Symbol:
Cep120
Name:
centrosomal protein 120
RGD ID:
1618987
MGI Page
MGI
Description:
Involved in centrosome cycle; positive regulation of centrosome duplication; and positive regulation of cilium assembly. Acts upstream of or within several processes, including astral microtubule organization; nervous system development; and regulation of microtubule-based process. Located in centriole and centrosome. Is expressed in central nervous system; peripheral nervous system ganglion; and sensory organ. Human ortholog(s) of this gene implicated in Joubert syndrome 31 and short-rib thoracic dysplasia 13 with or without polydactyly. Orthologous to human CEP120 (centrosomal protein 120).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
A230075C01; AU016693; Ccdc100; centrosomal protein of 120 kDa; coiled-coil domain containing 100; coiled-coil domain-containing protein 100; expressed sequence AU016693
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CEP120 (centrosomal protein 120) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Cep120 (centrosomal protein 120) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cep120 (centrosomal protein 120) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CEP120 (centrosomal protein 120) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CEP120 (centrosomal protein 120) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cep120 (centrosomal protein 120) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CEP120 (centrosomal protein 120) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CEP120 (centrosomal protein 120) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cep120 (centrosomal protein 120) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Cep120 (centrosomal protein 120)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CEP120 (centrosomal protein 120)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
rha
Alliance
DIOPT (InParanoid|OrthoFinder)
Xenopus tropicalis (tropical clawed frog):
cep120
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 53,814,795 - 53,877,825 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 53,814,795 - 53,877,680 (-) Ensembl GRCm39 Ensembl GRCm38 18 53,681,723 - 53,745,636 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 53,681,723 - 53,744,608 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 53,841,377 - 53,904,201 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 53,807,092 - 53,869,916 (-) NCBI MGSCv36 mm8 Celera 18 54,986,023 - 55,048,783 (-) NCBI Celera Cytogenetic Map 18 D1 NCBI cM Map 18 29.07 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Cep120 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 53,814,795 - 53,877,825 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 53,814,795 - 53,877,680 (-) Ensembl GRCm39 Ensembl GRCm38 18 53,681,723 - 53,745,636 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 53,681,723 - 53,744,608 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 53,841,377 - 53,904,201 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 53,807,092 - 53,869,916 (-) NCBI MGSCv36 mm8 Celera 18 54,986,023 - 55,048,783 (-) NCBI Celera Cytogenetic Map 18 D1 NCBI cM Map 18 29.07 NCBI
CEP120 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 123,344,892 - 123,423,842 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 123,344,890 - 123,423,592 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 122,680,586 - 122,759,536 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 122,708,478 - 122,787,151 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 5 118,636,070 - 118,714,783 (-) NCBI Celera Cytogenetic Map 5 q23.2 NCBI HuRef 5 117,868,779 - 117,947,505 (-) NCBI HuRef CHM1_1 5 122,113,195 - 122,191,912 (-) NCBI CHM1_1 T2T-CHM13v2.0 5 123,861,091 - 123,940,041 (-) NCBI T2T-CHM13v2.0
Cep120 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 49,326,266 - 49,388,380 (-) NCBI GRCr8 mRatBN7.2 18 47,127,979 - 47,189,964 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 47,127,981 - 47,189,964 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 49,187,874 - 49,249,626 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 49,888,749 - 49,950,492 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 47,693,830 - 47,755,574 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 48,658,495 - 48,720,570 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 48,658,495 - 48,720,472 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 47,868,772 - 47,930,749 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 49,192,432 - 49,255,022 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 18 45,306,661 - 45,368,619 (-) NCBI Celera Cytogenetic Map 18 q11 NCBI
Cep120 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955521 1,454,102 - 1,504,763 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955521 1,452,514 - 1,504,763 (-) NCBI ChiLan1.0 ChiLan1.0
CEP120 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 118,631,708 - 118,710,732 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 116,785,371 - 116,864,399 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 118,736,158 - 118,815,194 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 124,514,996 - 124,593,259 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 124,514,996 - 124,593,259 (-) Ensembl panpan1.1 panPan2
CEP120 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 13,184,590 - 13,306,975 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 13,143,672 - 13,266,151 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 11,965,568 - 12,088,044 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 13,891,065 - 14,012,128 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 13,894,248 - 14,011,305 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 12,630,097 - 12,753,720 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 12,450,899 - 12,600,321 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 13,080,812 - 13,202,287 (-) NCBI UU_Cfam_GSD_1.0
Cep120 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 135,614,220 - 135,689,343 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936575 3,695,377 - 3,770,687 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936575 3,695,473 - 3,770,522 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CEP120 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 126,840,266 - 126,930,483 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 126,840,262 - 126,930,117 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 132,182,338 - 132,269,849 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CEP120 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 23 26,392,940 - 26,469,818 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 23 26,392,941 - 26,469,717 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666034 51,653,525 - 51,730,359 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cep120
.
Predicted Target Of
Count of predictions: 540 Count of miRNA genes: 383 Interacting mature miRNAs: 434 Transcripts: ENSMUST00000049811 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1302163 Bmd16_m bone mineral density 16 (mouse) Not determined 18 29667914 63668060 Mouse 1302099 Hdlq30_m HDL QTL 30 (mouse) Not determined 18 51668300 85668468 Mouse 11252137 Modvl5_m modifier of vacuolated lens 5 (mouse) 18 51052156 85052311 Mouse 11532716 Sluc41c_m susceptibility to lung cancer 41c (mouse) 18 22619914 56620127 Mouse 11532715 Sluc41b_m susceptibility to lung cancer 41b (mouse) 18 22619914 56620127 Mouse 10412184 Sstapa1_m Suseptibility to Staphylococus aureus infection 1 (mouse) Not determined 18 46541546 57590708 Mouse 11532710 Sluc41a_m susceptibility to lung cancer 41a (mouse) 18 22619914 56620127 Mouse 25823171 Hrsq10_m host response to SARS QTL 10, D4% weight (mouse) 18 27241115 58827077 Mouse 11532709 Sluc41_m susceptibility to lung cancer 41 (mouse) 18 20953694 57590708 Mouse 10412244 Par5_m pulmonary adenoma resistance 5 (mouse) Not determined 18 51668300 85668468 Mouse 1301400 Lmr13_m leishmaniasis resistance 13 (mouse) Not determined 18 28109380 62109518 Mouse 25823174 Hrsq11_m host response to SARS QTL 11, log titer (mouse) 18 27241115 58827077 Mouse 1301215 Thcr_m T helper cell response (mouse) Not determined 18 45130604 68778777 Mouse 1301853 Heal9_m wound healing/regeneration 9 (mouse) Not determined 18 52805276 86805416 Mouse 25823173 Hrsq12_m host response to SARS QTL 12, hemorrhage (mouse) 18 24895881 78339555 Mouse 1301570 Sluc14_m susceptibility to lung cancer 14 (mouse) Not determined 18 22619914 56620127 Mouse 1357639 Obsty4_m obesity 4 (mouse) Not determined 18 39619914 84638778 Mouse 4142443 Pgis1_m proteoglycan induced spondylitis 1 (mouse) Not determined 18 53291022 76914293 Mouse 1558849 W3q15_m weight 3 weeks QTL 15 (mouse) Not determined 18 5041119 61272643 Mouse 12880412 V125Dq12_m vitamin D active form serum level QTL 12 (mouse) 18 30233067 64233067 Mouse 1301771 Pcyts6_m plasmacytoma susceptibility 6 (mouse) Not determined 18 35658632 69658851 Mouse 1301902 Hrtfm4_m heart failure modifier 4 (mouse) Not determined 18 43311120 77311343 Mouse 1300877 Adip8_m adiposity 8 (mouse) Not determined 18 22619914 56620127 Mouse 4141857 Mhysq5_m male hybrid sterility QTL 5 (mouse) Not determined 28130604 62130739 Mouse 1300685 Scc5_m colon tumor susceptibility 5 (mouse) Not determined 18 31988480 65988629 Mouse 4142366 Chlq10_m circulating hormone level QTL 10 (mouse) Not determined 18 36291022 70291180 Mouse 12050070 Nabq2_m nasal bone morphology QTL 2 (mouse) 18 39103677 73103793 Mouse 1357630 Tgq1_m triglyceride QTL 1 (mouse) Not determined 18 51052156 85052311 Mouse 12904745 Carcdq2_m cardiac collagen deposition QTL 2 (mouse) 18 46423287 80423287 Mouse 11039493 Ltpr8d_m Leishmania tropica response 8d (mouse) 18 46874903 80875042 Mouse 1357690 Vtbt19_m vertebral trabecular bone trait 19 (mouse) Not determined 18 33091043 67091221 Mouse 11039494 Ltpr8b_m Leishmania tropica response 8b (mouse) 18 46874903 80875042 Mouse 4142031 Moen1_m modifier of engrailed QTL 1 (mouse) Not determined 18 24115560 58115730 Mouse 15039381 Ltgq8_m liver triglyceride QTL 8 (mouse) 18 38206569 72206569 Mouse 1302050 Radpf4_m radiation pulmonary fibrosis 4 (mouse) Not determined 18 52966156 68778777 Mouse 12904950 Smmq3_m soleus muscle mass QTL 3 (mouse) 18 26056875 60056875 Mouse 15039383 Mvlq5_m microvesicular liver lesion QTL 5 (mouse) 18 38206569 72206569 Mouse 25823167 Hrsq5_m host response to SARS QTL 5, D3% weight (mouse) 18 27241115 58827077 Mouse 1357603 Mom3_m modifier of Min 3 (mouse) Not determined 18 14030023 67098962 Mouse 13463476 Hctq8_m hematocrit QTL 8 (mouse) 18 21217580 55217727 Mouse 27226723 Tibw9_m tibia width 9, proximal, 16 week (mouse) 18 3200000 60933072 Mouse 15039384 Liviq1_m liver inflammation QTL 1 (mouse) 18 38206569 72206569 Mouse 15039386 Mvlq4_m macrovesicular liver lesion QTL 4 (mouse) 18 38206569 72206569 Mouse 27226720 Tibw5_m tibia width 5, proximal, 10 week (mouse) 18 50433067 62633071 Mouse
AU016693
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 18 53,681,897 - 53,682,023 UniSTS GRCm38 MGSCv37 18 53,841,551 - 53,841,677 UniSTS GRCm37 Celera 18 54,986,197 - 54,986,323 UniSTS Cytogenetic Map 18 D1 UniSTS Whitehead/MRC_RH 18 736.04 UniSTS
RH137085
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 18 53,681,787 - 53,682,010 UniSTS GRCm38 MGSCv37 18 53,841,441 - 53,841,664 UniSTS GRCm37 Celera 18 54,986,087 - 54,986,310 UniSTS Cytogenetic Map 18 D1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000049811 ⟹ ENSMUSP00000062433
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 18 53,814,795 - 53,877,619 (-) Ensembl GRCm38.p6 Ensembl 18 53,681,723 - 53,744,547 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000235928
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 18 53,876,999 - 53,877,612 (-) Ensembl GRCm38.p6 Ensembl 18 53,743,927 - 53,744,540 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000237062 ⟹ ENSMUSP00000158481
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 18 53,818,567 - 53,877,680 (-) Ensembl GRCm38.p6 Ensembl 18 53,685,495 - 53,744,608 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000237145
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 18 53,841,674 - 53,877,635 (-) Ensembl GRCm38.p6 Ensembl 18 53,708,602 - 53,744,563 (-) Ensembl
RefSeq Acc Id:
NM_178686 ⟹ NP_848801
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 18 53,814,795 - 53,877,680 (-) NCBI GRCm38 18 53,681,723 - 53,744,608 (-) NCBI MGSCv37 18 53,841,377 - 53,904,201 (-) RGD Celera 18 54,986,023 - 55,048,783 (-) RGD cM Map 18 ENTREZGENE
Sequence:
GTCCTCCAGCCTCCCCCGGGCTCTCGGCCTGCGGGCCTGGTTGCTAGGCGGAAGCGGGGCGCGGCGGCGTCCGCTGCGGCTGCCCGGGCGTTTGAATAGCGGCTTAGCAGGCGGCAAAAAGACCCTGC
hide sequence
RefSeq Acc Id:
XM_011246906 ⟹ XP_011245208
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 18 53,814,795 - 53,877,825 (-) NCBI GRCm38 18 53,681,723 - 53,745,636 (-) NCBI
Sequence:
CCTTTCCGCTTGCGACCAGCAGGCGGCGCTGCGGGCTAATGCAGCCGCGTCTCCCCGGGGCTCT
hide sequence
RefSeq Acc Id:
XM_036161118 ⟹ XP_036017011
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 18 53,814,795 - 53,877,825 (-) NCBI
Sequence:
CCTTTCCGCTTGCGACCAGCAGGCGGCGCTGCGGGCTAATGCAGCCGCGTCTCCCCGGGGCTCTTGGAAAGAGCGTCAAAGGGCGGGAGGTGAAGGCGGCTGATGGACGTTCTATCCCCGACCGCCCT
hide sequence
RefSeq Acc Id:
NP_848801 ⟸ NM_178686
- UniProtKB:
Q8CAF2 (UniProtKB/Swiss-Prot), Q8C8B6 (UniProtKB/Swiss-Prot), Q8C580 (UniProtKB/Swiss-Prot), Q8BG01 (UniProtKB/Swiss-Prot), Q80ZQ2 (UniProtKB/Swiss-Prot), Q80Y93 (UniProtKB/Swiss-Prot), Q7TSG1 (UniProtKB/Swiss-Prot)
- Sequence:
MVPKSDQLLIVVSILEGRHFPKRPKHLLVVEAKFDGEQLATDPVDHTDQPEFATELAWEIDRKVLHQHRLQRTPIKLQCFALDPQTSAKETVGYIVLDLRTAQETKQAPKWYQLLSNKYTKFKAEVQI
hide sequence
RefSeq Acc Id:
XP_011245208 ⟸ XM_011246906
- Peptide Label:
isoform X2
- Sequence:
MVPKSDQLLIVVSILEGRHFPKRPKHLLVVEAKFDGEQLATDPVDHTDQPEFATELAWEIDRKVLHQHRLQRTPIKLQCFALDPQTSAKETVGYIVLDLRTAQETKQAPKWYQLLSNKYTKFKAEVQI
hide sequence
Ensembl Acc Id:
ENSMUSP00000158481 ⟸ ENSMUST00000237062
Ensembl Acc Id:
ENSMUSP00000062433 ⟸ ENSMUST00000049811
RefSeq Acc Id:
XP_036017011 ⟸ XM_036161118
- Peptide Label:
isoform X1
RGD ID: 13677812 Promoter ID: EPDNEW_M23056 Type: initiation region Name: Cep120_1 Description: Mus musculus centrosomal protein 120 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 18 53,744,553 - 53,744,613 EPDNEW
RGD ID: 6829149 Promoter ID: MM_KWN:25302 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: ENSMUST00000049811, UC008EXZ.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 18 53,904,131 - 53,904,937 (-) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-08-21
Cep120
centrosomal protein 120
AU016693
expressed sequence AU016693
Symbol and/or name change
5135510 APPROVED
2024-08-21
AU016693
expressed sequence AU016693
Cep120
centrosomal protein 120
Symbol and/or name change
5135510 APPROVED
