Symbol:
Tmx4
Name:
thioredoxin-related transmembrane protein 4
RGD ID:
1617582
MGI Page
MGI
Description:
Predicted to enable disulfide oxidoreductase activity. Located in nuclear inner membrane. Is expressed in future spinal cord. Orthologous to human TMX4 (thioredoxin related transmembrane protein 4).
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
2810417D04Rik; 4930500L08Rik; AI843224; AW046784; D2Bwg1356e; mKIAA1162; thioredoxin domain containing 13; thioredoxin domain-containing protein 13; Txndc1; Txndc13
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TMX4 (thioredoxin related transmembrane protein 4) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Tmx4 (thioredoxin-related transmembrane protein 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tmx4 (thioredoxin related transmembrane protein 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TMX4 (thioredoxin related transmembrane protein 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TMX4 (thioredoxin related transmembrane protein 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tmx4 (thioredoxin related transmembrane protein 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TMX4 (thioredoxin related transmembrane protein 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TMX4 (thioredoxin related transmembrane protein 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tmx4 (thioredoxin related transmembrane protein 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Tmx4 (thioredoxin-related transmembrane protein 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
TMX4 (thioredoxin related transmembrane protein 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tmx4 (thioredoxin-related transmembrane protein 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|ZFIN)
Caenorhabditis elegans (roundworm):
dpy-11
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
CG5554
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
tmx4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 134,436,421 - 134,486,041 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 134,436,105 - 134,486,065 (-) Ensembl GRCm39 Ensembl GRCm38 2 134,594,501 - 134,644,121 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 134,594,185 - 134,644,145 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 134,420,237 - 134,469,857 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 134,285,918 - 134,335,920 (-) NCBI MGSCv36 mm8 Celera 2 135,808,848 - 135,858,344 (-) NCBI Celera Cytogenetic Map 2 F2- F3 NCBI cM Map 2 65.66 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tmx4 Mouse (-)-epigallocatechin 3-gallate multiple interactions ISO TMX4 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of TMX4 mRNA CTD PMID:22079256 Tmx4 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TMX4 mRNA CTD PMID:36331819 Tmx4 Mouse 1,2-dimethylhydrazine multiple interactions ISO Tmx4 (Rattus norvegicus) 6480464 [APC protein affects the susceptibility to 1 and 2-Dimethylhydrazine] which results in decreased expression of TMX4 mRNA CTD PMID:27840820 Tmx4 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of TMX4 mRNA CTD PMID:22206623 Tmx4 Mouse 17beta-estradiol increases expression ISO Tmx4 (Rattus norvegicus) 6480464 Estradiol results in increased expression of TMX4 mRNA CTD PMID:32145629 Tmx4 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO TMX4 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of TMX4 mRNA CTD PMID:21632981 Tmx4 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of TMX4 mRNA CTD PMID:21570461 Tmx4 Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression EXP 6480464 2 more ... CTD PMID:38648751 Tmx4 Mouse 2,4-dinitrotoluene affects expression ISO Tmx4 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of TMX4 mRNA CTD PMID:21346803 Tmx4 Mouse 6-propyl-2-thiouracil decreases expression ISO Tmx4 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of TMX4 mRNA CTD PMID:24780913 Tmx4 Mouse 8-Br-cAMP increases expression ISO TMX4 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of TMX4 mRNA CTD PMID:20147733 Tmx4 Mouse aflatoxin B1 decreases methylation ISO TMX4 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of TMX4 gene CTD PMID:27153756 Tmx4 Mouse all-trans-retinoic acid increases expression ISO TMX4 (Homo sapiens) 6480464 Tretinoin results in increased expression of TMX4 mRNA CTD PMID:23724009 Tmx4 Mouse all-trans-retinoic acid decreases expression ISO TMX4 (Homo sapiens) 6480464 Tretinoin results in decreased expression of TMX4 mRNA CTD PMID:33167477 Tmx4 Mouse amphetamine increases expression ISO Tmx4 (Rattus norvegicus) 6480464 Amphetamine results in increased expression of TMX4 mRNA CTD PMID:30779732 Tmx4 Mouse arsane multiple interactions ISO TMX4 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of TMX4 mRNA CTD PMID:39836092 Tmx4 Mouse arsenic atom multiple interactions ISO TMX4 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of TMX4 mRNA CTD PMID:39836092 Tmx4 Mouse arsenite(3-) increases methylation ISO TMX4 (Homo sapiens) 6480464 arsenite results in increased methylation of TMX4 promoter CTD PMID:23974009 Tmx4 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of TMX4 mRNA CTD PMID:22228805 Tmx4 Mouse benzo[a]pyrene increases methylation ISO TMX4 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of TMX4 3' UTR CTD PMID:27901495 Tmx4 Mouse benzo[a]pyrene diol epoxide I increases expression ISO TMX4 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Tmx4 Mouse bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of TMX4 mRNA CTD PMID:33754040 Tmx4 Mouse bisphenol A affects expression ISO Tmx4 (Rattus norvegicus) 6480464 bisphenol A affects the expression of TMX4 mRNA CTD PMID:25181051 Tmx4 Mouse bisphenol A decreases expression ISO Tmx4 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of TMX4 mRNA CTD PMID:30816183 Tmx4 Mouse bisphenol A increases methylation ISO Tmx4 (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of TMX4 gene CTD PMID:28505145 Tmx4 Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of TMX4 mRNA CTD PMID:38685157 Tmx4 Mouse Brodifacoum increases expression ISO Tmx4 (Rattus norvegicus) 6480464 bromfenacoum results in increased expression of TMX4 protein CTD PMID:28903499 Tmx4 Mouse butanal decreases expression ISO TMX4 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of TMX4 mRNA CTD PMID:26079696 Tmx4 Mouse cadmium atom decreases expression ISO TMX4 (Homo sapiens) 6480464 Cadmium results in decreased expression of TMX4 mRNA CTD PMID:16439709 Tmx4 Mouse cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of TMX4 mRNA CTD PMID:20883709 Tmx4 Mouse cadmium dichloride decreases expression ISO TMX4 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of TMX4 mRNA CTD PMID:38568856 Tmx4 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes and Carbon results in increased expression of TMX4 mRNA CTD PMID:25620056 Tmx4 Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of TMX4 gene CTD PMID:20938992 Tmx4 Mouse chromium(6+) affects expression ISO TMX4 (Homo sapiens) 6480464 chromium hexavalent ion affects the expression of TMX4 mRNA CTD PMID:30690063 Tmx4 Mouse cisplatin affects response to substance ISO TMX4 (Homo sapiens) 6480464 TMX4 protein affects the susceptibility to Cisplatin CTD PMID:16217747 Tmx4 Mouse cisplatin increases expression ISO TMX4 (Homo sapiens) 6480464 Cisplatin results in increased expression of TMX4 mRNA CTD PMID:27594783 Tmx4 Mouse cisplatin increases expression ISO Tmx4 (Rattus norvegicus) 6480464 Cisplatin results in increased expression of TMX4 mRNA CTD PMID:22023808 Tmx4 Mouse cobalt dichloride decreases expression ISO TMX4 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of TMX4 mRNA CTD PMID:19376846 Tmx4 Mouse coumestrol multiple interactions ISO TMX4 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of TMX4 mRNA CTD PMID:19167446 Tmx4 Mouse Dibutyl phosphate affects expression ISO TMX4 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of TMX4 mRNA CTD PMID:37042841 Tmx4 Mouse doxorubicin decreases expression ISO TMX4 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of TMX4 mRNA CTD PMID:29803840 Tmx4 Mouse ethanol multiple interactions EXP 6480464 Ethanol affects the expression of and affects the splicing of TMX4 mRNA CTD PMID:30319688 Tmx4 Mouse folic acid multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of TMX4 gene CTD PMID:20938992 Tmx4 Mouse formaldehyde decreases expression ISO TMX4 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of TMX4 mRNA CTD PMID:23649840 Tmx4 Mouse FR900359 increases phosphorylation ISO TMX4 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of TMX4 protein CTD PMID:37730182 Tmx4 Mouse isoflavones affects expression ISO TMX4 (Homo sapiens) 6480464 Isoflavones affects the expression of TMX4 mRNA CTD PMID:16365062 Tmx4 Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of TMX4 gene CTD PMID:20938992 Tmx4 Mouse lithium atom increases expression ISO Tmx4 (Rattus norvegicus) 6480464 Lithium results in increased expression of TMX4 protein CTD PMID:18296634 Tmx4 Mouse lithium hydride increases expression ISO Tmx4 (Rattus norvegicus) 6480464 Lithium results in increased expression of TMX4 protein CTD PMID:18296634 Tmx4 Mouse N-methyl-4-phenylpyridinium increases expression ISO Tmx4 (Rattus norvegicus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of TMX4 mRNA CTD PMID:28801915 Tmx4 Mouse nickel sulfate decreases expression ISO TMX4 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of TMX4 mRNA CTD PMID:22714537 Tmx4 Mouse paracetamol increases expression ISO TMX4 (Homo sapiens) 6480464 Acetaminophen results in increased expression of TMX4 mRNA CTD PMID:25704631 Tmx4 Mouse paracetamol increases expression ISO Tmx4 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of TMX4 mRNA CTD PMID:33387578 Tmx4 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TMX4 mRNA CTD PMID:36331819 Tmx4 Mouse potassium chromate increases expression ISO TMX4 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of TMX4 mRNA CTD PMID:22079256 Tmx4 Mouse potassium chromate decreases expression ISO TMX4 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of TMX4 mRNA CTD PMID:22714537 Tmx4 Mouse potassium chromate multiple interactions ISO TMX4 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of TMX4 mRNA CTD PMID:22079256 Tmx4 Mouse resveratrol multiple interactions ISO TMX4 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of TMX4 mRNA CTD PMID:19167446 Tmx4 Mouse sodium arsenite decreases expression ISO TMX4 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TMX4 mRNA CTD PMID:22714537 and PMID:38568856 Tmx4 Mouse sodium arsenite multiple interactions ISO TMX4 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of TMX4 mRNA CTD PMID:39836092 Tmx4 Mouse sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of TMX4 mRNA CTD PMID:20883709 Tmx4 Mouse sodium fluoride increases expression EXP 6480464 Sodium Fluoride results in increased expression of TMX4 protein CTD PMID:28918527 Tmx4 Mouse tert-butyl hydroperoxide decreases expression ISO TMX4 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of TMX4 mRNA CTD PMID:15336504 Tmx4 Mouse thioacetamide increases expression ISO Tmx4 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of TMX4 mRNA CTD PMID:34492290 Tmx4 Mouse thiram decreases expression ISO TMX4 (Homo sapiens) 6480464 Thiram results in decreased expression of TMX4 mRNA CTD PMID:38568856 Tmx4 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of TMX4 gene CTD PMID:35295148 Tmx4 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of TMX4 promoter CTD PMID:35295148 Tmx4 Mouse triphenyl phosphate affects expression ISO TMX4 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TMX4 mRNA CTD PMID:37042841 Tmx4 Mouse trovafloxacin increases expression ISO Tmx4 (Rattus norvegicus) 6480464 trovafloxacin results in increased expression of TMX4 mRNA CTD PMID:24136188 Tmx4 Mouse urethane increases expression ISO TMX4 (Homo sapiens) 6480464 Urethane results in increased expression of TMX4 mRNA CTD PMID:28818685 Tmx4 Mouse valproic acid increases expression ISO TMX4 (Homo sapiens) 6480464 Valproic Acid results in increased expression of TMX4 mRNA CTD PMID:23179753 Tmx4 Mouse valproic acid affects expression ISO TMX4 (Homo sapiens) 6480464 Valproic Acid affects the expression of TMX4 mRNA CTD PMID:25979313 Tmx4 Mouse vinclozolin increases expression ISO Tmx4 (Rattus norvegicus) 6480464 vinclozolin results in increased expression of TMX4 mRNA CTD PMID:23034163 Tmx4 Mouse vincristine decreases expression ISO TMX4 (Homo sapiens) 6480464 Vincristine results in decreased expression of TMX4 mRNA CTD PMID:23649840
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (EXP) 1,2-dimethylhydrazine (EXP,ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2,4-dinitrotoluene (ISO) 6-propyl-2-thiouracil (ISO) 8-Br-cAMP (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amphetamine (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (ISO) bisphenol F (EXP) Brodifacoum (ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) carbon nanotube (EXP) choline (EXP) chromium(6+) (ISO) cisplatin (ISO) cobalt dichloride (ISO) coumestrol (ISO) Dibutyl phosphate (ISO) doxorubicin (ISO) ethanol (EXP) folic acid (EXP) formaldehyde (ISO) FR900359 (ISO) isoflavones (ISO) L-methionine (EXP) lithium atom (ISO) lithium hydride (ISO) N-methyl-4-phenylpyridinium (ISO) nickel sulfate (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (EXP) potassium chromate (ISO) resveratrol (ISO) sodium arsenite (EXP,ISO) sodium fluoride (EXP) tert-butyl hydroperoxide (ISO) thioacetamide (ISO) thiram (ISO) titanium dioxide (EXP) triphenyl phosphate (ISO) trovafloxacin (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (ISO) vincristine (ISO)
Tmx4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 134,436,421 - 134,486,041 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 134,436,105 - 134,486,065 (-) Ensembl GRCm39 Ensembl GRCm38 2 134,594,501 - 134,644,121 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 134,594,185 - 134,644,145 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 134,420,237 - 134,469,857 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 134,285,918 - 134,335,920 (-) NCBI MGSCv36 mm8 Celera 2 135,808,848 - 135,858,344 (-) NCBI Celera Cytogenetic Map 2 F2- F3 NCBI cM Map 2 65.66 NCBI
TMX4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 7,977,346 - 8,019,761 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 7,977,346 - 8,019,805 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 7,957,993 - 8,000,408 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 7,909,713 - 7,948,393 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 20 8,031,292 - 8,069,972 (-) NCBI Celera Cytogenetic Map 20 p12.3 NCBI HuRef 20 7,912,700 - 7,952,149 (-) NCBI HuRef CHM1_1 20 7,962,185 - 8,001,207 (-) NCBI CHM1_1 T2T-CHM13v2.0 20 8,019,162 - 8,061,561 (-) NCBI T2T-CHM13v2.0
Tmx4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 142,309,026 - 142,352,415 (-) NCBI GRCr8 mRatBN7.2 3 121,856,237 - 121,899,680 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 121,856,261 - 121,899,641 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 125,758,834 - 125,802,376 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 134,373,134 - 134,411,794 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 132,015,012 - 132,058,556 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 127,528,427 - 127,569,093 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 127,528,434 - 127,569,093 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 134,016,672 - 134,057,338 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 122,591,543 - 122,634,935 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 122,500,029 - 122,540,483 (-) NCBI Celera 3 120,614,340 - 120,655,909 (-) NCBI Celera Cytogenetic Map 3 q36 NCBI
Tmx4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955415 18,054,323 - 18,101,446 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955415 18,055,257 - 18,100,705 (-) NCBI ChiLan1.0 ChiLan1.0
TMX4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 8,876,827 - 8,919,210 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 8,873,654 - 8,916,037 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 7,951,311 - 7,993,682 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 7,731,940 - 7,774,238 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 7,735,655 - 7,773,982 (-) Ensembl panpan1.1 panPan2
TMX4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 14,113,495 - 14,176,081 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 14,132,455 - 14,207,428 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 13,947,552 - 13,998,253 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 14,525,102 - 14,577,624 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 14,525,097 - 14,577,886 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 14,134,798 - 14,186,640 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 14,243,706 - 14,295,641 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 14,574,193 - 14,625,057 (+) NCBI UU_Cfam_GSD_1.0
Tmx4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 162,944,398 - 162,985,647 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936485 11,375,706 - 11,412,741 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936485 11,375,768 - 11,415,951 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TMX4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 16,831,932 - 16,881,350 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 16,834,869 - 16,881,328 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 18,900,336 - 18,934,256 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TMX4
Tmx4
.
Predicted Target Of
Count of predictions: 2248 Count of miRNA genes: 809 Interacting mature miRNAs: 1096 Transcripts: ENSMUST00000038228, ENSMUST00000110119, ENSMUST00000110120, ENSMUST00000137377 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1301905 Lgth2_m body length 2 (mouse) Not determined 2 111173704 145173821 Mouse 1302033 Nsv1_m Neuroadapted Sindbis viral RNA level 1 (mouse) Not determined 2 111623386 145623526 Mouse 13824983 Vclq1_m curvilinear velocity QTL 1 (mouse) 2 61830344 136841920 Mouse 13506763 Tbvq1_m trabecular bone volume QTL 1 (mouse) 2 126041920 135441920 Mouse 11039520 Ltpr2h_m Leishmania tropica response 2h (mouse) 2 112212746 146213005 Mouse 11039521 Ltpr2g_m Leishmania tropica response 2g (mouse) 2 115212857 149212994 Mouse 12910799 Pwgrq2_m pre-weaning growth rate QTL 2 (mouse) 2 118589253 160611165 Mouse 1302174 Dssc2_m dextran sodium sulfate induced colitis QTL2 (mouse) Not determined 2 24224632 148700377 Mouse 12910795 Pwbwq5_m post-weaning body weight QTL 5 (mouse) 2 118589253 160611165 Mouse 27226761 Feml18_m femur length 18, 16 week (mouse) 2 94230345 154241920 Mouse 12910812 Pwgrq1_m pre-weaning growth rate QTL 1 (mouse) 2 118589253 160611165 Mouse 12910814 Pwbwq1_m pre-weaning body weight QTL 1 (mouse) 2 118589253 160611165 Mouse 4141854 T2dm2sa_m type 2 diabetes mellitus 2 in SMXA RI mice (mouse) Not determined 2 29307947 148374934 Mouse 1302071 Fembrs1_m femur breaking strength 1 (mouse) Not determined 2 100942930 134943090 Mouse 10045885 Cplaq15_m circadian period of locomotor activity 15 (mouse) Not determined 2 110916118 154354667 Mouse 1302203 Gvhd3_m graft-versus host disease 3 (mouse) Not determined 2 100942930 134943090 Mouse 1300793 Pcfm2_m periosteal circumference and femur length 2 (mouse) Not determined 2 111173704 145173821 Mouse 10412082 Hylaq1_m Hyperlocomotor activity related QTL 1 (mouse) Not determined 2 84013198 148667470 Mouse 1301822 Pgia2_m proteoglycan induced arthritis 2 (mouse) Not determined 2 123937311 157937424 Mouse 5491197 Mobq5_m multigenic obesity QTL 5 (mouse) Not determined 2 65269746 162518926 Mouse 5491196 Mobq6_m multigenic obesity QTL 6 (mouse) Not determined 2 85724269 180896594 Mouse 1301031 Bdln3_m body length 3 (mouse) Not determined 2 127664019 161664118 Mouse 27226788 Feml13_m femur length 13, 10 week (mouse) 2 102630345 159941920 Mouse 1301295 Prdt1_m prion disease incubation time 1 (mouse) Not determined 2 116077623 150077741 Mouse 1301294 Hrtfm5_m heart failure modifier 5 (mouse) Not determined 2 122883015 156883131 Mouse 11038696 Ltpr2f_m Leishmania tropica response 2f (mouse) 2 115212857 149212994 Mouse 1301330 Tbbmd2_m total body bone mineral density 2 (mouse) Not determined 2 100942930 134943090 Mouse 1301201 Chab1_m cholesterol absorption 1 (mouse) Not determined 2 111551028 145551163 Mouse 11038699 Ltpr2b_m Leishmania tropica response 2b (mouse) 2 112212746 146213005 Mouse 11038700 Ltpr2a_m Leishmania tropica response 2a (mouse) 2 112212746 146213005 Mouse 11038702 Ltpr2_m Leishmania tropica response 2 (mouse) 2 103095716 167212356 Mouse 1301087 Bbaa15_m B.burgdorferi-associated arthritis 15 (mouse) Not determined 2 110489658 144489807 Mouse 1301825 Pbrgcsf1_m peripheral blood stem cell response to granulocyte colony stimulating factor 1 (mouse) Not determined 2 106233580 140233729 Mouse 4141802 Ignpq1_m IgA nephropathy QTL 1 (mouse) Not determined 2 100824060 134824269 Mouse 1558990 Skmw9_m skeletal muscle weight 9 (mouse) Not determined 2 111173704 145173821 Mouse 1301066 Otx2m2_m orthodenticle homolog 2 (Drosophila) modifier 2 (mouse) Not determined 2 123231973 148700377 Mouse 1301961 Bts1_m bladder tumor susceptibility 1 (mouse) Not determined 2 132024159 166024330 Mouse 4141155 Plast2b_m plasma plant sterol 2b (mouse) Not determined 2 84013198 148522175 Mouse 1301618 Bglu1_m blood glucose level 1 (mouse) Not determined 2 117942930 174324863 Mouse 27226749 Femd10_m femur midshaft diameter 10, 16 week (mouse) 2 124441920 168241920 Mouse 1301755 Hrq1_m heart rate quantitative locus 1 (mouse) Not determined 2 111173704 145173821 Mouse 13207586 Mwmlpt2_m Morris water maze latency to platform, training, 2 (mouse) 2 131616184 139216184 Mouse 1302143 Bwq5_m body weight (mouse) Not determined 2 127664019 161664118 Mouse 12880427 V25Dq3_m vitamin D inactive form serum level QTL 3 (mouse) 2 129341920 163341920 Mouse 13207590 Mwmlpa2_m Morris water maze latency to platform, all, 2 (mouse) 2 131616184 139616184 Mouse 1301344 Lith1_m lithogenic gene 1 (mouse) Not determined 2 45347635 145312647 Mouse 1558881 Ses7_m salmonella enteritidis susceptibility 7 (mouse) Not determined 2 116306330 150306474 Mouse 11049566 Lmr28e_m leishmaniasis resistance 28e (mouse) 2 133144911 167145058 Mouse 11049567 Lmr28f_m leishmaniasis resistance 28f (mouse) 2 133144911 167145058 Mouse 10043875 Bw25_m body weight QTL 25 (mouse) Not determined 2 107255676 141255676 Mouse 1300712 El2_m epilepsy 2 (mouse) Not determined 2 122207146 142532135 Mouse
AW046784
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 2 134,597,410 - 134,597,557 UniSTS GRCm38 MGSCv37 2 134,423,146 - 134,423,293 UniSTS GRCm37 Celera 2 135,811,759 - 135,811,906 UniSTS Cytogenetic Map 2 G1 UniSTS cM Map 2 77.0 UniSTS Whitehead/MRC_RH 2 1629.3 UniSTS
AI843224
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 2 134,594,522 - 134,594,648 UniSTS GRCm38 MGSCv37 2 134,420,258 - 134,420,384 UniSTS GRCm37 Celera 2 135,808,869 - 135,808,995 UniSTS Cytogenetic Map 2 G1 UniSTS cM Map 2 77.0 UniSTS Whitehead/MRC_RH 2 1651.12 UniSTS
MDB1356
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 2 134,597,519 - 134,597,678 UniSTS GRCm38 MGSCv37 2 134,423,255 - 134,423,414 UniSTS GRCm37 Celera 2 135,811,868 - 135,812,027 UniSTS Cytogenetic Map 2 G1 UniSTS cM Map 2 77.0 UniSTS Whitehead_YAC 2 UniSTS
RH125048
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 2 134,597,387 - 134,597,673 UniSTS GRCm38 MGSCv37 2 134,423,123 - 134,423,409 UniSTS GRCm37 Celera 2 135,811,736 - 135,812,022 UniSTS Cytogenetic Map 2 G1 UniSTS cM Map 2 77.0 UniSTS
D2Bwg1356e
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 2 134,597,414 - 134,597,630 UniSTS GRCm38 MGSCv37 2 134,423,150 - 134,423,366 UniSTS GRCm37 Celera 2 135,811,763 - 135,811,979 UniSTS Cytogenetic Map 2 G1 UniSTS cM Map 2 77.0 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000038228 ⟹ ENSMUSP00000045154
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 134,436,105 - 134,486,065 (-) Ensembl GRCm38.p6 Ensembl 2 134,594,185 - 134,644,145 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000110119 ⟹ ENSMUSP00000105746
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 134,481,411 - 134,486,010 (-) Ensembl GRCm38.p6 Ensembl 2 134,639,491 - 134,644,090 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000110120 ⟹ ENSMUSP00000105747
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 134,449,386 - 134,485,961 (-) Ensembl GRCm38.p6 Ensembl 2 134,607,466 - 134,644,041 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000137377
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 134,440,923 - 134,486,052 (-) Ensembl GRCm38.p6 Ensembl 2 134,599,003 - 134,644,132 (-) Ensembl
RefSeq Acc Id:
NM_029148 ⟹ NP_083424
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 134,436,421 - 134,486,041 (-) NCBI GRCm38 2 134,594,501 - 134,644,121 (-) ENTREZGENE MGSCv37 2 134,420,237 - 134,469,857 (-) RGD Celera 2 135,808,848 - 135,858,344 (-) RGD cM Map 2 ENTREZGENE
Sequence:
CGGCGCAGAGGCGGGTTGGCCTCTCCTCAGACCTCTGTGAAGGCGGTTGCTTGGGGTGAGAAGCCCAGCCACTGCTCCCCGCCCTCAGAGAGCTGAGCTACCTCACAGGCGCCACCATGACAGGCGGC
hide sequence
RefSeq Acc Id:
NP_083424 ⟸ NM_029148
- Peptide Label:
precursor
- UniProtKB:
Q6ZPW7 (UniProtKB/Swiss-Prot), Q3UHC6 (UniProtKB/Swiss-Prot), Q80X49 (UniProtKB/Swiss-Prot), Q8C0L0 (UniProtKB/Swiss-Prot), Q0P5W2 (UniProtKB/TrEMBL)
- Sequence:
MTGGFCVPVLLAAWLAAAAAEGLEQAALPAEESRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQTDSEWETFAKNGETLQISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFRRYRGPGIYEDLQ
hide sequence
Ensembl Acc Id:
ENSMUSP00000105746 ⟸ ENSMUST00000110119
Ensembl Acc Id:
ENSMUSP00000105747 ⟸ ENSMUST00000110120
Ensembl Acc Id:
ENSMUSP00000045154 ⟸ ENSMUST00000038228
RGD ID: 6833029 Promoter ID: MM_KWN:31889 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: ENSMUST00000110119, OTTMUST00000036670, OTTMUST00000036671, UC008MNU.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 2 134,469,514 - 134,470,014 (-) MPROMDB
RGD ID: 6878880 Promoter ID: EPDNEW_M2891 Type: initiation region Name: Tmx4_1 Description: Mus musculus thioredoxin-related transmembrane protein 4 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 2 134,644,134 - 134,644,194 EPDNEW
