Tcap (titin-cap) - Rat Genome Database

Name: Tcap
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Tcap (titin-cap) Mus musculus

Analyze

Symbol:

Tcap

Name:

titin-cap

RGD ID:

1620095

MGI Page

MGI

Description:

Predicted to enable several functions, including BMP binding activity; cytoskeletal protein binding activity; and titin Z domain binding activity. Predicted to be a structural constituent of muscle. Involved in adult heart development; otic vesicle formation; and somitogenesis. Located in Z disc. Is expressed in embryo; heart; otocyst; tail somite; and trunk somite. Used to study autosomal recessive limb-girdle muscular dystrophy type 2G. Human ortholog(s) of this gene implicated in autosomal recessive limb-girdle muscular dystrophy type 2G and hypertrophic cardiomyopathy 25. Orthologous to human TCAP (titin-cap).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

AI503981; AJ223855; Telet; telethonin; titin cap protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TCAP (titin-cap)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Tcap (titin-cap)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Tcap (titin-cap)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TCAP (titin-cap)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TCAP (titin-cap)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tcap (titin-cap)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TCAP (titin-cap)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TCAP (titin-cap)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tcap (titin-cap)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TCAP (titin-cap)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tcap (titin-cap (telethonin))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tcap	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	98,274,637 - 98,275,779 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	98,274,637 - 98,275,779 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	98,383,811 - 98,384,953 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	98,383,811 - 98,384,953 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	98,245,125 - 98,246,267 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	98,199,901 - 98,201,302 (+)	NCBI		MGSCv36	mm8
Celera	11	108,038,035 - 108,039,177 (+)	NCBI		Celera
Cytogenetic Map	11	D	NCBI
cM Map	11	61.75	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal recessive limb-girdle muscular dystrophy type 2G (IAGP,ISO)

Brugada syndrome (ISO)

cardiomyopathy (ISO)

dilated cardiomyopathy (ISO)

Dilated Cardiomyopathy with Left Ventricular Noncompaction (ISO)

familial hypertrophic cardiomyopathy (ISO)

hypertrophic cardiomyopathy (ISO)

hypertrophic cardiomyopathy 1 (ISO)

hypertrophic cardiomyopathy 25 (ISO)

hypertrophic cardiomyopathy 4 (ISO)

isolated elevated serum creatine phosphokinase levels (ISO)

long QT syndrome (ISO)

Sudden Unexpected Nocturnal Death Syndrome (ISO)

Ventricular Tachycardia (ISO)

Wolff-Parkinson-White syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,3-dimethoxynaphthalene-1,4-dione (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP)

2-palmitoylglycerol (ISO)

6-propyl-2-thiouracil (ISO)

aristolochic acid A (ISO)

benzo[a]pyrene (EXP,ISO)

Benzo[k]fluoranthene (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (ISO)

cantharidin (EXP)

carbon nanotube (EXP)

cisplatin (ISO)

copper(II) sulfate (ISO)

dextran sulfate (EXP)

dibenz[a,h]anthracene (EXP)

Dibutyl phosphate (ISO)

dioxygen (EXP)

doxorubicin (EXP,ISO)

etoposide (ISO)

graphite (EXP)

Licochalcone B (ISO)

methamphetamine (EXP)

ozone (EXP)

phenformin (ISO)

pioglitazone (EXP)

pirinixic acid (ISO)

rotenone (ISO)

serpentine asbestos (EXP)

sevoflurane (EXP)

silicon dioxide (EXP)

sunitinib (ISO)

tamoxifen (EXP)

testosterone enanthate (ISO)

titanium dioxide (EXP,ISO)

triclosan (ISO)

tris(2-butoxyethyl) phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adult heart development (IEP,ISO)

cardiac muscle cell development (ISO)

cardiac muscle contraction (IBA,IEA,ISO)

cardiac muscle hypertrophy (ISO)

cardiac muscle hypertrophy in response to stress (IEA,ISO)

cardiac muscle tissue morphogenesis (IBA,IEA,ISO)

cardiac myofibril assembly (IBA,IEA,ISO)

detection of muscle stretch (IBA,IEA,ISO)

otic vesicle formation (IEP)

sarcomere organization (ISO)

sarcomerogenesis (IBA,IEA,ISO)

skeletal muscle contraction (IBA,IEA)

skeletal muscle myosin thick filament assembly (IBA,IEA,ISO)

skeletal muscle thin filament assembly (IBA,IEA,ISO)

somitogenesis (IEP)

Cellular Component

I band (IDA)

Z disc (IBA,IDA,ISO)

Molecular Function

BMP binding (IEA,ISO)

FATZ binding (IEA,ISO)

molecular adaptor activity (ISO)

protein binding (IPI)

protein-macromolecule adaptor activity (IBA,IEA,ISO)

structural constituent of muscle (IBA,IEA,ISO)

titin binding (IBA,IEA,ISO)

titin Z domain binding (IEA,ISO)

transmembrane transporter binding (IEA,ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal muscle physiology (IAGP)

abnormal sarcomere morphology (IAGP)

cardiac fibrosis (IAGP)

cardiac hypertrophy (IAGP)

centrally nucleated skeletal muscle fibers (IAGP)

congestive heart failure (IAGP)

decreased skeletal muscle fiber diameter (IAGP)

impaired coordination (IAGP)

increased cardiomyocyte apoptosis (IAGP)

increased response of heart to induced stress (IAGP)

myopathy (IAGP)

skeletal muscle fiber atrophy (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
2.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9350988	PMID:9817758	PMID:10208846	PMID:10349636	PMID:10655062	PMID:11042159	PMID:11076861	PMID:11217851	PMID:11842093	PMID:12466851	PMID:12477932	PMID:12507422
PMID:15489334	PMID:16141072	PMID:16141073	PMID:16702235	PMID:18440815	PMID:20233748	PMID:21267068	PMID:21305318	PMID:21799151	PMID:21873635	PMID:21884692	PMID:23100327
PMID:24280220	PMID:25121604	PMID:32937135	PMID:34566695	PMID:35149920	PMID:36574402	PMID:38569934

Genomics

Comparative Map Data

Tcap
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	98,274,637 - 98,275,779 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	98,274,637 - 98,275,779 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	98,383,811 - 98,384,953 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	98,383,811 - 98,384,953 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	98,245,125 - 98,246,267 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	98,199,901 - 98,201,302 (+)	NCBI		MGSCv36	mm8
Celera	11	108,038,035 - 108,039,177 (+)	NCBI		Celera
Cytogenetic Map	11	D	NCBI
cM Map	11	61.75	NCBI

TCAP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	39,665,349 - 39,666,554 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	39,665,349 - 39,666,554 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	37,821,602 - 37,822,807 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	35,075,125 - 35,076,333 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	35,075,124 - 35,076,333	NCBI
Celera	17	34,481,328 - 34,482,536 (+)	NCBI		Celera
Cytogenetic Map	17	q12	NCBI
HuRef	17	33,615,530 - 33,616,738 (+)	NCBI		HuRef
CHM1_1	17	38,057,420 - 38,058,628 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	40,528,914 - 40,530,119 (+)	NCBI		T2T-CHM13v2.0

Tcap
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	83,878,006 - 83,879,174 (+)	NCBI		GRCr8
mRatBN7.2	10	83,381,719 - 83,382,887 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	83,381,719 - 83,382,887 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	88,326,068 - 88,327,236 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	87,824,153 - 87,825,321 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	83,216,804 - 83,217,972 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	86,337,705 - 86,338,414 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	86,337,728 - 86,338,411 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Celera	10	82,128,978 - 82,130,146 (+)	NCBI		Celera
Cytogenetic Map	10	q31	NCBI

Tcap
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955451	14,413,657 - 14,414,735 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955451	14,413,657 - 14,414,735 (+)	NCBI	ChiLan1.0	ChiLan1.0

TCAP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	25,288,846 - 25,290,210 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	27,183,653 - 27,186,577 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	17,622,318 - 17,625,252 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	17,839,139 - 17,841,500 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	17,839,139 - 17,842,727 (-)	Ensembl	panpan1.1		panPan2

TCAP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	22,811,792 - 22,812,980 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	22,794,177 - 22,813,012 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	22,284,243 - 22,285,432 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	23,605,436 - 23,606,624 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	23,605,424 - 23,606,633 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	22,378,080 - 22,379,268 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	22,639,078 - 22,640,266 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	22,764,185 - 22,765,373 (-)	NCBI		UU_Cfam_GSD_1.0

Tcap
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	22,217,447 - 22,220,249 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936490	14,856,433 - 14,857,722 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936490	14,856,433 - 14,857,692 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TCAP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	22,651,664 - 22,653,722 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	22,651,666 - 22,652,904 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	23,107,378 - 23,108,618 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TCAP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	66,500,535 - 66,503,455 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	66,500,949 - 66,501,703 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	37,412,117 - 37,414,438 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tcap
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624795	3,410,951 - 3,413,052 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624795	3,411,744 - 3,414,229 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tcap
33 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	315
Count of miRNA genes:	254
Interacting mature miRNAs:	266
Transcripts:	ENSMUST00000008021
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
27226783	Tibl5_m	tibia length 5, 5 week (mouse)					11	68190826	101890826	Mouse
1302034	Pkccl_m	protein kinase C content in lungs (mouse)			Not determined		11	91604608	121973369	Mouse
1300628	Lgth6_m	body length 6 (mouse)			Not determined		11	66733420	100733652	Mouse
4141367	Inf1_m	acute ozone induced inflammation (mouse)			Not determined			44630038	113058009	Mouse
1558812	Rafar_m	retinoic acid induced forelimb autopod reduction (mouse)			Not determined		11	70691198	104691366	Mouse
1301535	Pas5b_m	pulmonary adenoma susceptibility 5b (mouse)			Not determined		11	96176465	108806384	Mouse
1300766	Skull16_m	skull morphology 16 (mouse)			Not determined		11	81574481	115574636	Mouse
1301404	Sbmd4_m	spinal bone mineral density 4 (mouse)			Not determined		11	72019649	106019734	Mouse
12910539	Sstapa3_m	suseptibility to Staphylococcus aureus infection 3 (mouse)					11	96897693	110603991	Mouse
4142121	Tmc1m2_m	Tmc1 modifier 2 (mouse)			Not determined		11	56864027	114157957	Mouse
27226758	Femd3_m	femur midshaft diameter 3, 5 week (mouse)					11	80890826	101890826	Mouse
14747003	Mancz9_m	mandible centroid size 9 (mouse)					11	85844911	119844911	Mouse
1301640	Lore4_m	loss of righting induced by ethanol 4 (mouse)			Not determined		11	79156009	107616472	Mouse
10412288	Carg4_m	Candida albicans resistance gene 4 (mouse)			Not determined		11	81810267	115810267	Mouse
11251723	Ewc5_m	ethanol withdrawal and consumption 5 (mouse)					11	89869251	121973369	Mouse
1301681	Sle13_m	systematic lupus erythematosus susceptibility 13 (mouse)			Not determined		11	70691198	104691366	Mouse
1300784	Prdt3_m	prion disease incubation time 3 (mouse)			Not determined		11	66733420	100733652	Mouse
4141339	Nilac2_m	nicotine induced locomotor activity 2 (mouse)			Not determined		11	70691198	104691366	Mouse
10413882	Moe1_m	modifier of epilepsy 1 (mouse)					11	77770978	111771099	Mouse
11039501	Ltpr6a_m	Leishmania tropica response 6a (mouse)					11	64830336	98830473	Mouse
4141465	Dbm2_m	diabetes modifier 2 (mouse)			Not determined			94437183	118022724	Mouse
11039502	Ltpr6b_m	Leishmania tropica response 6b (mouse)					11	64830336	98830473	Mouse
10045617	Heal26_m	wound healing/regeneration 26 (mouse)			Not determined		11	92939373	112544554	Mouse
10045616	Heal25_m	wound healing/regeneration 25 (mouse)			Not determined		11	77437183	111437322	Mouse
1357631	Motr1_m	modifier of tubby retinal degeneration 1 (mouse)			Not determined		11	87691198	103274115	Mouse
1301310	Tmevd5_m	Theiler's murine encephalomyelitis virus induced demyelinating disease susceptibility 5 (mouse)			Not determined		11	72726125	106726289	Mouse
1301153	Estq3_m	estradiol regulated response QTL 3 (mouse)			Not determined		11	96897693	99327028	Mouse
4142348	Pstc2_m	periosteal circumference 2 (mouse)			Not determined		11	72818615	106818733	Mouse
11039515	Ltpr6_m	Leishmania tropica response 6 (mouse)					11	64830336	98830473	Mouse
1301414	Heal10_m	wound healing/regeneration 10 (mouse)			Not determined		11	77437183	111437322	Mouse
1300651	Pcyts3_m	plasmacytoma susceptibility 3 (mouse)			Not determined		11	70691198	104691366	Mouse
1301546	Pcir2_m	periosteal circumference 2 (mouse)			Not determined		11	66733420	100733652	Mouse
1300649	Crhq1_m	compensatory renal hypertrophy QTL 1 (mouse)			Not determined		11	81574481	115574636	Mouse
27226789	Feml16_m	femur length 16, 10 week (mouse)					11	87490826	121873369	Mouse
14746970	Manh71_m	mandible shape 71 (mouse)					11	79416257	113416257	Mouse
10043865	T2dm5sa_m	type 2 diabetes mellitus 5 in SMXA RI mice (mouse)			Not determined		11	79813759	104502698	Mouse
1300944	Alcp20_m	alcohol preference locus 20 (mouse)			Not determined		11	95403965	121973369	Mouse
1301072	Eae22_m	experimental allergic encephalomyelitis 22 (mouse)			Not determined		11	82377698	116377820	Mouse
10043866	Adip19_m	adiposity 19 (mouse)			Not determined		11	72818615	106818733	Mouse
39128214	Lwq20_m	liver weight QTL 20 (mouse)					11	12268637	118022724	Mouse
4141939	Pregq2_m	pregnancy QTL 2 (mouse)			Not determined		11	94063779	118022724	Mouse
11038695	Par8_m	pulmonary adenoma resistance 8 (mouse)					11	77063779	111063918	Mouse
1301057	Nidd4_m	non-insulin-dependent diabetes mellitus 4 (mouse)			Not determined		11	96810136	121973369	Mouse
1357766	Si5lq6_m	serum IGFBP-5 level QTL 6 (mouse)			Not determined		11	66733420	100733652	Mouse
1301958	Alcp18_m	alcohol preference locus 18 (mouse)			Not determined		11	95403965	121973369	Mouse
1301833	Tbbmd5_m	total body bone mineral density 5 (mouse)			Not determined		11	66733420	100733652	Mouse
1301491	Abbp4_m	A/J and C57BL/6 blood pressure 4 (mouse)			Not determined		11	88699588	99081597	Mouse
15014785	Mvlq1_m	macrovesicular liver lesion QTL 1 (mouse)					11	86608320	120608320	Mouse
4141012	Femwf6_m	femur work to failure 6 (mouse)			Not determined			66733420	100733652	Mouse
15039374	Adip29_m	adiposity 29 (mouse)					11	86608320	120608320	Mouse
1300962	Cd8mts4_m	CD8 memory T cell subset 4 (mouse)			Not determined		11	96137674	121973369	Mouse
1301095	El6_m	epilepsy 6 (mouse)			Not determined		11	93229183	121973369	Mouse
27226731	Tibmd4_m	tibia midshaft diameter 4, 10 week (mouse)					11	94190826	118890826	Mouse
27226730	Tibmd1_m	tibia midshaft diameter 1, 5 week (mouse)					11	62590826	109390826	Mouse
15039376	Bw42_m	body weight QTL 42 (mouse)					11	86608320	120608320	Mouse
1558753	Ath19_m	atherosclerosis 19 (mouse)			Not determined		11	91604608	121973369	Mouse
10044007	Hbnr14_m	Heligmosomoides bakeri nematode resistance 14 (mouse)			Not determined		11	87502600	121502698	Mouse
1302124	Eae7_m	susceptibility to experimental allergic encephalomyelitis 7 (mouse)			Not determined		11	77573873	99377820	Mouse

Markers in Region

AI503981

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	11	98,384,769 - 98,384,863	UniSTS	GRCm38
MGSCv37	11	98,246,083 - 98,246,177	UniSTS	GRCm37
Celera	11	108,038,993 - 108,039,087	UniSTS
Cytogenetic Map	11	D	UniSTS
Whitehead/MRC_RH	11	1308.14	UniSTS
Whitehead/MRC_RH	11	1306.72	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_011540	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AJ223854	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ223855	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK010167	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL591390	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC027631	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC032992	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466556	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Y15845	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000008021 ⟹ ENSMUSP00000008021

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	98,274,637 - 98,275,779 (+)	Ensembl
GRCm38.p6 Ensembl	11	98,383,811 - 98,384,953 (+)	Ensembl

RefSeq Acc Id:

NM_011540 ⟹ NP_035670

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	11	98,274,637 - 98,275,779 (+)	NCBI
GRCm38	11	98,383,811 - 98,384,953 (+)	ENTREZGENE
MGSCv37	11	98,245,125 - 98,246,267 (+)	RGD
Celera	11	108,038,035 - 108,039,177 (+)	RGD
cM Map	11		ENTREZGENE

Sequence:

show sequence

AGGAGCAGGACATAGCAGAGGGAGCAATCAGAAATCATGGCCACTTCAGAGCTGAGCTGCCAAG
TGTCTGAGGAGAACCAGGAACGCAGGGAAGCCTTCTGGGCTGAGTGGAAAGACCTGACTCTGTC
TACCCGGCCGGAAGAGGGATGCTCCTTGCACGAGGAGGATACACAGAGGCATGAGACCTACCAC
CGGCAGGGACAGTGTCAGGCGGTGGTACAGCGCTCACCATGGCTGGTGATGCGCCTGGGTATCC
TCGGCCGTGGGCTACAGGAATACCAGCTGCCGTACCAGCGGGTGCTGCCCCTACCCATCTTCAC
GCCCACCAAGGTGGGGGCCTCCAAGGAGGAGCGCGAGGAGACCCCCATCCAGCTTCGGGAGCTG
CTGGCCCTGGAGACGGCCCTGGGCGGCCAGTGCGTGGAGCGCCAGGACGTGGCTGAGATCACAA
AGCAGCTTCCCCCTGTGGTGCCAGTCAGCAAACCCGGGCCCCTGCGCCGTACCCTGTCTCGATC
CATGTCTCAGGAAGCTCAGAGAGGCTGAGATGGACTGTGTGACTCAGACTCCACTGTGTCTGTC
TCAGGCTAGGCACTTCCTGGCTAGGACAATGGAGGAGAGCTGCTGGCAGTGGCTGCTTTGTAGT
TTGCCCAGAGGTGGGAGCTATGGGAGGAGGGAGCCCGAGGCCAGGATGCCTAGGTGTCCTGAGT
CCCCACAGGGAAGGGAGCGAGGATGGCGGGCACTAGGAGTGGAGAGCTGAGCACCCTCAGCCCC
AGAAGAAGAGACAAGAGATCCTGGTGAGAGGAGAGGCCCCTGGGAATGGCCTGCTCGGGAACAG
ATGGACTAGGAGAAGGATGTGCAACGCTCTGGAAAGGAGGGGGATGTGAAGAGGGTGGAAGTGG
GCAGGCCCCCAGCACCCTCTGGTAGCACTGCAATAAATGCTCAGCCATGTTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_035670	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH27631	(Get FASTA)	NCBI Sequence Viewer
	BAB26743	(Get FASTA)	NCBI Sequence Viewer
	CAA11585	(Get FASTA)	NCBI Sequence Viewer
	CAA11586	(Get FASTA)	NCBI Sequence Viewer
	CAB38077	(Get FASTA)	NCBI Sequence Viewer
	EDL16136	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000008021
	ENSMUSP00000008021.3
GenBank Protein	O70548	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_035670 ⟸ NM_011540
- UniProtKB:	O70548 (UniProtKB/Swiss-Prot), Q545G3 (UniProtKB/TrEMBL), O70549 (UniProtKB/TrEMBL)
- Sequence:	show sequence MATSELSCQVSEENQERREAFWAEWKDLTLSTRPEEGCSLHEEDTQRHETYHRQGQCQAVVQRS PWLVMRLGILGRGLQEYQLPYQRVLPLPIFTPTKVGASKEEREETPIQLRELLALETALGGQCV ERQDVAEITKQLPPVVPVSKPGPLRRTLSRSMSQEAQRG hide sequence

Ensembl Acc Id:

ENSMUSP00000008021 ⟸ ENSMUST00000008021

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O70548-F1-model_v2	AlphaFold	O70548	1-167	view protein structure

Promoters

RGD ID:

6822296

Promoter ID:

MM_KWN:9567

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

BoneMarrow_2Hour, BoneMarrow_4Hour

Transcripts:

NM_011540

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	11	98,244,756 - 98,245,602 (+)	MPROMDB

RGD ID:

8676482

Promoter ID:

EPDNEW_M16272

Type:

multiple initiation site

Name:

Tcap_1

Description:

Mus musculus titin-cap , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	11	98,383,824 - 98,383,884	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:1330233	AgrOrtholog
Ensembl Genes	ENSMUSG00000007877	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000008021	ENTREZGENE
	ENSMUST00000008021.3	UniProtKB/Swiss-Prot
Gene3D-CATH	2.20.160.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Telethonin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Titin-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:21393	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGD	MGI:1330233	ENTREZGENE
NCBI Gene	21393	ENTREZGENE
PANTHER	PTHR15143	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TELETHONIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Telethonin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Tcap	PhenoGen
UniProt	O70548	ENTREZGENE
	O70549	ENTREZGENE, UniProtKB/TrEMBL
	Q545G3	ENTREZGENE, UniProtKB/TrEMBL
	TELT_MOUSE	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Mammalian Phenotype