Symbol:
Plekhh1
Name:
pleckstrin homology domain containing, family H (with MyTH4 domain) member 1
RGD ID:
408345569
MGI Page
MGI
Description:
Predicted to be located in cytoskeleton. Is expressed in genitourinary system. Orthologous to human PLEKHH1 (pleckstrin homology, MyTH4 and FERM domain containing H1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
D630024D12Rik; mKIAA1200; PH domain-containing family H member 1; pleckstrin homology domain-containing family H member 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PLEKHH1 (pleckstrin homology, MyTH4 and FERM domain containing H1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Plekhh1 (pleckstrin homology, MyTH4 and FERM domain containing H1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Plekhh1 (pleckstrin homology, MyTH4 and FERM domain containing H1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PLEKHH1 (pleckstrin homology, MyTH4 and FERM domain containing H1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PLEKHH1 (pleckstrin homology, MyTH4 and FERM domain containing H1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Plekhh1 (pleckstrin homology, MyTH4 and FERM domain containing H1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PLEKHH1 (pleckstrin homology, MyTH4 and FERM domain containing H1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Plekhh1 (pleckstrin homology, MyTH4 and FERM domain containing H1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PLEKHH2 (pleckstrin homology, MyTH4 and FERM domain containing H2) HGNC
OrthoMCL
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 79,075,937 - 79,128,429 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 79,075,937 - 79,128,429 (+) Ensembl GRCm39 Ensembl GRCm38 12 79,029,163 - 79,081,655 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 Cytogenetic Map 12 C3 NCBI cM Map 12 35.51 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Plekhh1 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PLEKHH1 mRNA CTD PMID:22206623 Plekhh1 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of PLEKHH1 mRNA] CTD PMID:22206623 Plekhh1 Mouse 1-naphthyl isothiocyanate increases expression ISO Plekhh1 (Rattus norvegicus) 6480464 1-Naphthylisothiocyanate results in increased expression of PLEKHH1 mRNA CTD PMID:25380136 Plekhh1 Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of PLEKHH1 mRNA CTD PMID:19484750 and PMID:39298647 Plekhh1 Mouse 17beta-estradiol multiple interactions ISO Plekhh1 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of PLEKHH1 mRNA CTD PMID:26496021 Plekhh1 Mouse 17beta-estradiol increases expression ISO PLEKHH1 (Homo sapiens) 6480464 Estradiol results in increased expression of PLEKHH1 mRNA CTD PMID:31614463 Plekhh1 Mouse 2,2',4,4'-Tetrabromodiphenyl ether affects expression EXP 6480464 2 more ... CTD PMID:24680724 Plekhh1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PLEKHH1 mRNA CTD PMID:26377647 Plekhh1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Plekhh1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PLEKHH1 mRNA CTD PMID:33387578 Plekhh1 Mouse 2-methoxyethanol increases expression ISO Plekhh1 (Rattus norvegicus) 6480464 methyl cellosolve results in increased expression of PLEKHH1 mRNA CTD PMID:21061450 Plekhh1 Mouse 4,4'-diaminodiphenylmethane increases expression ISO Plekhh1 (Rattus norvegicus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of PLEKHH1 mRNA CTD PMID:25380136 Plekhh1 Mouse 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of PLEKHH1 mRNA CTD PMID:28973697 Plekhh1 Mouse 6-propyl-2-thiouracil decreases expression ISO Plekhh1 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of PLEKHH1 mRNA CTD PMID:24780913 Plekhh1 Mouse acrylamide decreases expression ISO PLEKHH1 (Homo sapiens) 6480464 Acrylamide results in decreased expression of PLEKHH1 mRNA CTD PMID:32763439 Plekhh1 Mouse acrylamide decreases expression ISO Plekhh1 (Rattus norvegicus) 6480464 Acrylamide results in decreased expression of PLEKHH1 mRNA CTD PMID:28959563 Plekhh1 Mouse aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of PLEKHH1 mRNA CTD PMID:19770486 Plekhh1 Mouse all-trans-retinoic acid decreases expression ISO PLEKHH1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of PLEKHH1 mRNA CTD PMID:33167477 Plekhh1 Mouse all-trans-retinoic acid increases expression ISO PLEKHH1 (Homo sapiens) 6480464 Tretinoin results in increased expression of PLEKHH1 mRNA CTD PMID:21934132 Plekhh1 Mouse aristolochic acid A decreases expression ISO PLEKHH1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PLEKHH1 mRNA CTD PMID:33212167 Plekhh1 Mouse arsane multiple interactions ISO PLEKHH1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PLEKHH1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PLEKHH1 mRNA CTD PMID:39836092 Plekhh1 Mouse arsenic atom multiple interactions ISO PLEKHH1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PLEKHH1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PLEKHH1 mRNA CTD PMID:39836092 Plekhh1 Mouse benzo[a]pyrene decreases methylation ISO PLEKHH1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of PLEKHH1 5' UTR and Benzo(a)pyrene results in decreased methylation of PLEKHH1 promoter CTD PMID:27901495 Plekhh1 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of PLEKHH1 mRNA CTD PMID:19770486 Plekhh1 Mouse bisphenol A affects expression ISO Plekhh1 (Rattus norvegicus) 6480464 bisphenol A affects the expression of PLEKHH1 mRNA CTD PMID:25181051 Plekhh1 Mouse bisphenol A increases expression ISO Plekhh1 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of PLEKHH1 mRNA CTD PMID:30816183 and PMID:32528016 Plekhh1 Mouse bisphenol A multiple interactions ISO PLEKHH1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PLEKHH1 gene CTD PMID:31601247 Plekhh1 Mouse bisphenol A decreases expression ISO PLEKHH1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PLEKHH1 mRNA CTD PMID:33670352 Plekhh1 Mouse bisphenol A multiple interactions ISO Plekhh1 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of PLEKHH1 mRNA CTD PMID:26496021 Plekhh1 Mouse bisphenol A decreases expression ISO Plekhh1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of PLEKHH1 mRNA CTD PMID:34947998 Plekhh1 Mouse C60 fullerene increases expression ISO Plekhh1 (Rattus norvegicus) 6480464 fullerene C60 results in increased expression of PLEKHH1 mRNA CTD PMID:19167457 Plekhh1 Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes and Carbon analog results in decreased expression of PLEKHH1 mRNA CTD PMID:25554681 Plekhh1 Mouse CGP 52608 multiple interactions ISO PLEKHH1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PLEKHH1 gene] CTD PMID:28238834 Plekhh1 Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PLEKHH1 mRNA CTD PMID:20938992 Plekhh1 Mouse Cuprizon decreases expression ISO Plekhh1 (Rattus norvegicus) 6480464 Cuprizone results in decreased expression of PLEKHH1 mRNA CTD PMID:27523638 Plekhh1 Mouse dicrotophos increases expression ISO PLEKHH1 (Homo sapiens) 6480464 dicrotophos results in increased expression of PLEKHH1 mRNA CTD PMID:28302478 Plekhh1 Mouse dorsomorphin multiple interactions ISO PLEKHH1 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PLEKHH1 mRNA CTD PMID:27188386 Plekhh1 Mouse folic acid multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PLEKHH1 mRNA more ... CTD PMID:20938992 and PMID:22206623 Plekhh1 Mouse FR900359 affects phosphorylation ISO PLEKHH1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of PLEKHH1 protein CTD PMID:37730182 Plekhh1 Mouse fulvestrant multiple interactions ISO PLEKHH1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PLEKHH1 gene CTD PMID:31601247 Plekhh1 Mouse gentamycin increases expression ISO Plekhh1 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of PLEKHH1 mRNA CTD PMID:33387578 Plekhh1 Mouse glyphosate increases expression EXP 6480464 Glyphosate results in increased expression of PLEKHH1 mRNA CTD PMID:35897073 Plekhh1 Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PLEKHH1 mRNA CTD PMID:20938992 Plekhh1 Mouse manganese atom multiple interactions ISO PLEKHH1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PLEKHH1 mRNA CTD PMID:39836092 Plekhh1 Mouse manganese(0) multiple interactions ISO PLEKHH1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PLEKHH1 mRNA CTD PMID:39836092 Plekhh1 Mouse manganese(II) chloride multiple interactions ISO PLEKHH1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PLEKHH1 mRNA CTD PMID:39836092 Plekhh1 Mouse manganese(II) chloride increases expression ISO Plekhh1 (Rattus norvegicus) 6480464 manganese chloride results in increased expression of PLEKHH1 mRNA CTD PMID:28801915 Plekhh1 Mouse methylmercury chloride decreases expression ISO PLEKHH1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PLEKHH1 mRNA CTD PMID:28001369 Plekhh1 Mouse monosodium L-glutamate increases expression EXP 6480464 Sodium Glutamate results in increased expression of PLEKHH1 mRNA CTD PMID:22078008 Plekhh1 Mouse N-methyl-4-phenylpyridinium increases expression ISO Plekhh1 (Rattus norvegicus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of PLEKHH1 mRNA CTD PMID:28801915 Plekhh1 Mouse nickel atom decreases expression ISO PLEKHH1 (Homo sapiens) 6480464 Nickel results in decreased expression of PLEKHH1 mRNA CTD PMID:24768652 and PMID:25583101 Plekhh1 Mouse orphenadrine affects expression ISO Plekhh1 (Rattus norvegicus) 6480464 Orphenadrine affects the expression of PLEKHH1 mRNA CTD PMID:23665939 Plekhh1 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of PLEKHH1 mRNA CTD PMID:27106289 Plekhh1 Mouse p-chloromercuribenzoic acid decreases expression ISO PLEKHH1 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in decreased expression of PLEKHH1 mRNA CTD PMID:26272509 Plekhh1 Mouse p-chloromercuribenzoic acid multiple interactions ISO PLEKHH1 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PLEKHH1 mRNA CTD PMID:27188386 Plekhh1 Mouse paracetamol increases expression ISO PLEKHH1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of PLEKHH1 mRNA CTD PMID:22230336 and PMID:29067470 Plekhh1 Mouse paracetamol increases expression ISO Plekhh1 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of PLEKHH1 mRNA CTD PMID:33387578 Plekhh1 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of PLEKHH1 mRNA CTD PMID:17562736 Plekhh1 Mouse pentachlorophenol increases expression EXP 6480464 Pentachlorophenol results in increased expression of PLEKHH1 mRNA CTD PMID:23892564 Plekhh1 Mouse perfluorohexanesulfonic acid decreases expression EXP 6480464 perfluorohexanesulfonic acid results in decreased expression of PLEKHH1 mRNA CTD PMID:37995155 Plekhh1 Mouse phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of PLEKHH1 mRNA CTD PMID:23091169 Plekhh1 Mouse phenobarbital decreases expression ISO Plekhh1 (Rattus norvegicus) 6480464 Phenobarbital results in decreased expression of PLEKHH1 mRNA CTD PMID:30047161 Plekhh1 Mouse pirinixic acid multiple interactions EXP 6480464 [pirinixic acid co-treated with PPARA] results in increased expression of PLEKHH1 mRNA CTD PMID:20813756 Plekhh1 Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of PLEKHH1 mRNA CTD PMID:17426115 and PMID:20813756 Plekhh1 Mouse pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of PLEKHH1 mRNA CTD PMID:22698814 Plekhh1 Mouse propiconazole increases expression EXP 6480464 propiconazole results in increased expression of PLEKHH1 mRNA CTD PMID:21278054 Plekhh1 Mouse quercetin increases expression ISO PLEKHH1 (Homo sapiens) 6480464 Quercetin results in increased expression of PLEKHH1 mRNA CTD PMID:21632981 Plekhh1 Mouse SB 431542 multiple interactions ISO PLEKHH1 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PLEKHH1 mRNA CTD PMID:27188386 Plekhh1 Mouse silicon dioxide increases expression ISO PLEKHH1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of PLEKHH1 mRNA CTD PMID:25895662 Plekhh1 Mouse sodium arsenite multiple interactions ISO PLEKHH1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PLEKHH1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PLEKHH1 mRNA CTD PMID:39836092 Plekhh1 Mouse sunitinib increases expression ISO PLEKHH1 (Homo sapiens) 6480464 Sunitinib results in increased expression of PLEKHH1 mRNA CTD PMID:31533062 Plekhh1 Mouse thioacetamide increases expression ISO Plekhh1 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of PLEKHH1 mRNA CTD PMID:23411599 and PMID:34492290 Plekhh1 Mouse titanium dioxide increases expression ISO PLEKHH1 (Homo sapiens) 6480464 titanium dioxide results in increased expression of PLEKHH1 mRNA CTD PMID:34973136 Plekhh1 Mouse tributylstannane increases expression EXP 6480464 tributyltin results in increased expression of PLEKHH1 mRNA CTD PMID:31939706 Plekhh1 Mouse triphenyl phosphate increases expression ISO Plekhh1 (Rattus norvegicus) 6480464 triphenyl phosphate results in increased expression of PLEKHH1 mRNA CTD PMID:30589522 Plekhh1 Mouse Triptolide increases expression EXP 6480464 triptolide results in increased expression of PLEKHH1 mRNA CTD PMID:32835833 Plekhh1 Mouse valproic acid increases expression ISO PLEKHH1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PLEKHH1 mRNA CTD PMID:23179753 Plekhh1 Mouse vinclozolin affects expression ISO Plekhh1 (Rattus norvegicus) 6480464 vinclozolin affects the expression of PLEKHH1 mRNA CTD PMID:19015723
1,2-dimethylhydrazine (EXP) 1-naphthyl isothiocyanate (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-methoxyethanol (ISO) 4,4'-diaminodiphenylmethane (ISO) 4-hydroxyphenyl retinamide (EXP) 6-propyl-2-thiouracil (ISO) acrylamide (ISO) aflatoxin B1 (EXP) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (EXP,ISO) bisphenol A (ISO) C60 fullerene (ISO) carbon nanotube (EXP) CGP 52608 (ISO) choline (EXP) Cuprizon (ISO) dicrotophos (ISO) dorsomorphin (ISO) folic acid (EXP) FR900359 (ISO) fulvestrant (ISO) gentamycin (ISO) glyphosate (EXP) L-methionine (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methylmercury chloride (ISO) monosodium L-glutamate (EXP) N-methyl-4-phenylpyridinium (ISO) nickel atom (ISO) orphenadrine (ISO) ozone (EXP) p-chloromercuribenzoic acid (ISO) paracetamol (EXP,ISO) pentachlorophenol (EXP) perfluorohexanesulfonic acid (EXP) phenobarbital (EXP,ISO) pirinixic acid (EXP) pregnenolone 16alpha-carbonitrile (EXP) propiconazole (EXP) quercetin (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sunitinib (ISO) thioacetamide (ISO) titanium dioxide (ISO) tributylstannane (EXP) triphenyl phosphate (ISO) Triptolide (EXP) valproic acid (ISO) vinclozolin (ISO)
Plekhh1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 79,075,937 - 79,128,429 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 79,075,937 - 79,128,429 (+) Ensembl GRCm39 Ensembl GRCm38 12 79,029,163 - 79,081,655 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 Cytogenetic Map 12 C3 NCBI cM Map 12 35.51 NCBI
PLEKHH1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 67,533,290 - 67,589,612 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 67,533,290 - 67,589,612 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 68,000,007 - 68,056,329 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 67,069,761 - 67,126,008 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 14 48,059,079 - 48,115,320 (+) NCBI Celera Cytogenetic Map 14 q24.1 NCBI HuRef 14 48,169,751 - 48,225,996 (+) NCBI HuRef CHM1_1 14 67,938,650 - 67,994,902 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 61,740,406 - 61,796,732 (+) NCBI T2T-CHM13v2.0
Plekhh1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 103,572,304 - 103,621,729 (+) NCBI GRCr8 mRatBN7.2 6 97,839,288 - 97,888,712 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 97,839,288 - 97,888,709 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 98,268,836 - 98,318,136 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 98,567,990 - 98,617,288 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 97,954,925 - 98,003,962 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 102,215,424 - 102,264,345 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 102,215,603 - 102,262,417 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 111,585,028 - 111,633,995 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 101,664,129 - 101,714,245 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 101,621,814 - 101,743,779 (+) NCBI Celera 6 96,226,252 - 96,275,106 (+) NCBI Celera Cytogenetic Map 6 q24 NCBI
Plekhh1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955466 2,618,585 - 2,653,771 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955466 2,616,627 - 2,653,804 (-) NCBI ChiLan1.0 ChiLan1.0
PLEKHH1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 68,641,414 - 68,697,820 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 67,857,929 - 67,914,332 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 48,111,017 - 48,167,541 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 66,989,464 - 67,045,677 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 66,989,471 - 67,045,677 (+) Ensembl panpan1.1 panPan2
PLEKHH1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 41,508,866 - 41,560,054 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 41,508,740 - 41,559,932 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 41,201,689 - 41,253,144 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 41,737,162 - 41,788,663 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 41,744,542 - 41,785,651 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 41,355,953 - 41,407,440 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 41,429,613 - 41,481,066 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 41,789,019 - 41,840,536 (+) NCBI UU_Cfam_GSD_1.0
Plekhh1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 63,220,352 - 63,270,563 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936495 10,929,656 - 10,969,350 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936495 10,921,136 - 10,971,349 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PLEKHH1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 44,781,699 - 44,835,802 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 44,790,362 - 44,835,351 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 33,011,773 - 33,067,736 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Plekhh1
.
14746976 Manh73_m mandible shape 73 (mouse) 12 65857131 99857131 Mouse 27226776 Tibl6_m tibia length 6, 5 week (mouse) 12 60646786 92666774 Mouse 1301337 Cdcs8_m cytokine deficiency colitis susceptibility 8 (mouse) Not determined 12 64689083 98689229 Mouse 1300633 Cdcs7_m cytokine deficiency colitis susceptibility 7 (mouse) Not determined 12 64689083 98689229 Mouse 27226771 Tibl14_m tibia length 14, 10 week (mouse) 12 68346774 98766259 Mouse 4142002 Tbqt3_m tibia bone quality traits 3 (mouse) Not determined 12 35285496 109936243 Mouse 12832727 Ahrq1_m airway hyperresponsiveness QTL 1 (mouse) 12 54695910 82665939 Mouse 1301574 Lmblgq5_m limb length QTL 5 (mouse) Not determined 12 17596447 80956883 Mouse 4141738 Tgq23_m triglyceride QTL 23 (mouse) Not determined 72112877 106112877 Mouse 13207568 Tcq14_m total cholesterol QTL 14 (mouse) 12 11660001 97176774 Mouse 27226753 Femd7_m femur midshaft diameter 7, 10 week (mouse) 12 9550000 84146774 Mouse 1357749 Vtbt13_m vertebral trabecular bone trait 13 (mouse) Not determined 12 53132002 87132145 Mouse 13524842 Ppiq10a_m prepulse inhibition QTL 10a (mouse) 12 77512220 111512220 Mouse 1301046 Par3_m pulmonary adenoma resistance 3 (mouse) Not determined 12 63956708 97956883 Mouse 1357757 Lnopy2_m lens opacity 2 (mouse) Not determined 12 52846626 86846796 Mouse 1301689 Skull18_m skull morphology 18 (mouse) Not determined 12 73887422 107887526 Mouse 10043895 Bw20_m body weight QTL 20 (mouse) Not determined 12 62308252 96308252 Mouse 27226797 Scvln19_m sacral vertebrae length 2, 16 week (mouse) 12 62146786 99466259 Mouse 1357479 Splwt1_m spleen weight 1 (mouse) Not determined 12 41693175 90887526 Mouse 10043948 Pbft6_m percent body fat 6 (mouse) Not determined 12 61205427 95205427 Mouse 1301926 Adip6_m adiposity 6 (mouse) Not determined 12 73887422 107887526 Mouse 27226793 Feml10_m femur length 10, 5 week (mouse) 12 68346774 113363620 Mouse 27226728 Tibl20_m tibia length 20, 16 week (mouse) 12 59146786 93866774 Mouse 1301476 Pbwg12_m postnatal body weight growth 12 (mouse) Not determined 12 62040164 96040364 Mouse 1301868 Fbgl1_m fasting blood glucose 1 (mouse) Not determined 12 79040164 83162211 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000039928 ⟹ ENSMUSP00000049460
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 12 79,075,937 - 79,128,429 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000217954 ⟹ ENSMUSP00000151944
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 12 79,076,468 - 79,097,080 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000219946
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 12 79,114,383 - 79,128,422 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000219956 ⟹ ENSMUSP00000151747
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 12 79,082,410 - 79,127,403 (+) Ensembl
RefSeq Acc Id:
NM_181073 ⟹ NP_851418
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 79,075,937 - 79,128,429 (+) NCBI
Sequence:
GTGCCTGGCCGCGAGCTGCCCGCCGAGCGAGCGCGGTGCGGACACAGCCGGCGCGGCGCTGCTCCCAGCGCTGGGGCGGGCTTTGTGCGGAGCTCCGGGGACCTTCCAGGCTCCGACCTCGGCCCGCC
hide sequence
RefSeq Acc Id:
XM_006515646 ⟹ XP_006515709
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 79,075,943 - 79,128,423 (+) NCBI
Sequence:
GGCCGCGAGCTGCCCGCCGAGCGAGCGCGGTGCGGACACAGCCGGCGCGGCGCTGCTCCCAGCG
hide sequence
RefSeq Acc Id:
XM_036157303 ⟹ XP_036013196
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 79,082,415 - 79,128,423 (+) NCBI
Sequence:
AAAAGAATCAGACACTAGAACTATCAGTGGCTTAATTGTTCTGCCCTTCTCTCCAGGGCTACTGACAAGTGTGCTGGATCTTGGAGCTCCCGGGAGTATTTGGAAGTTGGTTCCGTCATGGCAGAAGT
hide sequence
RefSeq Acc Id:
NP_851418 ⟸ NM_181073
- UniProtKB:
Q99JL2 (UniProtKB/Swiss-Prot), Q8K334 (UniProtKB/Swiss-Prot), Q8BWF3 (UniProtKB/Swiss-Prot), Q80TI1 (UniProtKB/Swiss-Prot), Q3UPN4 (UniProtKB/Swiss-Prot)
- Sequence:
MAEVKVEVASIDWQKRCLSLETQLFRFRLQASKIRELLADKMQELEQRLLEAEQRAENAETQVGVMEEKIKLSNLKSVDSTGTLHQKYQELLRAVQGKDELISQLQAQLEKQKQTRAEEAKIVQEKAA
hide sequence
RefSeq Acc Id:
XP_006515709 ⟸ XM_006515646
- Peptide Label:
isoform X2
- Sequence:
MAEVKVEVASIDWQKRCLSLETQLFRFRLQASKIRELLADKMQELEQRLLEAEQRAENAETQVGVMEEKIKLSNLKSVDSTGTLHQKYQELLRAVQGKDELISQLQAQLEKQKQTRAEEAKIVQEKAA
hide sequence
RefSeq Acc Id:
XP_036013196 ⟸ XM_036157303
- Peptide Label:
isoform X1
- UniProtKB:
Q99JL2 (UniProtKB/Swiss-Prot), Q8K334 (UniProtKB/Swiss-Prot), Q8BWF3 (UniProtKB/Swiss-Prot), Q80TI1 (UniProtKB/Swiss-Prot), Q3UPN4 (UniProtKB/Swiss-Prot)
Ensembl Acc Id:
ENSMUSP00000151747 ⟸ ENSMUST00000219956
Ensembl Acc Id:
ENSMUSP00000049460 ⟸ ENSMUST00000039928
Ensembl Acc Id:
ENSMUSP00000151944 ⟸ ENSMUST00000217954
RGD ID: 8678634 Promoter ID: EPDNEW_M17347 Type: initiation region Name: Plekhh1_1 Description: Mus musculus pleckstrin homology domain containing, family Hmember 1 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 12 79,029,175 - 79,029,235 EPDNEW
