Advanced Search (OLGA)

Gene: PPY (pancreatic polypeptide) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

PPY

Name:

pancreatic polypeptide

RGD ID:

737129

HGNC Page

HGNC:9327

Description:

Enables G protein-coupled receptor binding activity. Predicted to be involved in feeding behavior and neuropeptide signaling pathway. Predicted to be located in extracellular region. Predicted to be active in extracellular space.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

pancreatic polypeptide prohormone; pancreatic polypeptide Y; pancreatic prohormone; PH; PNP; PP; prepro-PP (prepropancreatic polypeptide)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Ppy (pancreatic polypeptide)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):	Ppy (pancreatic polypeptide)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Ppy (pancreatic polypeptide)	NCBI	Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):	PPY (pancreatic polypeptide)	NCBI	Ortholog
Canis lupus familiaris (dog):	PPY (pancreatic polypeptide)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ppy (pancreatic polypeptide)	NCBI	Ortholog
Sus scrofa (pig):	PPY (pancreatic polypeptide)	HGNC	NCBI
Chlorocebus sabaeus (green monkey):	PPY (pancreatic polypeptide)	NCBI	Ortholog
Heterocephalus glaber (naked mole-rat):	Ppy (pancreatic polypeptide)	NCBI	Ortholog
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Ppy (pancreatic polypeptide)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Ppy (pancreatic polypeptide)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Related Pseudogenes:

PPY2P

Allele / Splice:

See ClinVar data

Candidate Gene For:

BW444_H BW453_H

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	43,940,804 - 43,944,215 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	43,940,804 - 43,942,476 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	42,018,172 - 42,019,844 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	39,373,698 - 39,375,359 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	39,373,698 - 39,374,548	NCBI
Celera	17	38,726,213 - 38,727,874 (-)	NCBI		Celera
Cytogenetic Map	17	q21.31	NCBI
HuRef	17	37,782,442 - 37,784,103 (-)	NCBI		HuRef
CHM1_1	17	42,253,758 - 42,255,419 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	44,793,351 - 44,796,763 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
PPY	Human	hereditary breast ovarian cancer syndrome		IAGP	RGD:408382650	8554872	ClinVar Annotator: match by term: Breast-ovarian cancer, familial, susceptibility to, 1	ClinVar	PMID:38922859

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
PPY	Human	17alpha-ethynylestradiol	increases expression	ISO	RGD:11138	6480464	Ethinyl Estradiol results in increased expression of PPY mRNA	CTD	PMID:17942748
PPY	Human	17alpha-ethynylestradiol	multiple interactions	ISO	RGD:11138	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PPY mRNA	CTD	PMID:17942748
PPY	Human	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:11138	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PPY mRNA	CTD	PMID:17942748
PPY	Human	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:3385	6480464	Tetrachlorodibenzodioxin results in decreased expression of PPY mRNA	CTD	PMID:21215274
PPY	Human	3,3',4,4',5-pentachlorobiphenyl	multiple interactions	ISO	RGD:11138	6480464	3,4,5,3',4'-pentachlorobiphenyl inhibits the reaction [aroclor 1260 results in increased expression of PPY mRNA]; aroclor 1260 more ...	CTD	PMID:30312631
PPY	Human	3,3',4,4',5-pentachlorobiphenyl	increases expression	ISO	RGD:11138	6480464	3,4,5,3',4'-pentachlorobiphenyl results in increased expression of PPY mRNA	CTD	PMID:30312631
PPY	Human	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	EXP		6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
PPY	Human	actinomycin D	multiple interactions	EXP		6480464	[Dactinomycin co-treated with nutlin 3] results in increased expression of PPY mRNA	CTD	PMID:38460933
PPY	Human	aflatoxin B1	increases methylation	EXP		6480464	Aflatoxin B1 results in increased methylation of PPY promoter	CTD	PMID:30157460
PPY	Human	all-trans-retinol	multiple interactions	ISO	RGD:11138	6480464	[Vitamin A co-treated with INHBA protein] results in increased expression of PPY mRNA	CTD	PMID:17244017
PPY	Human	ammonium chloride	affects expression	ISO	RGD:3385	6480464	Ammonium Chloride affects the expression of PPY mRNA	CTD	PMID:16483693
PPY	Human	Azoxymethane	multiple interactions	ISO	RGD:11138	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PPY more ...	CTD	PMID:29950665
PPY	Human	benzo[a]pyrene	affects methylation	EXP		6480464	Benzo(a)pyrene affects the methylation of PPY exon	CTD	PMID:27901495
PPY	Human	benzo[a]pyrene	increases methylation	EXP		6480464	Benzo(a)pyrene results in increased methylation of PPY promoter	CTD	PMID:27901495
PPY	Human	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	RGD:11138	6480464	[Streptozocin co-treated with Dietary Fats co-treated with Diethylhexyl Phthalate] results in increased expression of PPY more ...	CTD	PMID:31606821\|PMID:33484791
PPY	Human	bis(2-ethylhexyl) phthalate	increases expression	EXP		6480464	Diethylhexyl Phthalate results in increased expression of PPY mRNA	CTD	PMID:31163220
PPY	Human	bisphenol A	decreases expression	ISO	RGD:3385	6480464	bisphenol A results in decreased expression of PPY mRNA	CTD	PMID:25181051
PPY	Human	bisphenol A	multiple interactions	EXP		6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
PPY	Human	bisphenol A	increases methylation	ISO	RGD:11138	6480464	bisphenol A results in increased methylation of PPY promoter	CTD	PMID:27312807
PPY	Human	carbon nanotube	increases expression	ISO	RGD:11138	6480464	Nanotubes, Carbon analog results in increased expression of PPY mRNA; Nanotubes, Carbon results in increased more ...	CTD	PMID:25554681
PPY	Human	chlorpyrifos	increases secretion	ISO	RGD:3385	6480464	Chlorpyrifos results in increased secretion of PPY protein	CTD	PMID:31400786
PPY	Human	chlorpyrifos	increases expression	ISO	RGD:11138	6480464	Chlorpyrifos results in increased expression of PPY mRNA	CTD	PMID:37019170
PPY	Human	chlorpyrifos	multiple interactions	ISO	RGD:3385	6480464	Dietary Fats inhibits the reaction [Chlorpyrifos results in increased secretion of PPY protein]	CTD	PMID:31400786
PPY	Human	cisplatin	increases expression	EXP		6480464	Cisplatin results in increased expression of PPY mRNA	CTD	PMID:27392435
PPY	Human	cisplatin	multiple interactions	EXP		6480464	[Cisplatin co-treated with jinfukang] results in increased expression of PPY mRNA	CTD	PMID:27392435
PPY	Human	clofibrate	multiple interactions	ISO	RGD:11138	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of PPY mRNA; PPARA affects the reaction [[Clofibrate more ...	CTD	PMID:17585979
PPY	Human	copper(II) sulfate	increases expression	EXP		6480464	Copper Sulfate results in increased expression of PPY mRNA	CTD	PMID:19549813
PPY	Human	dexamethasone	multiple interactions	EXP		6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
PPY	Human	dextran sulfate	multiple interactions	ISO	RGD:11138	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PPY more ...	CTD	PMID:29950665
PPY	Human	ethyl methanesulfonate	increases expression	EXP		6480464	Ethyl Methanesulfonate results in increased expression of PPY mRNA	CTD	PMID:23649840
PPY	Human	indometacin	multiple interactions	EXP		6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
PPY	Human	methyl methanesulfonate	increases expression	EXP		6480464	Methyl Methanesulfonate results in increased expression of PPY mRNA	CTD	PMID:23649840
PPY	Human	Nutlin-3	multiple interactions	EXP		6480464	[Dactinomycin co-treated with nutlin 3] results in increased expression of PPY mRNA	CTD	PMID:38460933
PPY	Human	orlistat	multiple interactions	EXP		6480464	orlistat inhibits the reaction [Triglycerides results in increased secretion of PPY protein]	CTD	PMID:15998659
PPY	Human	ozone	decreases expression	ISO	RGD:3385	6480464	Ozone results in decreased expression of PPY mRNA	CTD	PMID:26667333
PPY	Human	paracetamol	multiple interactions	ISO	RGD:11138	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of PPY mRNA; PPARA affects the reaction [[Clofibrate more ...	CTD	PMID:17585979
PPY	Human	sodium arsenite	increases expression	EXP		6480464	sodium arsenite results in increased expression of PPY mRNA	CTD	PMID:38568856
PPY	Human	streptozocin	multiple interactions	ISO	RGD:11138	6480464	[Streptozocin co-treated with Dietary Fats co-treated with Diethylhexyl Phthalate] results in increased expression of PPY more ...	CTD	PMID:31606821\|PMID:33484791
PPY	Human	streptozocin	increases expression	ISO	RGD:11138	6480464	Streptozocin results in increased expression of PPY mRNA	CTD	PMID:31606821
PPY	Human	titanium dioxide	increases expression	ISO	RGD:11138	6480464	titanium dioxide results in increased expression of PPY mRNA	CTD	PMID:27760801
PPY	Human	titanium dioxide	multiple interactions	ISO	RGD:11138	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PPY more ...	CTD	PMID:29950665
PPY	Human	triptonide	increases expression	ISO	RGD:11138	6480464	triptonide results in increased expression of PPY mRNA	CTD	PMID:33045310
PPY	Human	valproic acid	increases methylation	EXP		6480464	Valproic Acid results in increased methylation of PPY gene	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
PPY	Human	feeding behavior	involved_in	IBA	MGI:99924\|PANTHER:PTN000056513\|RGD:3197	150520179		GO_Central	GO_REF:0000033
PPY	Human	neuropeptide signaling pathway	involved_in	IBA	PANTHER:PTN000056513\|RGD:3197	150520179		GO_Central	GO_REF:0000033
PPY	Human	protein secretion	involved_in	TAS		150520179	PMID:2997153	PINC	PMID:2997153
PPY	Human	signal transduction	involved_in	IEA	GO:0005179	150520179		GOC	GO_REF:0000108

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
PPY	Human	cytoplasm	located_in	IEA	UniProtKB:P10601\|ensembl:ENSMUSP00000017460	150520179		Ensembl	GO_REF:0000107
PPY	Human	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	150520179		UniProt	GO_REF:0000044
PPY	Human	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	150520179		UniProt	GO_REF:0000043
PPY	Human	extracellular region	located_in	IEA	InterPro:IPR001955	150520179		InterPro	GO_REF:0000002
PPY	Human	extracellular region	located_in	TAS		150520179		Reactome	Reactome:R-HSA-380073\|Reactome:R-HSA-388863\|Reactome:R-HSA-749454\|Reactome:R-HSA-749456
PPY	Human	extracellular space	located_in	IEA	UniProtKB:P10601\|ensembl:ENSMUSP00000017460	150520179		Ensembl	GO_REF:0000107
PPY	Human	extracellular space	is_active_in	IBA	MGI:97753\|MGI:99924\|PANTHER:PTN000056513\|RGD:1593289\|RGD:3197	150520179		GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
PPY	Human	G protein-coupled receptor binding	enables	IEA	UniProtKB:P10601\|ensembl:ENSMUSP00000017460	150520179		Ensembl	GO_REF:0000107
PPY	Human	G protein-coupled receptor binding	enables	IPI	UniProtKB:P50391	150520179	PMID:7493937, PMID:7592911	GO_Central	PMID:7493937\|PMID:7592911
PPY	Human	hormone activity	enables	IEA	InterPro:IPR001955	150520179		InterPro	GO_REF:0000002
PPY	Human	hormone activity	enables	IEA	UniProtKB-KW:KW-0372	150520179		UniProt	GO_REF:0000043
PPY	Human	hormone activity	enables	TAS		150520179	PMID:2997153	PINC	PMID:2997153
PPY	Human	neuropeptide hormone activity	enables	IBA	MGI:99924\|PANTHER:PTN000056513	150520179		GO_Central	GO_REF:0000033
PPY	Human	neuropeptide Y receptor binding	enables	IBA	PANTHER:PTN000056513\|RGD:3197\|ZFIN:ZDB-GENE-060215-2\|ZFIN:ZDB-GENE-980526-438\|ZFIN:ZDB-GENE-980526-71	150520179		GO_Central	GO_REF:0000033
PPY	Human	protein binding	enables	IPI	UniProtKB:A8MQ03	150520179	PMID:32296183	IntAct	PMID:32296183

#	Reference Title	Reference Citation
1.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:782992	PMID:1194289	PMID:2997153	PMID:3753985	PMID:6094571	PMID:6138294	PMID:6366786	PMID:6373251	PMID:7014602	PMID:7031480	PMID:7493937	PMID:7592911
PMID:8244379	PMID:11825640	PMID:11825647	PMID:11825648	PMID:12187924	PMID:12477932	PMID:14988250	PMID:15489334	PMID:15561938	PMID:15966750	PMID:15998659	PMID:15998783
PMID:16359755	PMID:17171555	PMID:17235527	PMID:17325259	PMID:18577758	PMID:21813805	PMID:21873635	PMID:22020285	PMID:22399387	PMID:22673566	PMID:22979996	PMID:23371976
PMID:23956349	PMID:24375409	PMID:25445712	PMID:25990478	PMID:26002416	PMID:26766123	PMID:27918953	PMID:28027898	PMID:29771765	PMID:32296183	PMID:33918032	PMID:33961781
PMID:34294685

PPY
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	43,940,804 - 43,944,215 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	43,940,804 - 43,942,476 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	42,018,172 - 42,019,844 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	39,373,698 - 39,375,359 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	39,373,698 - 39,374,548	NCBI
Celera	17	38,726,213 - 38,727,874 (-)	NCBI		Celera
Cytogenetic Map	17	q21.31	NCBI
HuRef	17	37,782,442 - 37,784,103 (-)	NCBI		HuRef
CHM1_1	17	42,253,758 - 42,255,419 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	44,793,351 - 44,796,763 (-)	NCBI		T2T-CHM13v2.0

Ppy
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	101,990,757 - 101,992,145 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	101,990,756 - 101,992,145 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	102,099,931 - 102,101,319 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	102,099,930 - 102,101,319 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	101,961,245 - 101,962,614 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	101,916,021 - 101,917,390 (-)	NCBI		MGSCv36	mm8
Celera	11	113,805,823 - 113,807,218 (-)	NCBI		Celera
Cytogenetic Map	11	D	NCBI
cM Map	11	65.48	NCBI

Ppy
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	87,554,941 - 87,556,236 (-)	NCBI		GRCr8
mRatBN7.2	10	87,054,747 - 87,056,044 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	87,054,756 - 87,055,455 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	92,084,611 - 92,085,906 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	91,556,506 - 91,557,781 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	86,949,824 - 86,951,097 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	90,041,582 - 90,043,316 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	90,041,591 - 90,042,877 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	89,831,063 - 89,832,358 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	91,167,958 - 91,169,253 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	91,182,327 - 91,183,623 (-)	NCBI
Celera	10	85,772,353 - 85,773,648 (-)	NCBI		Celera
Cytogenetic Map	10	q32.1	NCBI

Ppy
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955451	17,155,876 - 17,156,214 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955451	17,155,681 - 17,156,829 (-)	NCBI	ChiLan1.0	ChiLan1.0

PPY
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	20,963,508 - 20,965,182 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	22,927,788 - 22,929,460 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	13,452,839 - 13,454,513 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	13,619,132 - 13,620,788 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	13,619,936 - 13,620,788 (+)	Ensembl	panpan1.1		panPan2

PPY
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	19,394,185 - 19,395,750 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	19,394,183 - 19,395,750 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	18,784,564 - 18,785,316 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	20,089,261 - 20,090,853 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	20,090,101 - 20,090,853 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	18,943,380 - 18,944,132 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	19,126,341 - 19,127,093 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	19,271,259 - 19,272,011 (+)	NCBI		UU_Cfam_GSD_1.0

Ppy
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	18,730,726 - 18,731,524 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936541	463,068 - 464,542 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936541	463,069 - 463,872 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PPY
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	19,217,806 - 19,218,559 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	19,217,649 - 19,218,680 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	19,451,675 - 19,455,138 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PPY
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	62,450,284 - 62,453,995 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	62,453,141 - 62,453,871 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	33,225,253 - 33,228,638 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ppy
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624795	908,495 - 909,435 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in PPY
8 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	2007
Count of miRNA genes:	590
Interacting mature miRNAs:	690
Transcripts:	ENST00000225992, ENST00000587006, ENST00000587070, ENST00000587926, ENST00000591228, ENST00000591703
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

RH80047

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	17	42,018,180 - 42,018,570	UniSTS	GRCh37
GRCh37	17	26,574,918 - 26,575,306	UniSTS	GRCh37
Build 36	17	23,599,045 - 23,599,433	RGD	NCBI36
Celera	17	38,726,221 - 38,726,611	UniSTS
Celera	17	23,436,651 - 23,437,039	RGD
Cytogenetic Map	17	q11	UniSTS
Cytogenetic Map	17	q21	UniSTS
HuRef	17	37,782,450 - 37,782,840	UniSTS
HuRef	17	22,782,949 - 22,783,337	UniSTS

GDB:178570

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	17	42,018,101 - 42,018,351	UniSTS	GRCh37
Build 36	17	39,373,627 - 39,373,877	RGD	NCBI36
Celera	17	38,726,142 - 38,726,392	RGD
Cytogenetic Map	17	q21	UniSTS
HuRef	17	37,782,371 - 37,782,621	UniSTS

RH71368

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	17	42,018,031 - 42,018,156	UniSTS	GRCh37
Build 36	17	39,373,557 - 39,373,682	RGD	NCBI36
Celera	17	38,726,072 - 38,726,197	RGD
Cytogenetic Map	17	q21	UniSTS
HuRef	17	37,782,301 - 37,782,426	UniSTS
GeneMap99-GB4 RH Map	17	322.36	UniSTS

GDB:180950

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	17	42,018,272 - 42,018,970	UniSTS	GRCh37
Celera	17	38,726,313 - 38,727,011	UniSTS
Cytogenetic Map	17	q21	UniSTS
HuRef	17	37,782,542 - 37,783,240	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system
223	775	540	322	1453	751	811	2	94	599	72	791	1562	1348	12	802	166	688	697	26


RefSeq Transcripts	NM_001319209	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_002722	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_011524978	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_054316627	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC007993	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC032225	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC040033	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BI838025	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BP384893	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BP388331	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BP394217	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471178	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068261	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M11726	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M15788	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X00491	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000225992 ⟹ ENSP00000225992

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	17	43,940,804 - 43,942,476 (-)	Ensembl

Ensembl Acc Id:

ENST00000587006 ⟹ ENSP00000465711

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	17	43,940,815 - 43,941,654 (-)	Ensembl

Ensembl Acc Id:

ENST00000587070 ⟹ ENSP00000489472

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	17	43,940,804 - 43,941,514 (-)	Ensembl

Ensembl Acc Id:

ENST00000587926

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	17	43,940,804 - 43,941,299 (-)	Ensembl

Ensembl Acc Id:

ENST00000591228 ⟹ ENSP00000466009

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	17	43,940,805 - 43,942,274 (-)	Ensembl

Ensembl Acc Id:

ENST00000591703 ⟹ ENSP00000466546

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	17	43,940,804 - 43,942,465 (-)	Ensembl

RefSeq Acc Id:

NM_001319209 ⟹ NP_001306138

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	17	43,940,804 - 43,942,274 (-)	NCBI
CHM1_1	17	42,253,756 - 42,255,228 (-)	NCBI
T2T-CHM13v2.0	17	44,793,351 - 44,794,821 (-)	NCBI

Sequence:

show sequence

GTCACGCTAGAAGAGCCGTCTGCTGACTGCACGTGTGTGTGCACACTCGTGTGCATGGCTGTGAACTGGAATGTGTGACTGTGACCTTATGGCTGCCGCACGCCTCTGCCTCTCCCTGCTGCTCCTGT
CCACCTGCGTGGCTCTGTTACTACAGCCACTGCTGGGTGCCCAGGGAGCCCCACTGGAGCCAGTGTACCCAGGGGACAATGCCACACCAGAGCAGATGGCCCAGTATGCAGCTGATCTCCGTAGATAC
ATCAACATGCTGACCAGGCCTAGGTATGGGAAAAGACACAAAGAGGACACGCTGGCCTTCTCGGAGTGGGGGTCCCCGCATGCTGCTGTCCCCAGGGAGCTCAGCCCGCTGGACTTATAATGCCACCT
TCTGTCTCCTACGACTCCATGAGCAGCGCCAGCCCAGCTCTCCCCTCTGCACCCTTGGCTCTGGCCAAAGCTTGCTCCCTGCTCCCACACAGGCTCAATAAAGCAAGTCAAAGCCA

hide sequence

RefSeq Acc Id:

NM_002722 ⟹ NP_002713

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	17	43,940,804 - 43,942,476 (-)	NCBI
GRCh37	17	42,018,172 - 42,019,833 (-)	ENTREZGENE
Build 36	17	39,373,698 - 39,375,359 (-)	NCBI Archive
HuRef	17	37,782,442 - 37,784,103 (-)	ENTREZGENE
CHM1_1	17	42,253,756 - 42,255,421 (-)	NCBI
T2T-CHM13v2.0	17	44,793,351 - 44,795,023 (-)	NCBI

Sequence:

show sequence

ATCCGGCCTGAGGCAGGTGCTCGCTTGGTCTAGTGCCCATTTACTCTGGACTCCGGATGGCTGCCGCACGCCTCTGCCTCTCCCTGCTGCTCCTGTCCACCTGCGTGGCTCTGTTACTACAGCCACTG
CTGGGTGCCCAGGGAGCCCCACTGGAGCCAGTGTACCCAGGGGACAATGCCACACCAGAGCAGATGGCCCAGTATGCAGCTGATCTCCGTAGATACATCAACATGCTGACCAGGCCTAGGTATGGGAA
AAGACACAAAGAGGACACGCTGGCCTTCTCGGAGTGGGGGTCCCCGCATGCTGCTGTCCCCAGGGAGCTCAGCCCGCTGGACTTATAATGCCACCTTCTGTCTCCTACGACTCCATGAGCAGCGCCAG
CCCAGCTCTCCCCTCTGCACCCTTGGCTCTGGCCAAAGCTTGCTCCCTGCTCCCACACAGGCTCAATAAAGCAAGTCAAAGCCA

hide sequence

RefSeq Acc Id:

XM_011524978 ⟹ XP_011523280

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	17	43,940,804 - 43,944,215 (-)	NCBI

Sequence:

show sequence

CCTGTGGGAGCTCAGATCCTTTTAACTAGGGTTGGAGCCTGGCGCCCTCTGGCGGCGAGCTGCAACCTCTACCCGCCAAACCCAAGGCCAGGCTGAGACCAGCCACCAATTCACACCCTTGTTTTGCA
AGTGGAAAACCTCAGTCCAGAGAAAGGCCCGGGCTTGCTGAGACAGAATGACTTTCGTATTTGCTTTGTGGAATATGGCTGCCGCACGCCTCTGCCTCTCCCTGCTGCTCCTGTCCACCTGCGTGGCT
CTGTTACTACAGCCACTGCTGGGTGCCCAGGGAGCCCCACTGGAGCCAGTGTACCCAGGGGACAATGCCACACCAGAGCAGATGGCCCAGTATGCAGCTGATCTCCGTAGATACATCAACATGCTGAC
CAGGCCTAGGTATGGGAAAAGACACAAAGAGGACACGCTGGCCTTCTCGGAGTGGGGGTCCCCGCATGCTGCTGTCCCCAGGGAGCTCAGCCCGCTGGACTTATAATGCCACCTTCTGTCTCCTACGA
CTCCATGAGCAGCGCCAGCCCAGCTCTCCCCTCTGCACCCTTGGCTCTGGCCAAAGCTTGCTCCCTGCTCCCACACAGGCTCAATAAAGCAAGTCAAAGCCACA

hide sequence

RefSeq Acc Id:

XM_054316627 ⟹ XP_054172602

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
T2T-CHM13v2.0	17	44,793,351 - 44,796,763 (-)	NCBI


Protein RefSeqs	NP_001306138	(Get FASTA)	NCBI Sequence Viewer
	NP_002713	(Get FASTA)	NCBI Sequence Viewer
	XP_011523280	(Get FASTA)	NCBI Sequence Viewer
	XP_054172602	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA60156	(Get FASTA)	NCBI Sequence Viewer
	AAA60161	(Get FASTA)	NCBI Sequence Viewer
	AAH32225	(Get FASTA)	NCBI Sequence Viewer
	AAH40033	(Get FASTA)	NCBI Sequence Viewer
	CAA25161	(Get FASTA)	NCBI Sequence Viewer
	EAW51649	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000225992
	ENSP00000225992.3
	ENSP00000466009.1
GenBank Protein	P01298	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_002713 ⟸ NM_002722
- Peptide Label:	isoform 1 preproprotein
- UniProtKB:	P01298 (UniProtKB/Swiss-Prot), K7EKP2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL hide sequence

RefSeq Acc Id:	XP_011523280 ⟸ XM_011524978
- Peptide Label:	isoform X1
- UniProtKB:	K7EKP2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTFVFALWNMAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL hide sequence

RefSeq Acc Id:	NP_001306138 ⟸ NM_001319209
- Peptide Label:	isoform 2 precursor
- UniProtKB:	K7EKP2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MCDCDLMAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL hide sequence

Ensembl Acc Id:

ENSP00000465711 ⟸ ENST00000587006

Ensembl Acc Id:

ENSP00000489472 ⟸ ENST00000587070

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P01298-F1-model_v2	AlphaFold	P01298	1-95	view protein structure

RGD ID:

7235211

Promoter ID:

EPDNEW_H23351

Type:

multiple initiation site

Name:

PPY_1

Description:

pancreatic polypeptide

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H23352

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	17	43,942,476 - 43,942,536	EPDNEW

RGD ID:

7235213

Promoter ID:

EPDNEW_H23352

Type:

initiation region

Name:

PPY_2

Description:

pancreatic polypeptide

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H23351

Experiment Methods:

Single-end sequencing.; Paired-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	17	43,944,071 - 43,944,131	EPDNEW

Database	Acc Id	Source(s)
COSMIC	PPY	COSMIC
Ensembl Genes	ENSG00000108849	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000225992	ENTREZGENE
	ENST00000225992.8	UniProtKB/Swiss-Prot
	ENST00000591228.4	UniProtKB/Swiss-Prot
Gene3D-CATH	6.10.250.900	UniProtKB/Swiss-Prot
GTEx	ENSG00000108849	GTEx
HGNC ID	HGNC:9327	ENTREZGENE
Human Proteome Map	PPY	Human Proteome Map
InterPro	Pancreatic_hormone-like	UniProtKB/Swiss-Prot
	Pancreatic_hormone-like_CS	UniProtKB/Swiss-Prot
KEGG Report	hsa:5539	UniProtKB/Swiss-Prot
NCBI Gene	5539	ENTREZGENE
OMIM	167780	OMIM
PANTHER	PTHR10533	UniProtKB/Swiss-Prot
	PTHR10533:SF2	UniProtKB/Swiss-Prot
Pfam	Hormone_3	UniProtKB/Swiss-Prot
PharmGKB	PA33690	PharmGKB
PRINTS	PANCHORMONE	UniProtKB/Swiss-Prot
PROSITE	PANCREATIC_HORMONE_1	UniProtKB/Swiss-Prot
	PANCREATIC_HORMONE_2	UniProtKB/Swiss-Prot
SMART	PAH	UniProtKB/Swiss-Prot
UniProt	A0A0U1RRD5_HUMAN	UniProtKB/TrEMBL
	K7EKP2	ENTREZGENE, UniProtKB/TrEMBL
	K7EML0_HUMAN	UniProtKB/TrEMBL
	P01298	ENTREZGENE, UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar