Symbol:
Snx9
Name:
sorting nexin 9
RGD ID:
1621547
MGI Page
MGI
Description:
Enables phosphatidylinositol binding activity. Involved in positive regulation of actin filament polymerization. Acts upstream of or within intracellular protein transport. Located in cytoplasm and plasma membrane. Is active in cytosol. Colocalizes with cuticular plate. Is expressed in lower jaw molar and upper jaw molar. Orthologous to human SNX9 (sorting nexin 9).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
2700073N08Rik; SD; SDP1; SH3P; SH3PX1; sorting nexin-9; sorting nexin-9-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SNX9 (sorting nexin 9) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB
Rattus norvegicus (Norway rat):
Snx9 (sorting nexin 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Snx9 (sorting nexin 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SNX9 (sorting nexin 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SNX9 (sorting nexin 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Snx9 (sorting nexin 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SNX9 (sorting nexin 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SNX9 (sorting nexin 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Snx9 (sorting nexin 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SNX9 (sorting nexin 9)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Snx9 (sorting nexin 9)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
snx9b (sorting nexin 9b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
snx9a (sorting nexin 9a)
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
lst-4
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
SH3PX1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
snx9
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 5,891,599 - 5,982,231 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 5,891,604 - 5,982,229 (+) Ensembl GRCm39 Ensembl GRCm38 17 5,841,324 - 5,931,956 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 5,841,329 - 5,931,954 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 5,841,380 - 5,930,711 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 5,797,862 - 5,887,193 (+) NCBI MGSCv36 mm8 Celera 17 6,430,109 - 6,474,633 (+) NCBI Celera Cytogenetic Map 17 A1 NCBI cM Map 17 3.51 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Snx9 Mouse (-)-epigallocatechin 3-gallate multiple interactions ISO SNX9 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of SNX9 mRNA CTD PMID:22079256 Snx9 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of SNX9 mRNA CTD PMID:22206623 Snx9 Mouse 1-chloro-2,4-dinitrobenzene increases expression ISO SNX9 (Homo sapiens) 6480464 Dinitrochlorobenzene results in increased expression of SNX9 mRNA CTD PMID:17374397 Snx9 Mouse 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of SNX9 mRNA CTD PMID:17555576 Snx9 Mouse 17beta-estradiol decreases expression ISO SNX9 (Homo sapiens) 6480464 Estradiol results in decreased expression of SNX9 mRNA CTD PMID:19167446 Snx9 Mouse 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO SNX9 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Snx9 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SNX9 mRNA CTD PMID:21570461 Snx9 Mouse 2,4,6-tribromophenol decreases expression ISO SNX9 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Snx9 Mouse 2-hydroxypropanoic acid decreases expression ISO SNX9 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of SNX9 mRNA CTD PMID:30851411 Snx9 Mouse 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of SNX9 mRNA CTD PMID:26251327 Snx9 Mouse 4-(ethoxymethylene)-2-phenyloxazol-5-one increases expression ISO SNX9 (Homo sapiens) 6480464 Oxazolone results in increased expression of SNX9 mRNA CTD PMID:17374397 Snx9 Mouse aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of SNX9 mRNA CTD PMID:19770486 Snx9 Mouse arsenite(3-) multiple interactions ISO SNX9 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to SNX9 mRNA] CTD PMID:32406909 Snx9 Mouse benzo[a]pyrene affects methylation ISO SNX9 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SNX9 intron and Benzo(a)pyrene affects the methylation of SNX9 promoter CTD PMID:27901495 and PMID:30157460 Snx9 Mouse benzo[a]pyrene diol epoxide I decreases expression ISO SNX9 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20018196 Snx9 Mouse benzoates increases expression ISO SNX9 (Homo sapiens) 6480464 Benzoates analog results in increased expression of SNX9 mRNA CTD PMID:29472718 Snx9 Mouse bisphenol A increases expression ISO Snx9 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of SNX9 mRNA CTD PMID:25181051 Snx9 Mouse bisphenol A increases methylation ISO SNX9 (Homo sapiens) 6480464 bisphenol A results in increased methylation of SNX9 gene CTD PMID:31601247 Snx9 Mouse bisphenol A multiple interactions ISO SNX9 (Homo sapiens) 6480464 [[ginger extract results in increased abundance of Oils and Volatile] which co-treated with bisphenol A] affects the expression of SNX9 protein CTD PMID:33376534 Snx9 Mouse bisphenol A increases expression ISO SNX9 (Homo sapiens) 6480464 bisphenol A results in increased expression of SNX9 protein CTD PMID:33181973 Snx9 Mouse bisphenol A decreases expression ISO Snx9 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of SNX9 mRNA CTD PMID:34947998 Snx9 Mouse bisphenol A increases methylation ISO Snx9 (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of SNX9 gene CTD PMID:28505145 Snx9 Mouse bisphenol AF increases expression ISO SNX9 (Homo sapiens) 6480464 bisphenol AF results in increased expression of SNX9 protein CTD PMID:34186270 Snx9 Mouse Bisphenol B increases expression ISO SNX9 (Homo sapiens) 6480464 bisphenol B results in increased expression of SNX9 protein CTD PMID:34186270 Snx9 Mouse caffeine increases phosphorylation ISO SNX9 (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of SNX9 protein CTD PMID:35688186 Snx9 Mouse calcitriol increases expression ISO SNX9 (Homo sapiens) 6480464 Calcitriol results in increased expression of SNX9 mRNA CTD PMID:16002434 Snx9 Mouse CGP 52608 multiple interactions ISO SNX9 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SNX9 gene] CTD PMID:28238834 Snx9 Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of SNX9 mRNA CTD PMID:20938992 Snx9 Mouse copper(II) sulfate increases expression ISO SNX9 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of SNX9 mRNA CTD PMID:19549813 Snx9 Mouse coumarin increases phosphorylation ISO SNX9 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of SNX9 protein CTD PMID:35688186 Snx9 Mouse coumestrol multiple interactions ISO SNX9 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of SNX9 mRNA CTD PMID:19167446 Snx9 Mouse coumestrol decreases expression ISO SNX9 (Homo sapiens) 6480464 Coumestrol results in decreased expression of SNX9 mRNA CTD PMID:19167446 Snx9 Mouse crocidolite asbestos affects expression ISO SNX9 (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of SNX9 mRNA CTD PMID:24160326 Snx9 Mouse cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of SNX9 mRNA CTD PMID:19770486 Snx9 Mouse cyclosporin A increases expression ISO SNX9 (Homo sapiens) 6480464 Cyclosporine results in increased expression of SNX9 mRNA CTD PMID:20106945 and PMID:25562108 Snx9 Mouse dextran sulfate decreases expression EXP 6480464 Dextran Sulfate results in decreased expression of SNX9 protein CTD PMID:32272095 Snx9 Mouse dextran sulfate multiple interactions EXP 6480464 Erianin inhibits the reaction [Dextran Sulfate results in decreased expression of SNX9 protein] CTD PMID:32272095 Snx9 Mouse dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of SNX9 mRNA CTD PMID:21266533 Snx9 Mouse Enterolactone multiple interactions ISO SNX9 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of SNX9 mRNA CTD PMID:19167446 Snx9 Mouse ethanol decreases expression ISO Snx9 (Rattus norvegicus) 6480464 Ethanol results in decreased expression of SNX9 protein CTD PMID:20133374 Snx9 Mouse fenthion increases expression EXP 6480464 Fenthion results in increased expression of SNX9 mRNA CTD PMID:34813904 Snx9 Mouse folic acid multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of SNX9 mRNA CTD PMID:20938992 Snx9 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of SNX9 mRNA CTD PMID:25629700 Snx9 Mouse FR900359 increases phosphorylation ISO SNX9 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of SNX9 protein CTD PMID:37730182 Snx9 Mouse inulin multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of SNX9 mRNA CTD PMID:36331819 Snx9 Mouse ivermectin decreases expression ISO SNX9 (Homo sapiens) 6480464 Ivermectin results in decreased expression of SNX9 protein CTD PMID:32959892 Snx9 Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of SNX9 mRNA CTD PMID:20938992 Snx9 Mouse menadione affects expression ISO SNX9 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of SNX9 mRNA CTD PMID:20044591 Snx9 Mouse methidathion increases expression EXP 6480464 methidathion results in increased expression of SNX9 mRNA CTD PMID:34813904 Snx9 Mouse nickel sulfate increases expression ISO SNX9 (Homo sapiens) 6480464 nickel sulfate results in increased expression of SNX9 mRNA CTD PMID:17374397 Snx9 Mouse nimesulide decreases expression ISO Snx9 (Rattus norvegicus) 6480464 nimesulide results in decreased expression of SNX9 mRNA CTD PMID:24136188 Snx9 Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of SNX9 mRNA CTD PMID:35964746 Snx9 Mouse oxaliplatin multiple interactions ISO Snx9 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of SNX9 mRNA CTD PMID:25729387 Snx9 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of SNX9 mRNA CTD PMID:17562736 Snx9 Mouse paracetamol decreases expression ISO Snx9 (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of SNX9 mRNA CTD PMID:33387578 Snx9 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of SNX9 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of SNX9 mRNA CTD PMID:36331819 Snx9 Mouse phenobarbital affects expression ISO SNX9 (Homo sapiens) 6480464 Phenobarbital affects the expression of SNX9 mRNA CTD PMID:19159669 Snx9 Mouse pirinixic acid multiple interactions EXP 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of SNX9 mRNA CTD PMID:19710929 Snx9 Mouse potassium chromate decreases expression ISO SNX9 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of SNX9 mRNA CTD PMID:22079256 Snx9 Mouse potassium chromate multiple interactions ISO SNX9 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of SNX9 mRNA CTD PMID:22079256 Snx9 Mouse potassium dichromate increases expression ISO SNX9 (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of SNX9 protein CTD PMID:23718831 Snx9 Mouse pyrogallol increases expression EXP 6480464 Pyrogallol results in increased expression of SNX9 mRNA CTD PMID:20362636 Snx9 Mouse rac-lactic acid decreases expression ISO SNX9 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of SNX9 mRNA CTD PMID:30851411 Snx9 Mouse serpentine asbestos affects expression ISO SNX9 (Homo sapiens) 6480464 Asbestos and Serpentine affects the expression of SNX9 mRNA CTD PMID:24160326 Snx9 Mouse sodium arsenite increases expression ISO SNX9 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SNX9 mRNA CTD PMID:38568856 Snx9 Mouse sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of SNX9 mRNA CTD PMID:36209798 Snx9 Mouse Soman increases expression ISO Snx9 (Rattus norvegicus) 6480464 Soman results in increased expression of SNX9 mRNA CTD PMID:19281266 Snx9 Mouse testosterone affects expression EXP 6480464 Testosterone affects the expression of SNX9 mRNA CTD PMID:20403060 Snx9 Mouse thimerosal decreases expression ISO SNX9 (Homo sapiens) 6480464 Thimerosal results in decreased expression of SNX9 mRNA CTD PMID:27188386 Snx9 Mouse thiram increases expression ISO SNX9 (Homo sapiens) 6480464 Thiram results in increased expression of SNX9 mRNA CTD PMID:38568856 Snx9 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of SNX9 gene and titanium dioxide results in decreased methylation of SNX9 promoter CTD PMID:35295148 Snx9 Mouse topotecan multiple interactions ISO Snx9 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of SNX9 mRNA CTD PMID:25729387 Snx9 Mouse triphenyl phosphate affects expression ISO SNX9 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SNX9 mRNA CTD PMID:37042841 Snx9 Mouse urethane increases expression ISO SNX9 (Homo sapiens) 6480464 Urethane results in increased expression of SNX9 mRNA CTD PMID:28818685 Snx9 Mouse valproic acid decreases expression ISO SNX9 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of SNX9 mRNA CTD PMID:23179753 Snx9 Mouse valproic acid affects expression ISO SNX9 (Homo sapiens) 6480464 Valproic Acid affects the expression of SNX9 mRNA CTD PMID:25979313 Snx9 Mouse valproic acid decreases methylation ISO SNX9 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of SNX9 gene CTD PMID:29154799 Snx9 Mouse vorinostat decreases expression ISO SNX9 (Homo sapiens) 6480464 vorinostat results in decreased expression of SNX9 mRNA CTD PMID:27188386
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (EXP) 1-chloro-2,4-dinitrobenzene (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4,6-tribromophenol (ISO) 2-hydroxypropanoic acid (ISO) 3,4-methylenedioxymethamphetamine (EXP) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) aflatoxin B1 (EXP) arsenite(3-) (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzoates (ISO) bisphenol A (ISO) bisphenol AF (ISO) Bisphenol B (ISO) caffeine (ISO) calcitriol (ISO) CGP 52608 (ISO) choline (EXP) copper(II) sulfate (ISO) coumarin (ISO) coumestrol (ISO) crocidolite asbestos (ISO) cyclosporin A (EXP,ISO) dextran sulfate (EXP) dibutyl phthalate (EXP) Enterolactone (ISO) ethanol (ISO) fenthion (EXP) folic acid (EXP) FR900359 (ISO) inulin (EXP) ivermectin (ISO) L-methionine (EXP) menadione (ISO) methidathion (EXP) nickel sulfate (ISO) nimesulide (ISO) nitrates (EXP) oxaliplatin (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (EXP) phenobarbital (ISO) pirinixic acid (EXP) potassium chromate (ISO) potassium dichromate (ISO) pyrogallol (EXP) rac-lactic acid (ISO) serpentine asbestos (ISO) sodium arsenite (EXP,ISO) Soman (ISO) testosterone (EXP) thimerosal (ISO) thiram (ISO) titanium dioxide (EXP) topotecan (ISO) triphenyl phosphate (ISO) urethane (ISO) valproic acid (ISO) vorinostat (ISO)
Biological Process
cleavage furrow formation (IBA,ISO,ISS) endocytosis (IBA,ISO,ISS) endosomal transport (IBA,ISO,ISS) intracellular protein transport (IMP,ISO) lipid tube assembly (ISO,ISS) mitotic cytokinesis (ISO,ISS) plasma membrane tubulation (IBA,IEA,ISO) positive regulation of actin filament polymerization (IDA) positive regulation of GTPase activity (ISO,ISS) positive regulation of membrane protein ectodomain proteolysis (IEA,ISO) positive regulation of protein kinase activity (ISO) protein-containing complex assembly (ISO,ISS) receptor-mediated endocytosis (ISO,ISS) regulation of synaptic vesicle endocytosis (IEA,ISO)
Cellular Component
clathrin-coated pit (ISO,ISS) clathrin-coated vesicle (ISO,ISS) cuticular plate (IDA) cytoplasm (IDA,ISO) cytoplasmic vesicle (IBA,ISO,ISS) cytoplasmic vesicle membrane (ISO,ISS) cytosol (IPI,ISO) plasma membrane (IBA,IDA,ISO) presynapse (IEA,ISO) ruffle (IEA) trans-Golgi network (ISO,ISS)
Snx9 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 5,891,599 - 5,982,231 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 5,891,604 - 5,982,229 (+) Ensembl GRCm39 Ensembl GRCm38 17 5,841,324 - 5,931,956 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 5,841,329 - 5,931,954 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 5,841,380 - 5,930,711 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 5,797,862 - 5,887,193 (+) NCBI MGSCv36 mm8 Celera 17 6,430,109 - 6,474,633 (+) NCBI Celera Cytogenetic Map 17 A1 NCBI cM Map 17 3.51 NCBI
SNX9 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 157,823,246 - 157,945,077 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 157,700,387 - 157,945,077 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 158,244,278 - 158,366,109 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 158,164,282 - 158,286,097 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 158,214,702 - 158,336,518 NCBI Celera 6 158,893,214 - 159,014,998 (+) NCBI Celera Cytogenetic Map 6 q25.3 NCBI HuRef 6 155,760,951 - 155,838,449 (+) NCBI HuRef CHM1_1 6 158,506,443 - 158,628,331 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 159,069,178 - 159,191,298 (+) NCBI T2T-CHM13v2.0
Snx9 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 48,827,061 - 48,915,215 (+) NCBI GRCr8 mRatBN7.2 1 46,424,897 - 46,510,096 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 46,423,553 - 46,509,036 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 46,975,856 - 47,059,358 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 52,963,109 - 53,046,607 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 47,051,280 - 47,134,782 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 46,780,142 - 46,826,250 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 46,779,860 - 46,825,830 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 48,084,891 - 48,130,894 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 1 42,155,821 - 42,201,820 (+) NCBI Celera Cytogenetic Map 1 q11 NCBI
Snx9 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955439 4,421,297 - 4,503,393 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955439 4,422,385 - 4,503,408 (-) NCBI ChiLan1.0 ChiLan1.0
SNX9 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 177,840,146 - 178,058,536 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 175,841,464 - 175,961,940 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 155,724,026 - 155,844,553 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 157,826,651 - 157,903,363 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 157,824,918 - 157,903,357 (+) Ensembl panpan1.1 panPan2
SNX9 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 47,346,214 - 47,457,417 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 47,343,668 - 47,455,937 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 48,191,531 - 48,302,806 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 47,532,216 - 47,644,795 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 47,530,968 - 47,644,779 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 47,412,288 - 47,523,565 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 47,282,028 - 47,393,272 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 47,840,744 - 47,952,026 (+) NCBI UU_Cfam_GSD_1.0
Snx9 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 142,484,264 - 142,552,848 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936489 9,736,242 - 9,804,874 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936489 9,736,255 - 9,804,841 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SNX9 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 9,130,338 - 9,239,029 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 9,130,360 - 9,239,023 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 11,253,605 - 11,362,628 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SNX9 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 13 85,468,837 - 85,549,351 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 13 85,468,479 - 85,549,988 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 57,787,751 - 57,911,509 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Snx9
.
Predicted Target Of
Count of predictions: 474 Count of miRNA genes: 300 Interacting mature miRNAs: 320 Transcripts: ENSMUST00000002436 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4141215 Mnic1_m macronutrient intake, carbohydrate 1 (mouse) Not determined 4854752 45670266 Mouse 12910982 Pifs2_m peptide-induced fatal syndrome 2 (mouse) 17 1 26189355 Mouse 12910528 Nrq1_m noise-induced hearing loss resistant QTL 1 (mouse) 17 1 29198453 Mouse 1357680 Idd23_m insulin dependent diabetes susceptibility 23 (mouse) Not determined 17 3974890 26401133 Mouse 1302196 Myaa1_m modifier of Yaa 1 (mouse) Not determined 17 1 20975022 Mouse 1302100 Circp2_m circadian photosensitivity 2 (mouse) Not determined 17 1 29198453 Mouse 4141272 Tfv1_m total food volume 1 (mouse) Not determined 4854752 65637357 Mouse 1300890 Bhr3_m bronchial hyperresponsiveness 3 (mouse) Not determined 17 3974890 48866091 Mouse 1357789 Kdnw3_m kidney weight 3 (mouse) Not determined 17 4854752 47885665 Mouse 10412276 Leci2_m leukocyte endothelial cell interactions 2 (mouse) Not determined 17 3348175 37348299 Mouse 1300706 Alan1_m alloantigen response 1 (mouse) Not determined 17 4854752 46469702 Mouse 1300613 Pcyts4_m plasmacytoma susceptibility 4 (mouse) Not determined 17 1 27081639 Mouse 1357452 Vtbt18_m vertebral trabecular bone trait 18 (mouse) Not determined 17 1 20975022 Mouse 1357902 Obq19_m obesity QTL 19 (mouse) Not determined 17 1 25662076 Mouse 1357743 Lith3_m lithogenic gene 3 (mouse) Not determined 17 1 26194456 Mouse 12910527 Nrq1a_m noise-induced hearing loss resistant QTL 1a (mouse) 17 1 29198453 Mouse 1301615 Cfld3_m cystic fibrosis lung disease 3 (mouse) Not determined 17 1 27081639 Mouse 1301327 Lmr7_m leishmaniasis resistance 7 (mouse) Not determined 17 4854752 27715939 Mouse 13524851 Asrq8_m acoustic startle response 8 (mouse) 17 1 31030170 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000002436 ⟹ ENSMUSP00000002436
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 5,891,604 - 5,982,229 (+) Ensembl GRCm38.p6 Ensembl 17 5,841,329 - 5,931,954 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000231803
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 5,891,627 - 5,940,405 (+) Ensembl GRCm38.p6 Ensembl 17 5,841,352 - 5,890,130 (+) Ensembl
RefSeq Acc Id:
NM_025664 ⟹ NP_079940
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 5,891,599 - 5,982,231 (+) NCBI GRCm38 17 5,841,324 - 5,931,956 (+) NCBI MGSCv37 17 5,841,380 - 5,930,711 (+) RGD Celera 17 6,430,120 - 6,474,633 (+) ENTREZGENE cM Map 17 ENTREZGENE
Sequence:
AGCCGGGACTTTCAGGAACTGCAGGCGCGGGCGGCGGCGGGAGTCGCCGAGCCGCGGGGGCCGGAGCGCCGAGAGCAGGACTGAGGCGGAGCCGCCGCGCCGGGCCGCAGCCACCGAACCGCAGACGG
hide sequence
RefSeq Acc Id:
XM_017317612 ⟹ XP_017173101
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 5,916,274 - 5,981,318 (+) NCBI GRCm38 17 5,865,988 - 5,931,162 (+) NCBI
Sequence:
GACACATAGTGAGCATGGGAACGCAGACACATAGTGAGTATGGGAACGCAGACACATAGTGAGC
hide sequence
RefSeq Acc Id:
XM_030249990 ⟹ XP_030105850
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 5,949,423 - 5,981,318 (+) NCBI GRCm38 17 5,899,146 - 5,931,162 (+) NCBI
Sequence:
TGTTGTCCTCAGGCCTACCAAGGACCAGCAACTGGTGATGATGACGAATGGGATGAAGACTGGG
hide sequence
RefSeq Acc Id:
NP_079940 ⟸ NM_025664
- UniProtKB:
Q91VH2 (UniProtKB/Swiss-Prot), Q3U1P2 (UniProtKB/TrEMBL), Q3TZU7 (UniProtKB/TrEMBL)
- Sequence:
MATKARVMYDFAAEPGNNELTVTEGEIITVTNPNVGGGWLEGKNNKGEQGLVPTDYVEILPNDGKDPFSCGNSVADQAFLDSLTASTAQTNSSSANSNNQVGGGNDPWTAWNAPKPGNWDSSDAWGSR
hide sequence
RefSeq Acc Id:
XP_017173101 ⟸ XM_017317612
- Peptide Label:
isoform X1
- UniProtKB:
Q3TZU7 (UniProtKB/TrEMBL)
- Sequence:
MWLLARVMYDFAAEPGNNELTVTEGEIITVTNPNVGGGWLEGKNNKGEQGLVPTDYVEILPNDGKDPFSCGNSVADQAFLDSLTASTAQTNSSSANSNNQVGGGNDPWTAWNAPKPGNWDSSDAWGSR
hide sequence
RefSeq Acc Id:
XP_030105850 ⟸ XM_030249990
- Peptide Label:
isoform X2
- UniProtKB:
Q9CZK0 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSMUSP00000002436 ⟸ ENSMUST00000002436
RGD ID: 6828705 Promoter ID: MM_KWN:21947 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, Kidney, Lung, Spleen Transcripts: NM_025664 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 17 5,841,076 - 5,841,827 (+) MPROMDB
RGD ID: 13674626 Promoter ID: EPDNEW_M21463 Type: initiation region Name: Snx9_1 Description: Mus musculus sorting nexin 9 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 17 5,841,365 - 5,841,425 EPDNEW
RGD ID: 6828704 Promoter ID: MM_KWN:21949 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, Kidney Transcripts: ENSMUST00000002436 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 17 5,886,726 - 5,887,226 (+) MPROMDB
