Advanced Search (OLGA)

Gene: 4933402J07Rik (RIKEN cDNA 4933402J07 gene) Mus musculus

Subscribe to Updates

Analyze

Symbol:

4933402J07Rik

Name:

RIKEN cDNA 4933402J07 gene

RGD ID:

1618778

MGI Page

MGI

Description:

Orthologous to human C16orf78 (chromosome 16 open reading frame 78).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC330820; uncharacterized protein C16orf78 homolog; uncharacterized protein LOC330820

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	88,290,535 - 88,315,825 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	88,290,481 - 88,316,052 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	87,563,907 - 87,589,197 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	87,563,853 - 87,589,424 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	90,087,806 - 90,113,096 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	90,454,012 - 90,479,302 (+)	NCBI		MGSCv36	mm8
Celera	8	91,829,032 - 91,854,280 (+)	NCBI		Celera
Cytogenetic Map	8	C3	NCBI
cM Map	8	42.21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
4933402J07Rik	Mouse	Chromosome 16q12 Duplication Syndrome		ISO	C16orf78 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Chromosome 16q12 duplication syndrome	ClinVar	PMID:25741868

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
4933402J07Rik	Mouse	benzo[a]pyrene	decreases methylation	ISO	C16orf78 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of C16ORF78 promoter	CTD	PMID:27901495
4933402J07Rik	Mouse	bis(2-ethylhexyl) phthalate	decreases expression	ISO	C16orf78 (Homo sapiens)	6480464	Diethylhexyl Phthalate results in decreased expression of C16ORF78 mRNA	CTD	PMID:31163220
4933402J07Rik	Mouse	bisphenol A	decreases expression	ISO	C19h16orf78 (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of C16ORF78 mRNA	CTD	PMID:25181051
4933402J07Rik	Mouse	bisphenol A	increases expression	ISO	C16orf78 (Homo sapiens)	6480464	bisphenol A results in increased expression of C16ORF78 mRNA	CTD	PMID:29275510
4933402J07Rik	Mouse	copper(II) sulfate	decreases expression	ISO	C16orf78 (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of C16ORF78 mRNA	CTD	PMID:19549813

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
4933402J07Rik	Mouse	biological_process	involved_in	ND		2290270		MGI	GO_REF:0000015

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
4933402J07Rik	Mouse	molecular_function	enables	ND		2290270		MGI	GO_REF:0000015

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
4933402J07Rik	Mouse	abnormal locomotor behavior		IEA		5509061		MGI
4933402J07Rik	Mouse	improved glucose tolerance		IEA		5509061		MGI

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:10349636	PMID:11042159	PMID:11076861	PMID:11217851	PMID:12466851	PMID:12477932	PMID:16141072	PMID:16141073	PMID:21677750	PMID:38355793

4933402J07Rik
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	88,290,535 - 88,315,825 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	88,290,481 - 88,316,052 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	87,563,907 - 87,589,197 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	87,563,853 - 87,589,424 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	90,087,806 - 90,113,096 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	90,454,012 - 90,479,302 (+)	NCBI		MGSCv36	mm8
Celera	8	91,829,032 - 91,854,280 (+)	NCBI		Celera
Cytogenetic Map	8	C3	NCBI
cM Map	8	42.21	NCBI

C16orf78
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	49,373,804 - 49,399,431 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	49,373,804 - 49,399,431 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	49,407,715 - 49,433,342 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	47,965,309 - 47,990,822 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	16	33,919,770 - 33,945,283 (+)	NCBI		Celera
Cytogenetic Map	16	q12.1	NCBI
HuRef	16	35,297,431 - 35,322,944 (+)	NCBI		HuRef
CHM1_1	16	50,814,732 - 50,840,245 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	55,171,560 - 55,197,187 (+)	NCBI		T2T-CHM13v2.0

C19h16orf78
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	35,657,645 - 35,683,019 (-)	NCBI		GRCr8
mRatBN7.2	19	19,484,248 - 19,509,632 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	19,483,882 - 19,509,469 (-)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	19	20,483,348 - 20,509,072 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	20,483,361 - 20,508,711 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	31,494,308 - 31,519,661 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	20,816,710 - 20,841,478 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	19	19,364,801 - 19,390,525 (-)	NCBI		Celera
Cytogenetic Map	19	p11	NCBI

CUNH16orf78
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955433	7,603,234 - 7,620,319 (+)	NCBI	ChiLan1.0	ChiLan1.0

C18H16orf78
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	58,828,598 - 58,862,989 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	64,733,929 - 64,767,922 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	29,634,536 - 29,660,125 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	48,522,313 - 48,547,900 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	48,522,313 - 48,547,900 (+)	Ensembl	panpan1.1		panPan2

C2H16orf78
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	65,866,069 - 65,880,700 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	65,859,569 - 65,880,672 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	62,443,308 - 62,457,713 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	66,416,892 - 66,431,320 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	66,412,367 - 66,431,296 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	63,240,320 - 63,254,721 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	64,260,125 - 64,274,753 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	65,148,584 - 65,163,031 (-)	NCBI		UU_Cfam_GSD_1.0

CUNH16orf78
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	56,977,687 - 57,003,218 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936475	2,585,895 - 2,611,173 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

C6H16orf78
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	35,393,669 - 35,409,872 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	35,394,618 - 35,409,614 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

CUNH16orf78
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	35,165,260 - 35,189,510 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	35,165,542 - 35,189,373 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	41,313,770 - 41,338,122 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

CUNH16orf78
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624757	7,147,835 - 7,170,324 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624757	7,147,930 - 7,170,258 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in 4933402J07Rik
2088 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	107
Count of miRNA genes:	99
Interacting mature miRNAs:	104
Transcripts:	ENSMUST00000093342
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10043992	Hbnr11_m	Heligmosomoides bakeri nematode resistance 11 (mouse)			Not determined		8	66326836	100326976	Mouse
1301013	Capsq4_m	capsaicin sensitivity related QTL 4 (mouse)			Not determined		8	36630154	93455280	Mouse
12904012	Cfq10_m	conditioned fear QTL 10 (mouse)					8	80793404	89740987	Mouse
11353828	Gf7_m	gonadal fat pad weight 7 (mouse)					8	58928107	92928107	Mouse
1357470	Obq16_m	obesity QTL 16 (mouse)			Not determined		8	76411976	110412125	Mouse
1558875	Eae31_m	experimental allergic encephalomyelitis susceptibility 31 (mouse)			Not determined		8	35109930	115563747	Mouse
1357787	Vtbt5_m	vertebral trabecular bone trait 5 (mouse)			Not determined		8	66084397	100084549	Mouse
1301506	Aevm1_m	autoimmune extremity vasculitis in MRL mice 1 (mouse)			Not determined		8	54740461	88740637	Mouse
1301952	Im3_m	immunoregulatory 3 (mouse)			Not determined		8	55159258	89159407	Mouse
1301767	Fcsa2_m	femoral cross-sectional area 2 (mouse)			Not determined		8	71032003	105032123	Mouse
10412234	Nhdlq14_m	non-HDL QTL 14 (mouse)			Not determined		8	76411976	110412125	Mouse
1301766	Desp1_m	despair 1 (mouse)			Not determined		8	85486208	119486373	Mouse
1301253	Skmw2_m	skeletal muscle weight 2 (mouse)			Not determined		8	86443553	120443701	Mouse
4140967	Bmd39_m	bone mineral density 39 (mouse)			Not determined		8	32506572	117965439	Mouse
1357708	Orq1_m	ovulation rate QTL 1 (mouse)			Not determined		8	71740461	124622354	Mouse
4141285	Tgq18_m	triglyceride QTL 18 (mouse)			Not determined			64186736	98186736	Mouse
4141797	Skmw16_m	skeletal muscle weight 16 (mouse)			Not determined		8	64666176	98666325	Mouse
10755519	Wbc1_m	white blood cell count 1 (mouse)					8	82345783	116345783	Mouse
27226754	Femd6_m	femur midshaft diameter 6, 10 week (mouse)					8	37867154	110326632	Mouse
10043975	Obq31_m	obesity QTL 31 (mouse)			Not determined		8	59136404	93136404	Mouse
1301581	Char2_m	P. chabaudi malaria resistance QTL 2 (mouse)			Not determined		8	79808806	113809031	Mouse
10412287	Carg3_m	Candida albicans resistance gene 3 (mouse)			Not determined		8	56298872	90298872	Mouse
1301874	Hdlq16_m	HDL QTL 16 (mouse)			Not determined		8	76411976	110412125	Mouse
1301872	Cd4ts3_m	CD4 T cell subset 3 (mouse)			Not determined		8	72122809	106123021	Mouse
10045619	Heal14_m	wound healing/regeneration 14 (mouse)			Not determined		8	86443553	120443701	Mouse
1301688	Orch6_m	autoimmune orchitis resistance 6 (mouse)			Not determined		8	61513479	95513605	Mouse
1558780	Idd22_m	insulin dependent diabetes susceptibility 22 (mouse)			Not determined		8	71829531	105829637	Mouse
1300920	Pitm3_m	prion incubation time 3 (mouse)			Not determined		8	73929123	107929226	Mouse
12904744	Carcdq1_m	cardiac collagen deposition QTL 1 (mouse)					8	40162297	95416226	Mouse
4141395	Char2a_m	P. chabaudi malaria resistance QTL 2a (mouse)			Not determined			71589427	90929226	Mouse
10755530	Wbc2_m	white blood cell count 2 (mouse)					8	81819296	115819296	Mouse
1302049	Heal1_m	wound healing/regeneration 1 (mouse)			Not determined		8	86443553	120443701	Mouse
4142283	Imraq2_m	immune response to AAV2 QTL 2 (mouse)			Not determined		8	71032003	105032123	Mouse
27095912	Pglq14_m	pelvic girdle length QTL 14, 16 week (mouse)					8	74126628	126826739	Mouse
4142023	W3q5_m	weight 3 weeks QTL 5 (mouse)			Not determined			71740461	124622354	Mouse
1301099	Cbm2_m	cerebellum weight 2 (mouse)			Not determined		8	79245241	113245331	Mouse
1558890	Lith18_m	lithogenic gene 18 (mouse)			Not determined		8	76402145	110402251	Mouse

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_177901	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC171684	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK077084	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK132946	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC117078	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC120779	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466525	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000093342 ⟹ ENSMUSP00000091033

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	8	88,290,481 - 88,316,052 (+)	Ensembl
GRCm38.p6 Ensembl	8	87,563,853 - 87,589,424 (+)	Ensembl

RefSeq Acc Id:

NM_177901 ⟹ NP_808569

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	8	88,290,535 - 88,315,825 (+)	NCBI
GRCm38	8	87,563,907 - 87,589,197 (+)	ENTREZGENE
MGSCv37	8	90,087,806 - 90,113,096 (+)	RGD
Celera	8	91,829,032 - 91,854,280 (+)	RGD
cM Map	8		ENTREZGENE

Sequence:

show sequence

GTCACTACATCCAGAGGCCACATCCTGCCTCTGACTCCCACACCAGCCAATCCAGGATCCAGAGAGAAGAGTGACAGACTCTGTTGTAGGGCACAGCTGAGATAGCAACATGACAGAAGTGGTAGAAG
ACACCGAGAATCTGATGCCCACTGAGAGGAAGTCCTTCTGGAGGTCAGCTGAGGAGAGGCGAATGTCTGACCTGACCCGGGTGCTGGAGTGGCTGGAGCGGAGGCAGGGCAAGAAGCGCGCCCTTCAG
AAAAAGAAGGAAGAGACAAAGAGTACAGAAGAGAAGGCAGGAAAGAAAAACGTAGGCGCTAAGAAGAAGCTAGAAAAAGTCAGCCGCAAAGTGACCTTCCACAAGGGCTACGTACGTCCTGTCAAGAA
GAAGGAACCCACCATTTACCACAAGAGAAATGAAATAGACCTAAAGAGCAAGCGTCTGAGCATGATCACTGCCAACTTCAGGGATAGCAATAAGAAGTCTGGTCAGTCTGGATCCAGAAGAACATCGG
AGAGCACAGACATAGACATCAAGGATGTTATAGCCCTAGAAACCAACAGTCGGGTAAGCGCTTTCCGAAGACAAAGCTCTGTAGATCCTGGAATTCAGGAAGGTATGTTTGGCAGCCGGAGGGCAGGC
ATCCTGAGAGAATGGGCAAACAAGGCTCCCGACAACAACTATGAACGCAAGCTGAAGAGCCTTATGGAGAAGGGCATGGATCCCAAGATGGAGATCAGCAAGATGCTGAAGCCAGAGGAGGTGCTGAG
CTGCCGATACCTGCGTTTGTCCAAGAACAACATCAAGACCTTGATCAAGCTGTGCAAGGATGCAGGGATGGATGTGGACATCCACCCCCACATGGTGGAGGCCGAGATAGACGCAAAGAAGATCTTCG
GACAGCGATTAAGCGTAGCACTCTAGCCGCTCTGCCCACTGGAGACTCATCCCTTGGCGACTAAGCACCCTGTTAACTAGCTTCTGTAGACCGCACCAGGCGAATAAGTCAAATGCATCACACTAGC

hide sequence


Protein RefSeqs	NP_808569	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI17079	(Get FASTA)	NCBI Sequence Viewer
	AAI20780	(Get FASTA)	NCBI Sequence Viewer
	BAC36603	(Get FASTA)	NCBI Sequence Viewer
	BAE21437	(Get FASTA)	NCBI Sequence Viewer
	EDL11041	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000091033
	ENSMUSP00000091033.6

RefSeq Acc Id:

NP_808569 ⟸ NM_177901

- UniProtKB:

Q8BHX0 (UniProtKB/TrEMBL), Q3V0R6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTEVVEDTENLMPTERKSFWRSAEERRMSDLTRVLEWLERRQGKKRALQKKKEETKSTEEKAGKKNVGAKKKLEKVSRKVTFHKGYVRPVKKKEPTIYHKRNEIDLKSKRLSMITANFRDSNKKSGQS
GSRRTSESTDIDIKDVIALETNSRVSAFRRQSSVDPGIQEGMFGSRRAGILREWANKAPDNNYERKLKSLMEKGMDPKMEISKMLKPEEVLSCRYLRLSKNNIKTLIKLCKDAGMDVDIHPHMVEAEI
DAKKIFGQRLSVAL

hide sequence

Ensembl Acc Id:

ENSMUSP00000091033 ⟸ ENSMUST00000093342

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8BHX0-F1-model_v2	AlphaFold	Q8BHX0	1-270	view protein structure

RGD ID:

8667797

Promoter ID:

EPDNEW_M11930

Type:

initiation region

Name:

4933402J07Rik_1

Description:

Mus musculus RIKEN cDNA 4933402J07 gene , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	8	87,563,894 - 87,563,954	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000069971	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSMUST00000093342	ENTREZGENE
	ENSMUST00000093342.6	UniProtKB/TrEMBL
InterPro	DUF4638	UniProtKB/TrEMBL
KEGG Report	mmu:330820	UniProtKB/TrEMBL
MGD	MGI:3607717	ENTREZGENE
NCBI Gene	330820	ENTREZGENE
PANTHER	PTHR35679	UniProtKB/TrEMBL
	RIKEN CDNA 4933402J07 GENE	UniProtKB/TrEMBL
Pfam	DUF4638	UniProtKB/TrEMBL
PhenoGen	4933402J07Rik	PhenoGen
UniProt	Q3V0R6	ENTREZGENE, UniProtKB/TrEMBL
	Q8BHX0	ENTREZGENE, UniProtKB/TrEMBL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Mammalian Phenotype