulfan (EXP) entinostat (ISO) formaldehyde (ISO) fulvestrant (ISO) gentamycin (EXP) glufosinate (ISO) hydroquinone (ISO) indole-3-methanol (EXP) indometacin (ISO) lidocaine (EXP) methimazole (EXP) methylarsonic acid (ISO) methylparaben (ISO) ozone (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) potassium dichromate (ISO) rac-lactic acid (ISO) resveratrol (ISO) rotenone (EXP) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) streptozocin (ISO) thioacetamide (EXP) trichloroethene (EXP) triclosan (ISO) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO) vinclozolin (EXP)
Alpk1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 218,801,425 - 218,924,013 (-) NCBI GRCr8 mRatBN7.2 2 216,126,939 - 216,247,180 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 216,128,825 - 216,247,157 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 2 231,997,360 - 232,117,471 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 231,996,088 - 232,117,134 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 251,345,268 - 251,462,165 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 224,934,194 - 224,989,819 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 224,888,846 - 224,988,527 (-) NCBI Celera 2 208,443,568 - 208,559,107 (-) NCBI Celera Cytogenetic Map 2 q42 NCBI
ALPK1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 112,297,369 - 112,442,621 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 112,285,509 - 112,442,621 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 113,218,525 - 113,363,777 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 113,437,948 - 113,583,223 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 113,656,455 - 113,720,433 NCBI Celera 4 110,512,576 - 110,657,856 (+) NCBI Celera Cytogenetic Map 4 q25 NCBI HuRef 4 108,950,042 - 109,095,428 (+) NCBI HuRef CHM1_1 4 113,195,311 - 113,340,525 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 115,605,712 - 115,750,965 (+) NCBI T2T-CHM13v2.0
Alpk1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 127,460,367 - 127,574,195 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 127,463,959 - 127,574,176 (-) Ensembl GRCm39 Ensembl GRCm38 3 127,666,718 - 127,780,547 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 127,670,310 - 127,780,527 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 127,373,228 - 127,483,445 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 127,662,332 - 127,772,549 (-) NCBI MGSCv36 mm8 Celera 3 134,160,957 - 134,282,674 (-) NCBI Celera Cytogenetic Map 3 G2 NCBI cM Map 3 56.54 NCBI
Alpk1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955457 14,325,281 - 14,379,937 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955457 14,325,278 - 14,444,368 (-) NCBI ChiLan1.0 ChiLan1.0
ALPK1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 110,372,767 - 110,517,166 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 110,666,192 - 110,813,772 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 104,786,721 - 104,931,981 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 115,349,826 - 115,495,026 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 115,430,258 - 115,495,026 (+) Ensembl panpan1.1 panPan2
ALPK1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 32 32,135,110 - 32,270,732 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 32 32,136,738 - 32,267,264 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 32 9,763,410 - 9,897,996 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 32 32,358,805 - 32,493,869 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 32 32,364,919 - 32,493,694 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 32 32,341,883 - 32,476,840 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 32 32,102,803 - 32,237,847 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 32 7,622,218 - 7,758,515 (-) NCBI UU_Cfam_GSD_1.0
Alpk1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405301 8,612,620 - 8,737,685 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936563 3,235,181 - 3,296,257 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936563 3,233,913 - 3,296,671 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ALPK1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 110,241,227 - 110,367,912 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 110,241,220 - 110,368,001 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 118,153,267 - 118,184,844 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ALPK1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 60,096,755 - 60,233,569 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 60,202,204 - 60,236,743 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 38,857,444 - 38,994,232 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Alpk1
.
Assembly: RGSC_v3.4 Assembly: Rnor_5.0
Predicted Target Of
Count of predictions: 40 Count of miRNA genes: 38 Interacting mature miRNAs: 40 Transcripts: ENSRNOT00000030798 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 2301408 Kidm36 Kidney mass QTL 36 0.002 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 190613715 226808892 Rat 1598813 Memor9 Memory QTL 9 2.7 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 199341726 234244620 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 1298075 Scl17 Serum cholesterol level QTL 17 3.4 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 211744537 249053267 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 2298479 Eau5 Experimental allergic uveoretinitis QTL 5 0.0021 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 2 202446871 237938339 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 1300126 Bp175 Blood pressure QTL 175 3.46 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 214226044 247136170 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 7207484 Bss108 Bone structure and strength QTL 108 5.3 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 2 211744537 249053267 Rat 2313073 Bmd75 Bone mineral density QTL 75 4.1 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 2 215377404 237938339 Rat 738013 Alc15 Alcohol consumption QTL 15 4.1 0.00022 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 2 184165752 229165752 Rat 61398 Bp50 Blood pressure QTL 50 4.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189599258 234599258 Rat 7207482 Bss107 Bone structure and strength QTL 107 7 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 2 211744537 249053267 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 2317752 Glom23 Glomerulus QTL 23 3.6 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 2 193452645 245889826 Rat 1549836 Bss2 Bone structure and strength QTL 2 7.5 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 2 211744537 249053267 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 2317885 Alcrsp28 Alcohol response QTL 28 2.1 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 212828222 249053267 Rat 1359031 Bp275 Blood pressure QTL 275 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 185876309 219753474 Rat 1581499 Esta2 Estrogen-induced thymic atrophy QTL 2 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 189599258 226936289 Rat 9589044 Scfw1 Subcutaneous fat weight QTL 1 5.8 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 2 182171407 227171407 Rat 8694435 Bw166 Body weight QTL 166 14.08 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 2 182171407 227171407 Rat 61417 Cia10 Collagen induced arthritis QTL 10 3.4 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 2 179946951 224946951 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631203 Gluco14 Glucose level QTL 14 0.0001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 2 206665645 219003804 Rat 8694383 Bw158 Body weight QTL 158 7.69 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 2 182171407 227171407 Rat 1598835 Anxrr18 Anxiety related response QTL 18 2.98 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 2 200990457 245990457 Rat 7207490 Bss111 Bone structure and strength QTL 111 6.4 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 2 211744537 249053267 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1331745 Bp203 Blood pressure QTL 203 4.377 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 189599258 218414891 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 8694194 Abfw1 Abdominal fat weight QTL 1 11.7 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 2 182171407 227171407 Rat 61366 Iddm3 Insulin dependent diabetes mellitus QTL 3 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 189599258 234599258 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 2299161 Iddm33 Insulin dependent diabetes mellitus QTL 33 2.98 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 206312063 220876787 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 2300189 Bmd48 Bone mineral density QTL 48 5.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 179335906 224335906 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat
D2Rat291
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 218,830,334 - 218,830,507 (+) Marker Load Pipeline mRatBN7.2 2 216,155,848 - 216,156,021 (+) MAPPER mRatBN7.2 Rnor_6.0 2 232,024,895 - 232,025,067 NCBI Rnor6.0 Rnor_5.0 2 251,370,383 - 251,370,555 UniSTS Rnor5.0 RGSC_v3.4 2 224,959,151 - 224,959,325 RGD RGSC3.4 RGSC_v3.4 2 224,959,152 - 224,959,324 UniSTS RGSC3.4 RGSC_v3.1 2 224,945,831 - 224,946,005 RGD Celera 2 208,470,906 - 208,471,078 UniSTS SHRSP x BN Map 2 86.3798 UniSTS SHRSP x BN Map 2 86.3798 RGD Cytogenetic Map 2 q42 UniSTS
RH138670
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 83,113,432 - 83,113,679 (+) MAPPER mRatBN7.2 mRatBN7.2 2 216,164,169 - 216,164,413 (+) MAPPER mRatBN7.2 Rnor_6.0 2 232,033,215 - 232,033,458 NCBI Rnor6.0 Rnor_6.0 17 87,490,477 - 87,490,723 NCBI Rnor6.0 Rnor_5.0 17 89,181,425 - 89,181,671 UniSTS Rnor5.0 Rnor_5.0 2 251,378,703 - 251,378,946 UniSTS Rnor5.0 RGSC_v3.4 2 224,967,472 - 224,967,715 UniSTS RGSC3.4 RGSC_v3.4 17 94,592,933 - 94,593,179 UniSTS RGSC3.4 Celera 17 82,379,911 - 82,380,157 UniSTS Celera 2 208,479,226 - 208,479,469 UniSTS Cytogenetic Map 2 q42 UniSTS Cytogenetic Map 17 q12.3 UniSTS Cytogenetic Map 9 q31 UniSTS
RH139278
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 216,129,254 - 216,129,480 (+) MAPPER mRatBN7.2 Rnor_6.0 2 231,998,397 - 231,998,622 NCBI Rnor6.0 Rnor_5.0 2 251,343,921 - 251,344,146 UniSTS Rnor5.0 RGSC_v3.4 2 224,932,276 - 224,932,501 UniSTS RGSC3.4 Celera 2 208,444,605 - 208,444,830 UniSTS RH 3.4 Map 2 1547.1 UniSTS Cytogenetic Map 2 q42 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000030798 ⟹ ENSRNOP00000030809
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 216,128,825 - 216,247,157 (-) Ensembl Rnor_6.0 Ensembl 2 231,996,088 - 232,117,134 (-) Ensembl
RefSeq Acc Id:
XM_017591342 ⟹ XP_017446831
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 218,801,425 - 218,924,012 (-) NCBI mRatBN7.2 2 216,126,939 - 216,247,179 (-) NCBI Rnor_6.0 2 231,997,360 - 232,117,471 (-) NCBI
Sequence:
TAAACTTCTTCAGCACAGCAGACTCAGAAAGGCTCAAAGTTAAAATATTGTTGACCTCTTAAAACTTTCCGATAGAAATGTACTTTGATAAACATTTTAACATCTTTCTGTGTACTTTTGACTTGCTT
hide sequence
RefSeq Acc Id:
XM_039104061 ⟹ XP_038959989
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 218,801,425 - 218,924,013 (-) NCBI mRatBN7.2 2 216,126,939 - 216,247,179 (-) NCBI
RefSeq Acc Id:
XM_039104062 ⟹ XP_038959990
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 218,801,425 - 218,924,013 (-) NCBI mRatBN7.2 2 216,126,939 - 216,247,180 (-) NCBI
RefSeq Acc Id:
XM_063282918 ⟹ XP_063138988
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 218,801,425 - 218,924,009 (-) NCBI
RefSeq Acc Id:
XM_227715 ⟹ XP_227715
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 218,801,425 - 218,924,008 (-) NCBI mRatBN7.2 2 216,126,939 - 216,247,178 (-) NCBI Rnor_6.0 2 231,997,360 - 232,117,470 (-) NCBI Rnor_5.0 2 251,345,268 - 251,462,165 (-) NCBI RGSC_v3.4 2 224,934,194 - 224,989,819 (-) RGD
Sequence:
AAACTTCTTCAGCACAGCAGACTCAGAAAGGCTCAAAGTTAAAATATTGTTGACCTCTTAAAACTTTCCGATAGAAATGTACTTTGATAAACATTTTAACATCTTTCTGTGTACTTTTGACTTGCTTT
hide sequence
RefSeq Acc Id:
XP_227715 ⟸ XM_227715
- Peptide Label:
isoform X3
- Sequence:
MNNQDAVASILHECKQVLDRLLLETPDVSTEDKGEDQRCRASLSGELRTLIQEAKEMKWPFVPEKWQYKQAMSPEDKTNLQDVIGAGLQQLLAALRASILVQDCAAAAAIVFLMDRFLYGLDVSGKLL
hide sequence
RefSeq Acc Id:
XP_017446831 ⟸ XM_017591342
- Peptide Label:
isoform X1
- Sequence:
MNNQDAVASILHECKQVLDRLLLETPDVSTEDKGEDQRCRASLSGELRTLIQEAKEMKWPFVPEKWQYKQAMSPEDKTNLQDVIGAGLQQLLKINVATKMRPTMTGEERAGTTSGKWPAPKTWVLGDY
hide sequence
Ensembl Acc Id:
ENSRNOP00000030809 ⟸ ENSRNOT00000030798
RefSeq Acc Id:
XP_038959990 ⟸ XM_039104062
- Peptide Label:
isoform X2
- UniProtKB:
A6HVL8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038959989 ⟸ XM_039104061
- Peptide Label:
isoform X1
- UniProtKB:
A6HVL8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063138988 ⟸ XM_063282918
- Peptide Label:
isoform X4
- UniProtKB:
A6HVL8 (UniProtKB/TrEMBL)
RGD ID: 13691748 Promoter ID: EPDNEW_R2266 Type: multiple initiation site Name: Alpk1_1 Description: alpha-kinase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 232,117,142 - 232,117,202 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Alpk1
alpha-kinase 1
Alpk1_predicted
alpha-kinase 1 (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-30
Alpk1_predicted
alpha-kinase 1 (predicted)
RGD1304613_predicted
similar to lymphocyte alpha-kinase (predicted)
Symbol and Name updated
1299863 APPROVED
2005-01-20
RGD1304613_predicted
similar to lymphocyte alpha-kinase (predicted)
LOC310879_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC310879_predicted
similar to lymphocyte alpha-kinase (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
