Cmtm2b (CKLF-like MARVEL transmembrane domain containing 2B) - Rat Genome Database

Cmtm2b (CKLF-like MARVEL transmembrane domain containing 2B) - Rat Genome Database

Submit Data | Help | Video Tutorials | News | Publications | Download | REST API | Citing RGD | Contact

Advanced Search (OLGA)

Gene: Cmtm2b (CKLF-like MARVEL transmembrane domain containing 2B) Mus musculus

Subscribe to Updates

Symbol:

Cmtm2b

Name:

CKLF-like MARVEL transmembrane domain containing 2B

RGD ID:

1623142

MGI Page

Description:

Predicted to enable cytokine activity. Predicted to be involved in chemotaxis and signal transduction. Predicted to be located in extracellular space. Predicted to be active in membrane. Orthologous to human CMTM2 (CKLF like MARVEL transmembrane domain containing 2).

Type:

protein-coding

RefSeq Status:

Previously known as:

1700013O04Rik; chemokine-like factor super family 2B; chemokine-like factor superfamily member 2B; chemokine-like factor superfamily protein 2-2; CKLF-like MARVEL transmembrane domain-containing protein 2B; Cklfsf; Cklfsf22; Cklfsf2b

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	105,048,838 - 105,057,396 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	105,048,862 - 105,057,396 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	104,322,206 - 104,330,764 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	104,322,230 - 104,330,764 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	106,846,137 - 106,854,656 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	107,211,366 - 107,219,885 (+)	NCBI		MGSCv36	mm8
Celera	8	108,553,629 - 108,562,034 (+)	NCBI		Celera
Cytogenetic Map	8	D3	NCBI
cM Map	8	53.04	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cmtm2b	Mouse	COVID-19		ISO	CMTM2 (Homo sapiens)	9068941	mRNA:decreased expression:peripheral blood mononuclear cell (human)	RGD	PMID:32228226 and REF_RGD_ID:28912744

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cmtm2b	Mouse	autosomal dominant dyskeratosis congenita 6		ISO	CMTM2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Dyskeratosis congenita and autosomal dominant 6	ClinVar	PMID:28492532
Cmtm2b	Mouse	cataract 5 multiple types		ISO	CMTM2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Cataract 5 multiple types	ClinVar	PMID:15959809 more ...
Cmtm2b	Mouse	Chromosome 16q12 Duplication Syndrome		ISO	CMTM2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Chromosome 16q12 duplication syndrome	ClinVar	PMID:25741868

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cmtm2b	Mouse	juvenile rheumatoid arthritis		ISO	CMTM2 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:19565504

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cmtm2b	Mouse	17alpha-ethynylestradiol	affects expression	EXP		6480464	Ethinyl Estradiol affects the expression of CMTM2B mRNA	CTD	PMID:17555576
Cmtm2b	Mouse	antirheumatic drug	decreases expression	ISO	CMTM2 (Homo sapiens)	6480464	Antirheumatic Agents results in decreased expression of CMTM2 mRNA	CTD	PMID:24449571
Cmtm2b	Mouse	aristolochic acid A	increases expression	ISO	CMTM2 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of CMTM2 mRNA	CTD	PMID:33212167
Cmtm2b	Mouse	benzo[a]pyrene	increases methylation	ISO	CMTM2 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of CMTM2 promoter	CTD	PMID:27901495
Cmtm2b	Mouse	bisphenol A	decreases methylation	EXP		6480464	bisphenol A results in decreased methylation of CMTM2B promoter	CTD	PMID:27312807
Cmtm2b	Mouse	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of CMTM2B mRNA	CTD	PMID:32156529
Cmtm2b	Mouse	cadmium dichloride	decreases expression	ISO	CMTM2 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of CMTM2 mRNA	CTD	PMID:38382870
Cmtm2b	Mouse	CGP 52608	multiple interactions	ISO	CMTM2 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to CMTM2 gene]	CTD	PMID:28238834
Cmtm2b	Mouse	Dibutyl phosphate	affects expression	ISO	CMTM2 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of CMTM2 mRNA	CTD	PMID:37042841
Cmtm2b	Mouse	mono(2-ethylhexyl) phthalate	decreases expression	EXP		6480464	mono-(2-ethylhexyl)phthalate results in decreased expression of CMTM2B mRNA	CTD	PMID:22401849
Cmtm2b	Mouse	ozone	multiple interactions	ISO	CMTM2 (Homo sapiens)	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of CMTM2 mRNA	CTD	PMID:35430440
Cmtm2b	Mouse	paracetamol	decreases expression	ISO	CMTM2 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of CMTM2 mRNA	CTD	PMID:22230336
Cmtm2b	Mouse	sodium arsenite	increases expression	ISO	CMTM2 (Homo sapiens)	6480464	sodium arsenite results in increased expression of CMTM2 mRNA	CTD	PMID:38568856
Cmtm2b	Mouse	sodium fluoride	increases expression	EXP		6480464	Sodium Fluoride results in increased expression of CMTM2B protein	CTD	PMID:28918527
Cmtm2b	Mouse	tamoxifen	affects expression	EXP		6480464	Tamoxifen affects the expression of CMTM2B mRNA	CTD	PMID:17555576
Cmtm2b	Mouse	Theaflavin 3,3'-digallate	affects expression	ISO	CMTM2 (Homo sapiens)	6480464	theaflavin-3 and 3'-digallate affects the expression of CMTM2 mRNA	CTD	PMID:34925699
Cmtm2b	Mouse	triphenyl phosphate	affects expression	ISO	CMTM2 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of CMTM2 mRNA	CTD	PMID:37042841

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cmtm2b	Mouse	chemotaxis	involved_in	IEA	UniProtKB-KW:KW-0145	2290270		UniProt	GO_REF:0000043
Cmtm2b	Mouse	signal transduction	involved_in	IEA	GO:0005125	2290270		GOC	GO_REF:0000108

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cmtm2b	Mouse	extracellular space	located_in	IEA	UniProtKB-KW:KW-0202	2290270		UniProt	GO_REF:0000043
Cmtm2b	Mouse	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	2290270		UniProt	GO_REF:0000044
Cmtm2b	Mouse	membrane	is_active_in	IBA	PANTHER:PTN001103553 more ...	2290270		GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cmtm2b	Mouse	cytokine activity	enables	IEA	UniProtKB-KW:KW-0202	2290270		UniProt	GO_REF:0000043
Cmtm2b	Mouse	protein binding	enables	ISO	UniProtKB:P0DN84 more ...	9068941	PMID:32296183	IntAct	PMID:32296183

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cmtm2b	Mouse	immotile sperm		IAGP		5509061		MGI	PMID:30209135
Cmtm2b	Mouse	impaired binding of sperm to zona pellucida		IAGP		5509061		MGI	PMID:30209135
Cmtm2b	Mouse	male infertility		IAGP		5509061		MGI	PMID:30209135
Cmtm2b	Mouse	reduced male fertility		IAGP		5509061		MGI	PMID:30209135

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:10349636	PMID:11042159	PMID:11076861	PMID:11217851	PMID:12466851	PMID:12477932	PMID:12782130	PMID:15489334	PMID:16141072	PMID:16141073	PMID:16343975	PMID:21873635
PMID:30209135	PMID:30321752	PMID:31455729

Cmtm2b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	105,048,838 - 105,057,396 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	105,048,862 - 105,057,396 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	104,322,206 - 104,330,764 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	104,322,230 - 104,330,764 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	106,846,137 - 106,854,656 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	107,211,366 - 107,219,885 (+)	NCBI		MGSCv36	mm8
Celera	8	108,553,629 - 108,562,034 (+)	NCBI		Celera
Cytogenetic Map	8	D3	NCBI
cM Map	8	53.04	NCBI

CMTM2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	66,579,463 - 66,588,275 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	66,579,448 - 66,588,275 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	66,613,366 - 66,622,178 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	65,170,852 - 65,179,679 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	65,170,851 - 65,179,676	NCBI
Celera	16	51,119,925 - 51,128,752 (+)	NCBI		Celera
Cytogenetic Map	16	q21	NCBI
HuRef	16	52,489,275 - 52,498,102 (+)	NCBI		HuRef
CHM1_1	16	68,020,529 - 68,029,356 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	72,373,758 - 72,382,570 (+)	NCBI		T2T-CHM13v2.0

Cmtm2b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	647,273 - 667,683 (-)	NCBI		GRCr8
mRatBN7.2	19	640,838 - 651,872 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	640,824 - 651,939 (-)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	19	849,308 - 860,032 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	848,311 - 860,493 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	846,972 - 848,043 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Cytogenetic Map	19	p14	NCBI

.

Variants in Cmtm2b
705 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	156
Count of miRNA genes:	148
Interacting mature miRNAs:	154
Transcripts:	ENSMUST00000041973
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300560	Tgl1_m	triglyceride level 1 (mouse)			Not determined		8	102486208	111650036	Mouse
4141435	Fbtq3_m	femoral bone trait QTL 3 (mouse)			Not determined		8	100965309	130127694	Mouse
11252141	Fdr2_m	fat response to dietary restriction 2 (mouse)					8	98390634	130127694	Mouse
1357470	Obq16_m	obesity QTL 16 (mouse)			Not determined		8	76411976	110412125	Mouse
1302105	Im1_m	Immunoregulatory 1 (mouse)			Not determined		8	99828531	130127694	Mouse
1301080	Sluc9_m	susceptibility to lung cancer 9 (mouse)			Not determined		8	99828531	130127694	Mouse
1558875	Eae31_m	experimental allergic encephalomyelitis susceptibility 31 (mouse)			Not determined		8	35109930	115563747	Mouse
10412234	Nhdlq14_m	non-HDL QTL 14 (mouse)			Not determined		8	76411976	110412125	Mouse
1301766	Desp1_m	despair 1 (mouse)			Not determined		8	85486208	119486373	Mouse
1301253	Skmw2_m	skeletal muscle weight 2 (mouse)			Not determined		8	86443553	120443701	Mouse
1301316	Dntcs1_m	dental caries susceptibility 1 (mouse)			Not determined		8	103443553	127781786	Mouse
4140967	Bmd39_m	bone mineral density 39 (mouse)			Not determined		8	32506572	117965439	Mouse
1357708	Orq1_m	ovulation rate QTL 1 (mouse)			Not determined		8	71740461	124622354	Mouse
1300681	Pgia22_m	proteoglycan induced arthritis 22 (mouse)			Not determined		8	102486208	116025457	Mouse
10755519	Wbc1_m	white blood cell count 1 (mouse)					8	82345783	116345783	Mouse
27226754	Femd6_m	femur midshaft diameter 6, 10 week (mouse)					8	37867154	110326632	Mouse
1301581	Char2_m	P. chabaudi malaria resistance QTL 2 (mouse)			Not determined		8	79808806	113809031	Mouse
1301874	Hdlq16_m	HDL QTL 16 (mouse)			Not determined		8	76411976	110412125	Mouse
1357494	Obsty2_m	obesity 2 (mouse)			Not determined		8	96245241	129745061	Mouse
1301872	Cd4ts3_m	CD4 T cell subset 3 (mouse)			Not determined		8	72122809	106123021	Mouse
10045619	Heal14_m	wound healing/regeneration 14 (mouse)			Not determined		8	86443553	120443701	Mouse
1558780	Idd22_m	insulin dependent diabetes susceptibility 22 (mouse)			Not determined		8	71829531	105829637	Mouse
1300920	Pitm3_m	prion incubation time 3 (mouse)			Not determined		8	73929123	107929226	Mouse
12880431	Fgf23lq2_m	FGF23 serum level QTL 2 (mouse)					8	97626632	130127694	Mouse
10755530	Wbc2_m	white blood cell count 2 (mouse)					8	81819296	115819296	Mouse
1302049	Heal1_m	wound healing/regeneration 1 (mouse)			Not determined		8	86443553	120443701	Mouse
27226796	Scvln16_m	sacral vertebrae length 2, 16 week (mouse)					8	89726628	130027694	Mouse
27095912	Pglq14_m	pelvic girdle length QTL 14, 16 week (mouse)					8	74126628	126826739	Mouse
4142023	W3q5_m	weight 3 weeks QTL 5 (mouse)			Not determined			71740461	124622354	Mouse
1301099	Cbm2_m	cerebellum weight 2 (mouse)			Not determined		8	79245241	113245331	Mouse
1301481	Lith11_m	lithogenic gene 11 (mouse)			Not determined		8	98563635	130127694	Mouse
11532692	Sluc38a_m	susceptibility to lung cancer 38a (mouse)					8	105033977	130127694	Mouse
11532691	Sluc38_m	susceptibility to lung cancer 38 (mouse)					8	105033977	130127694	Mouse
1558890	Lith18_m	lithogenic gene 18 (mouse)			Not determined		8	76402145	110402251	Mouse

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_028524	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006531455	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC121952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK005970	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY162282	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY241872	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC050983	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC060997	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466525	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000041973 ⟹ ENSMUSP00000043127

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	8	105,048,862 - 105,057,396 (+)	Ensembl
GRCm38.p6 Ensembl	8	104,322,230 - 104,330,764 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000212912 ⟹ ENSMUSP00000148496

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	8	105,049,247 - 105,057,394 (+)	Ensembl
GRCm38.p6 Ensembl	8	104,322,615 - 104,330,762 (+)	Ensembl

RefSeq Acc Id:

NM_028524 ⟹ NP_082800

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	8	105,048,859 - 105,057,396 (+)	NCBI
GRCm38	8	104,322,227 - 104,330,764 (+)	NCBI
MGSCv37	8	106,846,137 - 106,854,656 (+)	RGD
Celera	8	108,553,619 - 108,562,042 (+)	NCBI
cM Map	8		ENTREZGENE

Sequence:

show sequence

CCCAGTGGTCAGTTGAGAGCCACCCTTGAACAGGTCAGGAGACACCAGGCTCTCTCTCGAGCTGGGCCTGTTCAGCGACTGCAGACAAGGCTGGGCGGTTGGAAGCTGAGAACTACCTGCTAACAACC
ATGGCAGCGCCCGCGCCGCGAGCCCGGACAGGTGGCAAGAAGAAAGATGAAAGAAGAGGGTTCAAAGGCTACAAGTGGGAATTCAGAGACAGCAATAAAGACTTCTGGGCGCAGGGACATGCAGAGTG
CAAGTCTCTGATTATGATCCTCCTCATTGCTGCAATGGTCTGTTTCCAAAGAGTGGCCACTCATCCAATTGTAATCCTGCTGCTTACTATGGAACTGTCAATCTGTGCTTTCTTCTTCTTCCTCTACT
CCTTAGCCATCAACAGATACATTCCCTTCGTCTTCTGGCCTATGATGGATCTGATGAACGACCTGGCCTGTTCCACATTCCTCATAGGTGGTATATTCTTTGCTCTTGAAGCAAGACGAGAATTGCCA
GTGCCCTACTTAACTGGTATGATCCTCATGGGTGTTACGGCATTTATAAGTATCATTGACCTGTGTCTTCAGAGGAGACAATTTAAAAGCAGGAAGCTTCGAAAGTTTATTCTACTTACCCCAGACAG
GAAAGGCAAGAAGCAGGACCCGAAACTCCTTTTAATGCTGGCTGCCAAAGAGGATGAGGAGGAGAGGCAAAGGGAACTGGCAGAGAAAGCGAAGAGGGAGTCGATGGACCCTGGATGGTGACTGCGCA
GCCACACCTGTGGTCAGGGACAGCTGCGAACTCTGCAGCCAGGCCTTTCTACTCTCTCTCTTTTGCCAGATTTCCAGCAGAGTTCTCCATCAATAAAGACATCCTGGAAAAGACAAAAAAAAAAAAAA
AA

hide sequence

RefSeq Acc Id:

XM_006531455 ⟹ XP_006531518

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	8	105,048,838 - 105,057,396 (+)	NCBI
GRCm38	8	104,322,206 - 104,330,764 (+)	NCBI

Sequence:

show sequence

CAAGCGTTAGAATTCCGCAGTCCCAGTGGTCAGTTGAGAGCCACCCTTGAACAGGTCAGGAGAC
ACCAGGCTCTCTCTCGAGCTGGGCCTGTTCAGCGACTGCAGACAAGGCTGGGCGGTTGGAAGCTGAGAACTACCTGCTAACAACCATGGCAGCGCCCGCGCCGCGAGCCCGGACAGGTGGCAAGAAGA
AAGATGAAAGAAGAGGGTTCAAAGGCTACAAGTGGGAATTCAGAGACAGCAATAAAGACTTCTGGGCGCAGGGACATGCAGAGTGCAAGTCTCTGATTATGATCCTCCTCATTGCTGCAATGGTCTGT
TTCCAAAGAGTGGCCACTCATCCAATTGTAATCCTGCTGCTTACTATGGAACTGTCAATCTGTGCTTTCTTCTTCTTCCTCTACTCCTTAGCCATCAACAGATACATTCCCTTCGTCTTCTGGCCTAT
GATGGATCTGATGAACGACCTGGCCTGTTCCACATTCCTCATAGGTGGTATATTCTTTGCTCTTGAAGCAAGACGAGAATTGCCAGTGCCCTACTTAACTGGTATGGTAAGATCCTCATGGGTGTTAC
GGCATTTATAAGTATCATTGACCTGTGTCTTCAGAGGAGACAATTTAAAAGCAGGAAGCTTCGAAAGTTTATTCTACTTACCCCAGACAGGAAAGGCAAGAAGCAGGACCCGAAACTCCTTTTAATGC
TGGCTGCCAAAGAGGATGAGGAGGAGAGGCAAAGGGAACTGGCAGAGAAAGCGAAGAGGGAGTCGATGGACCCTGGATGGTGACTGCGCAGCCACACCTGTGGTCAGGGACAGCTGCGAACTCTGCAG
CCAGGCCTTTCTACTCTCTCTCTTTTGCCAGATTTCCAGCAGAGTTCTCCATCAATAAAGACATCCTGGAAAAGACA

hide sequence


Protein RefSeqs	NP_082800	(Get FASTA)	NCBI Sequence Viewer
	XP_006531518	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH60997	(Get FASTA)	NCBI Sequence Viewer
	AAO34103	(Get FASTA)	NCBI Sequence Viewer
	AAP33494	(Get FASTA)	NCBI Sequence Viewer
	BAB24346	(Get FASTA)	NCBI Sequence Viewer
	EDL11209	(Get FASTA)	NCBI Sequence Viewer
	EDL11210	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000043127
	ENSMUSP00000043127.6
GenBank Protein	Q9DAC0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_082800 ⟸ NM_028524

- UniProtKB:

Q9DAC0 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MAAPAPRARTGGKKKDERRGFKGYKWEFRDSNKDFWAQGHAECKSLIMILLIAAMVCFQRVATHPIVILLLTMELSICAFFFFLYSLAINRYIPFVFWPMMDLMNDLACSTFLIGGIFFALEARRELP
VPYLTGMILMGVTAFISIIDLCLQRRQFKSRKLRKFILLTPDRKGKKQDPKLLLMLAAKEDEEERQRELAEKAKRESMDPGW

hide sequence

RefSeq Acc Id:	XP_006531518 ⟸ XM_006531455
- Peptide Label:	isoform X1
- Sequence:	show sequence MAAPAPRARTGGKKKDERRGFKGYKWEFRDSNKDFWAQGHAECKSLIMILLIAAMVCFQRVATHPIVILLLTMELSICAFFFFLYSLAINRYIPFVFWPMMDLMNDLACSTFLIGGIFFALEARRELP VPYLTGMVRSSWVLRHL hide sequence

Ensembl Acc Id:

ENSMUSP00000148496 ⟸ ENSMUST00000212912

Ensembl Acc Id:

ENSMUSP00000043127 ⟸ ENSMUST00000041973

Protein Domains

MARVEL

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9DAC0-F1-model_v2	AlphaFold	Q9DAC0	1-210	view protein structure

RGD ID:

Promoter ID:

Type:

initiation region

Name:

Cmtm2b_1

Description:

Mus musculus CKLF-like MARVEL transmembrane domain containing2B , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	8	104,322,237 - 104,322,297	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000035785	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000041973	ENTREZGENE
	ENSMUST00000041973.7	UniProtKB/Swiss-Prot
InterPro	Marvel	UniProtKB/Swiss-Prot
KEGG Report	mmu:75502	UniProtKB/Swiss-Prot
MGD	MGI:2447311	ENTREZGENE
NCBI Gene	75502	ENTREZGENE
PhenoGen	Cmtm2b	PhenoGen
PROSITE	MARVEL	UniProtKB/Swiss-Prot
UniProt	A0A1D5RLT3_MOUSE	UniProtKB/TrEMBL
	CLF2B_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE