No known orthologs.
Symbol:
Skint3
Name:
selection and upkeep of intraepithelial T cells 3
RGD ID:
1619888
MGI Page
MGI
Description:
Predicted to enable signaling receptor binding activity. Predicted to be involved in T cell receptor signaling pathway and regulation of cytokine production. Predicted to be located in membrane. Predicted to be active in external side of plasma membrane. Is expressed in several structures, including genitourinary system; gut; integumental system; liver; and thymus.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
A430090E18Rik; RP23-29D6.1; selection and upkeep of intraepithelial T-cells protein 3; skint 3; Skint-3
RGD Orthologs
Alliance Orthologs
More Info
homologs ...
More Info
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 112,089,442 - 112,157,665 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 112,089,442 - 112,157,665 (+) Ensembl GRCm39 Ensembl GRCm38 4 112,232,245 - 112,300,468 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 112,232,245 - 112,300,468 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 111,904,850 - 111,973,073 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 111,730,177 - 111,798,400 (+) NCBI MGSCv36 mm8 MGSCv36 4 109,986,001 - 110,055,097 (+) NCBI MGSCv36 mm8 Cytogenetic Map 4 D1 NCBI cM Map 4 51.53 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Skint3 Mouse 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Skint3 Mouse 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Skint3 Mouse 2,2',5,5'-tetrachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Skint3 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SKINT3 mRNA CTD PMID:26377647 Skint3 Mouse 2,4,4'-trichlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Skint3 Mouse benzo[b]fluoranthene decreases expression EXP 6480464 benzo(b)fluoranthene results in decreased expression of SKINT3 mRNA CTD PMID:26377693 Skint3 Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of SKINT3 mRNA CTD PMID:34319233 Skint3 Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 Skint3 Mouse folic acid increases expression EXP 6480464 Folic Acid results in increased expression of SKINT3 mRNA CTD PMID:25629700 Skint3 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of SKINT3 mRNA CTD PMID:34911549 Skint3 Mouse PCB138 multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Skint3 Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of SKINT3 mRNA CTD PMID:29264374
1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4,4'-trichlorobiphenyl (EXP) benzo[b]fluoranthene (EXP) bis(2-ethylhexyl) phthalate (EXP) carbon nanotube (EXP) folic acid (EXP) ozone (EXP) PCB138 (EXP) titanium dioxide (EXP)
.
Predicted Target Of
Count of predictions: 1052 Count of miRNA genes: 384 Interacting mature miRNAs: 432 Transcripts: ENSMUST00000038455, ENSMUST00000170945 Prediction methods: Miranda Result types: miRGate_prediction
13824982 Svwq1_m seminal vesicle weight QTL 1 (mouse) 4 89888237 118857197 Mouse 11532714 Sluc43_m susceptibility to lung cancer 43 (mouse) 4 46642108 123127211 Mouse 12904002 Opfaq9_m open field activity QTL 9 (mouse) 4 92975790 126975790 Mouse 4141623 W6q13_m weight 6 weeks QTL 13 (mouse) Not determined 88982069 140468203 Mouse 12910797 Pwgrq4_m pre-weaning growth rate QTL 4 (mouse) 4 105835310 141433838 Mouse 25314312 Syncl2_m synaptonemal complex length 2 (mouse) 4 65718237 146584457 Mouse 1357726 Lnopy1_m lens opacity 1 (mouse) Not determined 4 85428838 119429037 Mouse 12910794 Pwbwq8_m post-weaning body weight QTL 8 (mouse) 4 105835310 141433838 Mouse 14696689 Gdq2_m grooming duration QTL 2, females (mouse) 4 100857197 124893793 Mouse 1300743 Skull6_m skull morphology 6 (mouse) Not determined 4 111009051 145009280 Mouse 1301382 Arvm2_m autoimmune renal vasculitis 2 (mouse) Not determined 4 107791564 141791756 Mouse 12910813 Pwbwq4_m pre-weaning body weight QTL 4 (mouse) 4 105835310 141433838 Mouse 4141093 W3q17_m weight 3 weeks QTL 17 (mouse) Not determined 88982069 140468203 Mouse 12910808 Pwbwq9_m post-weaning body weight QTL 9 (mouse) 4 105835310 141433838 Mouse 27095939 Ulnl9_m ulna length 9, 16 week (mouse) 4 65318237 118857197 Mouse 11567249 Elorr3_m ethanol induced loss of righting response 3 (mouse) 4 3722677 156268235 Mouse 12904933 Edlmmq3_m extensor digitorum longus muscle mass QTL 3 (mouse) 4 81213991 115213991 Mouse 1301815 Sles2_m systemic lupus erythmatosus suppressor 2 (mouse) Not determined 4 94957579 150676858 Mouse 1300663 Start2_m startle response 2 (mouse) Not determined 4 107264957 141265153 Mouse 1300918 Stheal4_m soft tissue heal 4 (mouse) Not determined 4 89969627 123969747 Mouse 1301556 Cd4vts1_m CD4 virgin T cell subset 1 (mouse) Not determined 4 85428838 119429037 Mouse 1301823 Bmd7_m bone mineral density 7 (mouse) Not determined 4 88982069 151654550 Mouse 1302204 Spm1_m splenomegaly modifier (mouse) Not determined 4 82244395 116244582 Mouse 11039517 Ltpr4_m Leishmania tropica response 4 (mouse) 4 79365751 113365867 Mouse 10412072 Ssen1_m suseptibility to Sendai virus 1 (mouse) Not determined 4 109658132 133154782 Mouse 11039504 Ltpr4a_m Leishmania tropica response 4a (mouse) 4 79365751 113365867 Mouse 11039505 Ltpr4c_m Leishmania tropica response 4c (mouse) 4 79365751 113365867 Mouse 1301930 Papg1_m pulmonary adenoma progression 1 (mouse) Not determined 4 85781167 119781279 Mouse 11039506 Ltpr4b_m Leishmania tropica response 4b (mouse) 4 79365751 113365867 Mouse 13208562 Wght7_m weight 7 (mouse) 4 90888237 148084457 Mouse 13208565 Bmiq6_m body mass index QTL 6 (mouse) 4 110857197 125893793 Mouse 1300781 Lith8_m lithogenic gene 8 (mouse) Not determined 4 107264957 141265153 Mouse 39128212 Lwq21_m liver weight QTL 21 (mouse) 4 88982069 140468203 Mouse 1300689 Dob1_m Dietary obesity 1 (mouse) Body weight 4 101574601 123127211 Mouse 27226716 Metcl2_m metatarsal-calcaneal length 2, 5 week (mouse) 4 88118237 118557197 Mouse 1301847 Fecq2_m fecundity QTL 2 (mouse) Not determined 4 100071971 134072206 Mouse 26884445 Sklq7_m skull length QTL 7, 10 week (mouse) 4 68018237 150884457 Mouse 1301597 Anxty_m anxiety (mouse) Not determined 4 74137574 128009280 Mouse 26884437 Sklq13_m skull length QTL 13, 16 week (mouse) 4 57700000 155684457 Mouse 4141549 W10q10_m weight 10 weeks QTL 10 (mouse) Not determined 88982069 140468203 Mouse 1357895 Ctrcts_m cataract severity (mouse) Not determined 4 45709925 138342753 Mouse 1300809 Ccrs2_m corpus callosum hemisphere surface size 2 (mouse) Not determined 4 107264957 141265153 Mouse 4142047 Mvwf3_m modifier of von Willebrand factor 3 (mouse) Not determined 14010457 117072206 Mouse 1301106 Skts7_m skin tumor susceptibility 7 (mouse) Not determined 4 100071971 134072206 Mouse 1301233 Sbw2_m splenomegaly-NZB x NZW 2 (mouse) Not determined 4 94957579 128009280 Mouse 10755520 Rbc1_m red blood cell count 1 (mouse) 4 108477692 142477692 Mouse 10755521 Hct1_m hematocrit 1 (mouse) 4 108477692 142477692 Mouse 10755522 Hgb1_m hemoglobin 1 (mouse) 4 108477692 142477692 Mouse 27095924 Pglq2_m pelvic girdle length QTL 2, 5 week (mouse) 4 69118237 130727311 Mouse 1301118 Bbaa23_m B.burgdorferi-associated arthritis 23 (mouse) Not determined 4 85781167 119781279 Mouse 11532738 Abd1_m autoimmune biliary disease 1 (mouse) 4 88982069 116271120 Mouse 15039368 Nmrs19_m NAFLD-associated magnetic resonance shift 19 (mouse) 4 90882780 124882780 Mouse 27095917 Scvln14_m sacral vertebrae length 2, 16 week (mouse) 4 68018237 130277062 Mouse 1301731 Cafq2_m caffeine metabolism QTL 2 (mouse) Not determined 4 94732255 128732454 Mouse 4141900 Skts-fp1_m skin tumor susceptibility in FVB and PWK 1 (mouse) Not determined 4 53550839 124055180 Mouse 15039382 Ltgq7_m liver triglyceride QTL 7 (mouse) 4 105705794 139705794 Mouse 15039377 Bw45_m body weight QTL 45 (mouse) 4 105705794 139705794 Mouse 1300839 Dyscalc2_m dystrophic cardiac calcinosis 2 (mouse) Not determined 4 111009051 145009280 Mouse 12880433 Fgf23lq1_m FGF23 serum level QTL 1 (mouse) 4 101157197 135157197 Mouse 1300580 Lbw2_m lupus NZB x NZW 2 (mouse) Not determined 4 98545539 128009280 Mouse 15039378 Adip30_m adiposity 30 (mouse) 4 105705794 139705794 Mouse 1301867 Idd11_m insulin dependent diabetes susceptibility 11 (mouse) Not determined 4 83604870 117605006 Mouse 26884449 Sklq2_m skull length QTL 2, 5 week (mouse) 4 36700000 128993793 Mouse 27095905 Scvln3_m sacral vertebrae length 2, 5 week (mouse) 4 55600000 128993793 Mouse 1357800 Tgq3_m triglyceride QTL 3 (mouse) Not determined 4 107055093 141055180 Mouse 11553870 Cmmm_m carcinoma modifier of MSM (mouse) 4 90590668 124590781 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000038455 ⟹ ENSMUSP00000042662
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 112,089,442 - 112,157,665 (+) Ensembl GRCm38.p6 Ensembl 4 112,232,245 - 112,300,468 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000170945 ⟹ ENSMUSP00000131300
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 112,089,442 - 112,157,665 (+) Ensembl GRCm38.p6 Ensembl 4 112,232,245 - 112,300,468 (+) Ensembl
RefSeq Acc Id:
NM_001102474 ⟹ NP_001095944
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 112,089,442 - 112,157,665 (+) NCBI GRCm38 4 112,232,245 - 112,300,468 (+) NCBI MGSCv37 4 111,904,850 - 111,973,073 (+) RGD cM Map 4 ENTREZGENE
Sequence:
ATATCAGGCTTGCAGAATCATAGGGGCAGACTTTCAGAGTAGGAGAGTGGACATTAATATTTAATTTTCCTGATTTCCATATAACTCTGATATACTTTATGGCTTCAAGAAAACTGTGGAAGTATTAT
hide sequence
RefSeq Acc Id:
NM_001348354 ⟹ NP_001335283
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 112,089,442 - 112,157,665 (+) NCBI GRCm38 4 112,232,245 - 112,300,468 (+) NCBI
Sequence:
ATATCAGGCTTGCAGAATCATAGGGGCAGACTTTCAGAGTAGGAGAGTGGACATTAATATTTAA
hide sequence
RefSeq Acc Id:
NM_177578 ⟹ NP_808246
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 112,089,442 - 112,157,665 (+) NCBI GRCm38 4 112,232,245 - 112,300,468 (+) ENTREZGENE MGSCv37 4 111,904,850 - 111,973,073 (+) RGD cM Map 4 ENTREZGENE
Sequence:
ATATCAGGCTTGCAGAATCATAGGGGCAGACTTTCAGAGTAGGAGAGTGGACATTAATATTTAATTTTCCTGATTTCCATATAACTCTGATATACTTTATGGCTTCAAGAAAACTGTGGAAGTATTAT
hide sequence
RefSeq Acc Id:
NP_808246 ⟸ NM_177578
- Peptide Label:
isoform b precursor
- UniProtKB:
A7TZF0 (UniProtKB/Swiss-Prot)
- Sequence:
MGSIQIIFAAYCVVLCVLQMLVLSSEQFTITGLERPVLAPLGGILELSCQLSPPQNAQQMEIRWFRNRYTEPVYLYRNGKDLHGETISKYVERTELLKHDIGKGKVTLRVFKVTVDDDGSYHCVFKDG
hide sequence
RefSeq Acc Id:
NP_001095944 ⟸ NM_001102474
- Peptide Label:
isoform a precursor
- UniProtKB:
A7TZF2 (UniProtKB/Swiss-Prot), Q8BIN0 (UniProtKB/Swiss-Prot), A7TZF0 (UniProtKB/Swiss-Prot)
- Sequence:
MGSIQIIFAAYCVVLCVLQMLVLSSEQFTITGLERPVLAPLGGILELSCQLSPPQNAQQMEIRW
hide sequence
RefSeq Acc Id:
NP_001335283 ⟸ NM_001348354
- Peptide Label:
isoform c precursor
- UniProtKB:
A7TZF0 (UniProtKB/Swiss-Prot)
Ensembl Acc Id:
ENSMUSP00000131300 ⟸ ENSMUST00000170945
Ensembl Acc Id:
ENSMUSP00000042662 ⟸ ENSMUST00000038455
