Symbol:
Hells
Name:
helicase, lymphoid specific
RGD ID:
1616865
MGI Page
MGI
Description:
Enables chromatin binding activity. Involved in kidney development; lymphocyte proliferation; and negative regulation of gene expression, epigenetic. Acts upstream of or within several processes, including cellular response to leukemia inhibitory factor; chromosomal DNA methylation maintenance following DNA replication; and negative regulation of intrinsic apoptotic signaling pathway. Located in nucleus and pericentric heterochromatin. Is expressed in several structures, including gut; hippocampus; neural retina; reproductive system; and thymus. Human ortholog(s) of this gene implicated in immunodeficiency-centromeric instability-facial anomalies syndrome 4. Orthologous to human HELLS (helicase, lymphoid specific).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AI323785; E130115I21Rik; L; LSH; Ly; lymphocyte-specific helicase; Lysh; P; PASG; proliferation-associated SNF2-like protein; YFK8
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
HELLS (helicase, lymphoid specific) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Hells (helicase, lymphoid specific) RGD
RGD
Chinchilla lanigera (long-tailed chinchilla):
Hells (helicase, lymphoid specific) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
HELLS (helicase, lymphoid specific) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
HELLS (helicase, lymphoid specific) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Hells (helicase, lymphoid specific) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
HELLS (helicase, lymphoid specific) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
HELLS (helicase, lymphoid specific) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Hells (helicase, lymphoid specific) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Hells (helicase, lymphoid specific)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
HELLS (helicase, lymphoid specific)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
hells (helicase, lymphoid specific)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
IRC5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
hells
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 38,913,282 - 38,958,914 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 38,919,359 - 38,959,495 (+) Ensembl GRCm39 Ensembl GRCm38 19 38,930,262 - 38,970,470 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 38,930,915 - 38,971,051 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 39,005,480 - 39,042,767 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 38,996,134 - 39,033,421 (+) NCBI MGSCv36 mm8 Celera 19 39,732,380 - 39,769,659 (+) NCBI Celera Cytogenetic Map 19 C3 NCBI cM Map 19 33.57 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hells Mouse (-)-demecolcine decreases expression ISO HELLS (Homo sapiens) 6480464 Demecolcine results in decreased expression of HELLS mRNA CTD PMID:23649840 Hells Mouse (S)-nicotine multiple interactions EXP 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Hells Mouse 1,2-dichloroethane decreases expression EXP 6480464 ethylene dichloride results in decreased expression of HELLS mRNA CTD PMID:28960355 Hells Mouse 1,4-dioxane increases expression EXP 6480464 1 and 4-dioxane results in increased expression of HELLS protein CTD PMID:20025956 Hells Mouse 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions EXP 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Hells Mouse 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine increases expression EXP 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Hells Mouse 1-naphthyl isothiocyanate decreases expression ISO Hells (Rattus norvegicus) 6480464 1-Naphthylisothiocyanate results in decreased expression of HELLS mRNA CTD PMID:25380136 Hells Mouse 14-Deoxy-11,12-didehydroandrographolide decreases expression ISO HELLS (Homo sapiens) 6480464 14-deoxy-11 and 12-didehydroandrographolide results in decreased expression of HELLS mRNA CTD PMID:22101062 Hells Mouse 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of HELLS mRNA CTD PMID:17942748 Hells Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HELLS mRNA CTD PMID:17942748 Hells Mouse 17beta-estradiol multiple interactions EXP 6480464 ESR1 protein promotes the reaction [Estradiol results in increased expression of HELLS mRNA] CTD PMID:25210133 Hells Mouse 17beta-estradiol increases expression ISO HELLS (Homo sapiens) 6480464 Estradiol results in increased expression of HELLS mRNA CTD PMID:19167446 Hells Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of HELLS mRNA CTD PMID:25210133 Hells Mouse 2,2',5,5'-tetrachlorobiphenyl increases expression ISO Hells (Rattus norvegicus) 6480464 2 more ... CTD PMID:23829299 Hells Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Hells (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of HELLS mRNA CTD PMID:21215274 and PMID:33387578 Hells Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of HELLS mRNA CTD PMID:26377647 Hells Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of HELLS mRNA CTD PMID:17942748 Hells Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO HELLS (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of HELLS mRNA CTD PMID:20106945 Hells Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HELLS mRNA CTD PMID:17942748 Hells Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression EXP 6480464 2 more ... CTD PMID:38648751 Hells Mouse 2,6-di-tert-butyl-4-methylphenol increases expression EXP 6480464 Butylated Hydroxytoluene results in increased expression of HELLS mRNA CTD PMID:19000923 Hells Mouse 4,4'-diaminodiphenylmethane decreases expression ISO Hells (Rattus norvegicus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of HELLS mRNA CTD PMID:25380136 Hells Mouse 4-hydroxynon-2-enal decreases expression EXP 6480464 4-hydroxy-2-nonenal results in decreased expression of HELLS mRNA CTD PMID:19191707 Hells Mouse 6-propyl-2-thiouracil increases expression ISO Hells (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of HELLS mRNA CTD PMID:24780913 and PMID:30047161 Hells Mouse 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:20025956 Hells Mouse acrolein multiple interactions ISO HELLS (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of HELLS mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of HELLS mRNA CTD PMID:32699268 Hells Mouse acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of HELLS protein CTD PMID:20025956 Hells Mouse acrylamide increases expression ISO Hells (Rattus norvegicus) 6480464 Acrylamide results in increased expression of HELLS mRNA CTD PMID:28959563 Hells Mouse aflatoxin B1 affects expression ISO HELLS (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of HELLS protein CTD PMID:20106945 Hells Mouse aflatoxin B1 decreases methylation ISO HELLS (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of HELLS intron CTD PMID:30157460 Hells Mouse aflatoxin B1 increases expression ISO HELLS (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of HELLS mRNA CTD PMID:22100608 Hells Mouse aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of HELLS mRNA CTD PMID:19770486 Hells Mouse aflatoxin M1 decreases expression ISO HELLS (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of HELLS mRNA CTD PMID:30928695 Hells Mouse all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of HELLS protein CTD PMID:20025956 Hells Mouse all-trans-retinoic acid decreases expression ISO HELLS (Homo sapiens) 6480464 Tretinoin results in decreased expression of HELLS mRNA CTD PMID:33167477 Hells Mouse alpha-pinene multiple interactions ISO HELLS (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of HELLS mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of HELLS mRNA CTD PMID:32699268 Hells Mouse amitrole increases expression ISO Hells (Rattus norvegicus) 6480464 Amitrole results in increased expression of HELLS mRNA CTD PMID:30047161 Hells Mouse anthracene-1,8,9-triol increases expression EXP 6480464 Anthralin results in increased expression of HELLS protein CTD PMID:20025956 Hells Mouse arsane multiple interactions ISO HELLS (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HELLS mRNA CTD PMID:39836092 Hells Mouse arsenic atom multiple interactions ISO HELLS (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HELLS mRNA CTD PMID:39836092 Hells Mouse atrazine decreases expression ISO Hells (Rattus norvegicus) 6480464 Atrazine results in decreased expression of HELLS mRNA CTD PMID:36841081 Hells Mouse azathioprine decreases expression ISO HELLS (Homo sapiens) 6480464 Azathioprine results in decreased expression of HELLS mRNA CTD PMID:22623647 Hells Mouse bazedoxifene decreases expression ISO HELLS (Homo sapiens) 6480464 bazedoxifene results in decreased expression of HELLS mRNA CTD PMID:19914376 Hells Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of HELLS mRNA CTD PMID:20504355 Hells Mouse benzo[a]pyrene increases expression ISO HELLS (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of HELLS mRNA CTD PMID:32234424 Hells Mouse benzo[a]pyrene diol epoxide I decreases expression ISO HELLS (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 and PMID:20382639 Hells Mouse bisphenol A decreases expression ISO Hells (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of HELLS mRNA CTD PMID:25181051 and PMID:30816183 Hells Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of HELLS mRNA CTD PMID:35598803 Hells Mouse bisphenol A decreases expression ISO HELLS (Homo sapiens) 6480464 bisphenol A analog results in decreased expression of HELLS mRNA more ... CTD PMID:29275510 more ... Hells Mouse bisphenol A affects expression ISO HELLS (Homo sapiens) 6480464 bisphenol A affects the expression of HELLS mRNA CTD PMID:30903817 Hells Mouse butylated hydroxyanisole increases expression EXP 6480464 Butylated Hydroxyanisole results in increased expression of HELLS mRNA CTD PMID:19000923 Hells Mouse cadmium dichloride increases methylation ISO Hells (Rattus norvegicus) 6480464 Cadmium Chloride results in increased methylation of HELLS promoter CTD PMID:22457795 Hells Mouse cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of HELLS mRNA CTD PMID:24982889 Hells Mouse caffeine multiple interactions EXP 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Hells Mouse caffeine increases phosphorylation ISO HELLS (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of HELLS protein CTD PMID:35688186 Hells Mouse caffeine increases expression EXP 6480464 Caffeine results in increased expression of HELLS protein CTD PMID:20025956 Hells Mouse calcitriol decreases expression ISO HELLS (Homo sapiens) 6480464 Calcitriol results in decreased expression of HELLS mRNA CTD PMID:21592394 Hells Mouse calcitriol multiple interactions ISO HELLS (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of HELLS mRNA CTD PMID:21592394 Hells Mouse carbon nanotube increases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 Hells Mouse cefaloridine increases expression ISO Hells (Rattus norvegicus) 6480464 Cephaloridine results in increased expression of HELLS mRNA CTD PMID:18500788 Hells Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of HELLS mRNA CTD PMID:20350560 and PMID:37019170 Hells Mouse cholic acid increases expression EXP 6480464 Cholic Acid results in increased expression of HELLS protein CTD PMID:20025956 Hells Mouse chromium(6+) affects expression EXP 6480464 chromium hexavalent ion affects the expression of HELLS mRNA CTD PMID:28472532 Hells Mouse cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of HELLS mRNA CTD PMID:21151649 Hells Mouse cisplatin increases expression ISO HELLS (Homo sapiens) 6480464 Cisplatin results in increased expression of HELLS mRNA CTD PMID:27594783 Hells Mouse clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of HELLS protein CTD PMID:20025956 Hells Mouse copper atom multiple interactions ISO HELLS (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of HELLS mRNA CTD PMID:20971185 Hells Mouse copper(0) multiple interactions ISO HELLS (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of HELLS mRNA CTD PMID:20971185 Hells Mouse coumarin increases phosphorylation ISO HELLS (Homo sapiens) 6480464 coumarin results in increased phosphorylation of HELLS protein CTD PMID:35688186 Hells Mouse coumestrol multiple interactions ISO HELLS (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Hells Mouse coumestrol increases expression ISO HELLS (Homo sapiens) 6480464 Coumestrol results in increased expression of HELLS mRNA CTD PMID:19167446 Hells Mouse cyclosporin A decreases expression ISO HELLS (Homo sapiens) 6480464 Cyclosporine results in decreased expression of HELLS mRNA CTD PMID:20106945 more ... Hells Mouse DDE increases expression ISO HELLS (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of HELLS mRNA CTD PMID:38568856 Hells Mouse deguelin increases expression ISO HELLS (Homo sapiens) 6480464 deguelin results in increased expression of HELLS mRNA CTD PMID:33512557 Hells Mouse dexamethasone multiple interactions ISO HELLS (Homo sapiens) 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone] results in decreased expression of HELLS mRNA CTD PMID:26424790 Hells Mouse Dibutyl phosphate affects expression ISO HELLS (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of HELLS mRNA CTD PMID:37042841 Hells Mouse dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of HELLS mRNA CTD PMID:17361019 and PMID:21266533 Hells Mouse dicrotophos decreases expression ISO HELLS (Homo sapiens) 6480464 dicrotophos results in decreased expression of HELLS mRNA CTD PMID:28302478 Hells Mouse diethylstilbestrol decreases expression ISO HELLS (Homo sapiens) 6480464 Diethylstilbestrol results in decreased expression of HELLS mRNA CTD PMID:36621641 Hells Mouse dioxygen decreases expression ISO HELLS (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of HELLS mRNA CTD PMID:26516004 Hells Mouse dioxygen multiple interactions ISO Hells (Rattus norvegicus) 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of HELLS mRNA CTD PMID:33729688 Hells Mouse Enterolactone multiple interactions ISO HELLS (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of HELLS mRNA CTD PMID:19167446 Hells Mouse flurbiprofen increases expression EXP 6480464 Flurbiprofen results in increased expression of HELLS mRNA CTD PMID:16949054 Hells Mouse formaldehyde increases expression ISO HELLS (Homo sapiens) 6480464 Formaldehyde results in increased expression of HELLS mRNA CTD PMID:23649840 Hells Mouse FR900359 decreases phosphorylation ISO HELLS (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of HELLS protein CTD PMID:37730182 Hells Mouse gentamycin decreases expression ISO Hells (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of HELLS mRNA CTD PMID:33387578 Hells Mouse glafenine decreases expression ISO Hells (Rattus norvegicus) 6480464 Glafenine results in decreased expression of HELLS mRNA CTD PMID:24136188 Hells Mouse glycerol 2-phosphate multiple interactions ISO HELLS (Homo sapiens) 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone] results in decreased expression of HELLS mRNA CTD PMID:26424790 Hells Mouse indole-3-methanol affects expression ISO Hells (Rattus norvegicus) 6480464 indole-3-carbinol affects the expression of HELLS mRNA CTD PMID:21396975 Hells Mouse irinotecan decreases expression ISO HELLS (Homo sapiens) 6480464 Irinotecan analog results in decreased expression of HELLS mRNA CTD PMID:18927307 Hells Mouse iron dichloride increases expression EXP 6480464 ferrous chloride results in increased expression of HELLS protein CTD PMID:20025956 Hells Mouse iron trichloride increases expression EXP 6480464 ferric chloride results in increased expression of HELLS protein CTD PMID:20025956 Hells Mouse ivermectin decreases expression ISO HELLS (Homo sapiens) 6480464 Ivermectin results in decreased expression of HELLS protein CTD PMID:32959892 Hells Mouse L-ascorbic acid multiple interactions ISO HELLS (Homo sapiens) 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone] results in decreased expression of HELLS mRNA CTD PMID:26424790 Hells Mouse Lasiocarpine increases expression ISO HELLS (Homo sapiens) 6480464 lasiocarpine results in increased expression of HELLS mRNA CTD PMID:32234424 Hells Mouse manganese atom multiple interactions ISO HELLS (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HELLS mRNA CTD PMID:39836092 Hells Mouse manganese(0) multiple interactions ISO HELLS (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HELLS mRNA CTD PMID:39836092 Hells Mouse manganese(II) chloride multiple interactions ISO HELLS (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HELLS mRNA CTD PMID:39836092 Hells Mouse methimazole increases expression ISO Hells (Rattus norvegicus) 6480464 Methimazole results in increased expression of HELLS mRNA CTD PMID:30047161 Hells Mouse methyl methanesulfonate increases expression ISO HELLS (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of HELLS mRNA CTD PMID:23649840 Hells Mouse methylmercury chloride decreases expression ISO HELLS (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of HELLS mRNA CTD PMID:28001369 Hells Mouse Mezerein increases expression EXP 6480464 mezerein results in increased expression of HELLS mRNA CTD PMID:19000923 Hells Mouse N-nitrosodimethylamine decreases expression ISO Hells (Rattus norvegicus) 6480464 Dimethylnitrosamine results in decreased expression of HELLS mRNA CTD PMID:25380136 Hells Mouse nickel atom increases expression ISO HELLS (Homo sapiens) 6480464 Nickel results in increased expression of HELLS mRNA CTD PMID:25583101 Hells Mouse nicotine multiple interactions EXP 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Hells Mouse oxaliplatin multiple interactions ISO Hells (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of HELLS mRNA CTD PMID:25729387 Hells Mouse oxaliplatin decreases expression ISO Hells (Rattus norvegicus) 6480464 oxaliplatin results in decreased expression of HELLS mRNA CTD PMID:25729387 Hells Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of HELLS mRNA more ... CTD PMID:19555225 more ... Hells Mouse ozone multiple interactions ISO HELLS (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of HELLS mRNA more ... CTD PMID:32699268 Hells Mouse ozone increases expression EXP 6480464 Ozone results in increased expression of HELLS mRNA CTD PMID:31626304 Hells Mouse palytoxin increases expression EXP 6480464 palytoxin results in increased expression of HELLS protein CTD PMID:20025956 Hells Mouse paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of HELLS protein CTD PMID:20025956 Hells Mouse paracetamol increases expression ISO HELLS (Homo sapiens) 6480464 Acetaminophen results in increased expression of HELLS mRNA CTD PMID:22230336 Hells Mouse pentachlorophenol increases expression EXP 6480464 Pentachlorophenol results in increased expression of HELLS mRNA CTD PMID:23892564 Hells Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of HELLS mRNA CTD PMID:36331819 Hells Mouse perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of HELLS protein CTD PMID:20025956 Hells Mouse perfluorooctanoic acid decreases expression ISO HELLS (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of HELLS protein CTD PMID:26879310 Hells Mouse phenethyl isothiocyanate decreases expression ISO HELLS (Homo sapiens) 6480464 phenethyl isothiocyanate results in decreased expression of HELLS mRNA CTD PMID:26678675 Hells Mouse phenobarbital multiple interactions EXP 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of HELLS mRNA] CTD PMID:19482888 Hells Mouse phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of HELLS mRNA CTD PMID:19482888 more ... Hells Mouse phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of HELLS mRNA CTD PMID:19136022 Hells Mouse phorbol 13-acetate 12-myristate increases expression EXP 6480464 Tetradecanoylphorbol Acetate results in increased expression of HELLS mRNA CTD PMID:19000923 Hells Mouse picoxystrobin increases expression ISO HELLS (Homo sapiens) 6480464 picoxystrobin results in increased expression of HELLS mRNA CTD PMID:33512557 Hells Mouse pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of HELLS mRNA CTD PMID:19136022 Hells Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of HELLS mRNA CTD PMID:20813756 Hells Mouse pirinixic acid multiple interactions EXP 6480464 [pirinixic acid co-treated with PPARA] results in increased expression of HELLS mRNA CTD PMID:20813756 Hells Mouse pirinixic acid multiple interactions ISO HELLS (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of HELLS mRNA CTD PMID:19710929 Hells Mouse progesterone decreases expression ISO HELLS (Homo sapiens) 6480464 Progesterone results in decreased expression of HELLS mRNA CTD PMID:21795739 Hells Mouse progesterone decreases expression EXP 6480464 Progesterone results in decreased expression of HELLS mRNA CTD PMID:16966611 and PMID:22238285 Hells Mouse quercetin affects expression ISO HELLS (Homo sapiens) 6480464 Quercetin affects the expression of HELLS mRNA CTD PMID:21632981 Hells Mouse resveratrol decreases expression ISO HELLS (Homo sapiens) 6480464 resveratrol results in decreased expression of HELLS mRNA CTD PMID:15767336 Hells Mouse resveratrol decreases expression ISO Hells (Rattus norvegicus) 6480464 resveratrol results in decreased expression of HELLS mRNA CTD PMID:25905778 Hells Mouse resveratrol multiple interactions ISO HELLS (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of HELLS mRNA CTD PMID:19167446 Hells Mouse saccharin increases expression EXP 6480464 Saccharin results in increased expression of HELLS mRNA CTD PMID:19000923 Hells Mouse SB 431542 multiple interactions ISO HELLS (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of HELLS protein CTD PMID:37664457 Hells Mouse silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of HELLS mRNA CTD PMID:29341224 Hells Mouse sodium arsenite increases expression ISO HELLS (Homo sapiens) 6480464 sodium arsenite results in increased expression of HELLS mRNA CTD PMID:29301061 Hells Mouse sodium arsenite multiple interactions ISO HELLS (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HELLS mRNA CTD PMID:39836092 Hells Mouse sodium arsenite affects expression ISO HELLS (Homo sapiens) 6480464 sodium arsenite affects the expression of HELLS mRNA CTD PMID:34032870 Hells Mouse sodium arsenite decreases expression ISO HELLS (Homo sapiens) 6480464 sodium arsenite results in decreased expression of HELLS mRNA CTD PMID:38568856 Hells Mouse sodium nitrite increases expression EXP 6480464 Sodium Nitrite results in increased expression of HELLS protein CTD PMID:20025956 Hells Mouse styrene oxide increases expression EXP 6480464 styrene oxide results in increased expression of HELLS protein CTD PMID:20025956 Hells Mouse succimer multiple interactions EXP 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of HELLS mRNA CTD PMID:21641980 Hells Mouse sulfadimethoxine increases expression ISO Hells (Rattus norvegicus) 6480464 Sulfadimethoxine results in increased expression of HELLS mRNA CTD PMID:30047161 Hells Mouse sunitinib decreases expression ISO HELLS (Homo sapiens) 6480464 Sunitinib results in decreased expression of HELLS mRNA CTD PMID:31533062 Hells Mouse testosterone multiple interactions ISO HELLS (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of HELLS mRNA CTD PMID:21592394 Hells Mouse testosterone decreases expression ISO HELLS (Homo sapiens) 6480464 Testosterone results in decreased expression of HELLS mRNA CTD PMID:21592394 Hells Mouse tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of HELLS mRNA CTD PMID:17484886 Hells Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of HELLS mRNA CTD PMID:27339419 and PMID:31919559 Hells Mouse thimerosal increases expression ISO HELLS (Homo sapiens) 6480464 Thimerosal results in increased expression of HELLS mRNA CTD PMID:27188386 Hells Mouse thioacetamide decreases expression ISO Hells (Rattus norvegicus) 6480464 Thioacetamide results in decreased expression of HELLS mRNA CTD PMID:34492290 Hells Mouse thiram decreases expression ISO HELLS (Homo sapiens) 6480464 Thiram results in decreased expression of HELLS mRNA CTD PMID:38568856 Hells Mouse topotecan multiple interactions ISO Hells (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of HELLS mRNA CTD PMID:25729387 Hells Mouse topotecan decreases expression ISO Hells (Rattus norvegicus) 6480464 Topotecan results in decreased expression of HELLS mRNA CTD PMID:25729387 Hells Mouse tremolite asbestos increases expression EXP 6480464 tremolite results in increased expression of HELLS mRNA CTD PMID:29279043 Hells Mouse trichloroethene increases methylation ISO Hells (Rattus norvegicus) 6480464 Trichloroethylene results in increased methylation of HELLS gene CTD PMID:27618143 Hells Mouse trichloroethene decreases expression ISO Hells (Rattus norvegicus) 6480464 Trichloroethylene results in decreased expression of HELLS mRNA CTD PMID:33387578 Hells Mouse trimellitic anhydride increases expression EXP 6480464 trimellitic anhydride results in increased expression of HELLS mRNA CTD PMID:19042947 Hells Mouse urethane decreases expression ISO HELLS (Homo sapiens) 6480464 Urethane results in decreased expression of HELLS mRNA CTD PMID:28818685 Hells Mouse valproic acid increases expression ISO HELLS (Homo sapiens) 6480464 Valproic Acid results in increased expression of HELLS mRNA CTD PMID:23179753 and PMID:29154799 Hells Mouse valproic acid decreases expression ISO HELLS (Homo sapiens) 6480464 Valproic Acid results in decreased expression of HELLS mRNA CTD PMID:23179753 and PMID:27188386 Hells Mouse valproic acid affects expression ISO HELLS (Homo sapiens) 6480464 Valproic Acid affects the expression of HELLS mRNA CTD PMID:25979313 Hells Mouse vinclozolin increases expression ISO Hells (Rattus norvegicus) 6480464 vinclozolin results in increased expression of HELLS mRNA CTD PMID:23555832 Hells Mouse vincristine decreases expression ISO HELLS (Homo sapiens) 6480464 Vincristine results in decreased expression of HELLS mRNA CTD PMID:23649840 Hells Mouse vorinostat increases expression ISO HELLS (Homo sapiens) 6480464 vorinostat results in increased expression of HELLS mRNA CTD PMID:27188386 Hells Mouse zinc dichloride increases expression EXP 6480464 zinc chloride results in increased expression of HELLS mRNA CTD PMID:19000923
(-)-demecolcine (ISO) (S)-nicotine (EXP) 1,2-dichloroethane (EXP) 1,4-dioxane (EXP) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (EXP) 1-naphthyl isothiocyanate (ISO) 14-Deoxy-11,12-didehydroandrographolide (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2,6-di-tert-butyl-4-methylphenol (EXP) 4,4'-diaminodiphenylmethane (ISO) 4-hydroxynon-2-enal (EXP) 6-propyl-2-thiouracil (ISO) 7,12-dimethyltetraphene (EXP) acrolein (ISO) acrylamide (EXP,ISO) aflatoxin B1 (EXP,ISO) aflatoxin M1 (ISO) all-trans-retinoic acid (EXP,ISO) alpha-pinene (ISO) amitrole (ISO) anthracene-1,8,9-triol (EXP) arsane (ISO) arsenic atom (ISO) atrazine (ISO) azathioprine (ISO) bazedoxifene (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) butylated hydroxyanisole (EXP) cadmium dichloride (EXP,ISO) caffeine (EXP,ISO) calcitriol (ISO) carbon nanotube (EXP) cefaloridine (ISO) chlorpyrifos (EXP) cholic acid (EXP) chromium(6+) (EXP) cisplatin (EXP,ISO) clofibrate (EXP) copper atom (ISO) copper(0) (ISO) coumarin (ISO) coumestrol (ISO) cyclosporin A (ISO) DDE (ISO) deguelin (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) diethylstilbestrol (ISO) dioxygen (ISO) Enterolactone (ISO) flurbiprofen (EXP) formaldehyde (ISO) FR900359 (ISO) gentamycin (ISO) glafenine (ISO) glycerol 2-phosphate (ISO) indole-3-methanol (ISO) irinotecan (ISO) iron dichloride (EXP) iron trichloride (EXP) ivermectin (ISO) L-ascorbic acid (ISO) Lasiocarpine (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methimazole (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) Mezerein (EXP) N-nitrosodimethylamine (ISO) nickel atom (ISO) nicotine (EXP) oxaliplatin (ISO) ozone (EXP,ISO) palytoxin (EXP) paracetamol (EXP,ISO) pentachlorophenol (EXP) perfluorooctane-1-sulfonic acid (EXP) perfluorooctanoic acid (EXP,ISO) phenethyl isothiocyanate (ISO) phenobarbital (EXP) phorbol 13-acetate 12-myristate (EXP) picoxystrobin (ISO) pirinixic acid (EXP,ISO) progesterone (EXP,ISO) quercetin (ISO) resveratrol (ISO) saccharin (EXP) SB 431542 (ISO) silicon dioxide (EXP) sodium arsenite (ISO) sodium nitrite (EXP) styrene oxide (EXP) succimer (EXP) sulfadimethoxine (ISO) sunitinib (ISO) testosterone (ISO) tetrachloromethane (EXP) thimerosal (ISO) thioacetamide (ISO) thiram (ISO) topotecan (ISO) tremolite asbestos (EXP) trichloroethene (ISO) trimellitic anhydride (EXP) urethane (ISO) valproic acid (ISO) vinclozolin (ISO) vincristine (ISO) vorinostat (ISO) zinc dichloride (EXP)
Hells Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 38,913,282 - 38,958,914 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 38,919,359 - 38,959,495 (+) Ensembl GRCm39 Ensembl GRCm38 19 38,930,262 - 38,970,470 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 38,930,915 - 38,971,051 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 39,005,480 - 39,042,767 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 38,996,134 - 39,033,421 (+) NCBI MGSCv36 mm8 Celera 19 39,732,380 - 39,769,659 (+) NCBI Celera Cytogenetic Map 19 C3 NCBI cM Map 19 33.57 NCBI
HELLS Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 94,545,788 - 94,613,905 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 94,545,329 - 94,613,905 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 96,305,545 - 96,361,856 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 96,295,564 - 96,351,846 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 96,295,563 - 96,351,845 NCBI Celera 10 90,045,660 - 90,101,938 (+) NCBI Celera Cytogenetic Map 10 q23.33 NCBI HuRef 10 89,932,081 - 89,988,296 (+) NCBI HuRef CHM1_1 10 96,587,374 - 96,643,612 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 95,424,900 - 95,493,015 (+) NCBI T2T-CHM13v2.0
Hells Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 246,113,580 - 246,159,230 (+) NCBI GRCr8 mRatBN7.2 1 236,701,704 - 236,748,239 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 236,701,758 - 236,746,844 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 245,125,577 - 245,167,789 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 252,018,896 - 252,061,072 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 244,857,143 - 244,899,325 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 257,901,856 - 257,953,889 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 257,614,731 - 257,791,728 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 257,766,691 - 257,949,183 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 265,357,043 - 265,402,172 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 243,246,843 - 243,262,459 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 1 233,793,113 - 233,835,276 (+) NCBI Celera Cytogenetic Map 1 q53 NCBI
Hells Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955507 990,429 - 1,034,852 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955507 995,389 - 1,034,852 (+) NCBI ChiLan1.0 ChiLan1.0
HELLS Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 106,573,712 - 106,642,121 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 106,579,467 - 106,647,438 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 91,282,330 - 91,344,156 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 94,790,137 - 94,847,209 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 94,790,292 - 94,847,209 (+) Ensembl panpan1.1 panPan2
HELLS Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 8,660,866 - 8,705,570 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 8,661,008 - 8,705,580 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 8,837,652 - 8,882,362 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 8,924,517 - 8,969,255 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 8,924,655 - 8,969,265 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 8,640,526 - 8,685,234 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 8,671,482 - 8,716,173 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 8,842,995 - 8,887,709 (+) NCBI UU_Cfam_GSD_1.0
Hells
HELLS Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 105,924,536 - 105,955,430 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 105,923,727 - 105,967,003 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 115,770,403 - 115,812,864 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HELLS Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 87,780,897 - 87,835,087 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 87,796,502 - 87,834,619 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 48,579,766 - 48,645,153 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hells
.
Predicted Target Of
Count of predictions: 1082 Count of miRNA genes: 615 Interacting mature miRNAs: 749 Transcripts: ENSMUST00000025965, ENSMUST00000127968, ENSMUST00000128949, ENSMUST00000138292, ENSMUST00000145051, ENSMUST00000155465 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
13506250 Renmq1_m renal mercury accumulation QTL 1 (mouse) 19 27385594 61385705 Mouse 10412251 Mnp_m modifier of Niemann Pick type C1 (mouse) Not determined 19 20234314 54234461 Mouse 1302170 Tanidd1_m tally ho associated non-insulin dependednt diabetes mellitus 1 (mouse) Not determined 19 36752597 61420004 Mouse 1301466 T2dm2_m type 2 diabetes mellitus 2 (mouse) Not determined 19 38376050 61420004 Mouse 11039522 Tbbr4_m Trypanosoma brucei brucei response 4 (mouse) 19 5313326 39313470 Mouse 1301336 Alcp23_m alcohol preference locus 23 (mouse) Not determined 19 15912607 49912719 Mouse 1558876 W3q14_m weight 3 weeks QTL 14 (mouse) Not determined 19 22313326 53911504 Mouse 1302019 Pgia23_m proteoglycan induced arthritis 23 (mouse) Not determined 19 9787453 43787602 Mouse 1301633 Alcp24_m alcohol preference locus 24 (mouse) Not determined 19 15912607 49912719 Mouse 14928311 Manh85_m mandible shape 85 (mouse) 19 11914789 45914789 Mouse 1301639 Stnn_m striatal neuron number (mouse) Not determined 19 33951952 61420004 Mouse 1301451 Ath16_m atherosclerosis 16 (mouse) Not determined 19 25426917 59427005 Mouse 1300683 Fembm7_m femoral bone morphometry 7 (mouse) Not determined 19 30141224 61420004 Mouse 4141659 Pbwg20_m postnatal body weight growth 20 (mouse) Not determined 19 21378705 55378928 Mouse 4141019 Tgq29_m triglyceride QTL 29 (mouse) Not determined 34596786 61420004 Mouse 1301942 Pas13_m pulmonary adenoma susceptibility 13 (mouse) Not determined 19 30141231 61420004 Mouse 10413881 Moe2_m modifier of epilepsy 2 (mouse) 19 14923016 48923138 Mouse 1302004 Lfp2_m long free running period 2 (mouse) Not determined 19 18295162 52295381 Mouse 12790634 Ebm1_m Epidermolysis Bullosa modifier 1 (mouse) 19 24988439 58988439 Mouse 1300856 Nobq2_m New Zealand obese QTL 2 (mouse) Not determined 19 30897880 61420004 Mouse 4141138 Femwf11_m femur work to failure 11 (mouse) Not determined 28140348 61420004 Mouse 4141650 Chldq9_m cholesterol and HDL QTL 9 (mouse) Not determined 19 37882982 61420004 Mouse 13504736 Ifvrq6_m influenza virus resistance QTL 6 (mouse) 19 36902910 44913949 Mouse 1301410 Cd8mts6_m CD8 memory T cell subset 6 (mouse) Not determined 19 30141231 61420004 Mouse 1301479 Sluc1_m susceptibility to lung cancer 1 (mouse) Not determined 19 36016944 46761521 Mouse 4142343 Moen2_m modifier of engrailed QTL 2 (mouse) Not determined 19 20234314 54234461 Mouse 1302123 Tlsr8_m thymic lymphoma suppressor region 8 (mouse) Not determined 19 25136002 42388916 Mouse 1302063 Eae19_m experimental allergic encephalomyelitis 19 (mouse) Not determined 19 18295162 52295381 Mouse 1301741 Lith2_m lithogenic gene 2 (mouse) Not determined 19 32992158 61420004 Mouse 1301228 Iba4_m induction of brown adipocytes 4 (mouse) Not determined 19 9305715 43305821 Mouse
AI323785
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 10 73,142,414 - 73,142,704 UniSTS GRCm38 GRCm38 19 38,967,873 - 38,968,157 UniSTS GRCm38 MGSCv37 19 39,042,363 - 39,042,647 UniSTS GRCm37 MGSCv37 10 72,605,162 - 72,605,452 UniSTS GRCm37 Celera 19 39,769,255 - 39,769,539 UniSTS Celera 10 74,209,177 - 74,209,467 UniSTS Cytogenetic Map 19 C3-D1 UniSTS Whitehead/MRC_RH 19 370.21 UniSTS
UniSTS:237938
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 19 38,965,568 - 38,965,865 UniSTS GRCm38 MGSCv37 19 39,040,058 - 39,040,355 UniSTS GRCm37 Celera 19 39,766,937 - 39,767,234 UniSTS Cytogenetic Map 19 C3-D1 UniSTS
Hells
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 19 C3-D1 UniSTS cM Map 19 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000025965 ⟹ ENSMUSP00000025965
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 19 38,919,359 - 38,959,495 (+) Ensembl GRCm38.p6 Ensembl 19 38,930,915 - 38,971,051 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000127968
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 19 38,932,133 - 38,938,919 (+) Ensembl GRCm38.p6 Ensembl 19 38,943,689 - 38,950,475 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000128949
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 19 38,922,952 - 38,929,045 (+) Ensembl GRCm38.p6 Ensembl 19 38,934,508 - 38,940,601 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000138292
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 19 38,919,474 - 38,928,944 (+) Ensembl GRCm38.p6 Ensembl 19 38,931,030 - 38,940,500 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000145051 ⟹ ENSMUSP00000116710
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 19 38,919,618 - 38,932,358 (+) Ensembl GRCm38.p6 Ensembl 19 38,931,174 - 38,943,914 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000155465
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 19 38,919,834 - 38,942,053 (+) Ensembl GRCm38.p6 Ensembl 19 38,931,390 - 38,953,609 (+) Ensembl
RefSeq Acc Id:
NM_008234 ⟹ NP_032260
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 19 38,919,434 - 38,956,721 (+) NCBI GRCm38 19 38,930,990 - 38,968,277 (+) NCBI MGSCv37 19 39,005,480 - 39,042,767 (+) RGD Celera 19 39,732,380 - 39,769,659 (+) RGD cM Map 19 ENTREZGENE
Sequence:
TGAGGATTTAGCTCGCGGCGTTTGAGGCGACTGGGTCCCCGGCCGGTGTCCAGCCGTGCCTGCGGAGCCGCCCGCGAGCAGCAGCGGGTCCTTGGCTCCAGAGATGGCCGAACAAACGGAGCCTGCGG
hide sequence
RefSeq Acc Id:
XM_006526699 ⟹ XP_006526762
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 19 38,913,282 - 38,958,914 (+) NCBI GRCm38 19 38,930,262 - 38,970,470 (+) NCBI
Sequence:
CTTCCAATCCAGGAATGAGATGTGTTGTTTTTGTCTTTCCTCGGTCACCGTTTGTACTTTGTGGGAGTTTATGTGACATCTCTACCCTGTTGAGTTGTACAGAACAAGTGCCTCTTCCCCTCCCCTCC
hide sequence
RefSeq Acc Id:
XM_006526700 ⟹ XP_006526763
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 19 38,936,000 - 38,958,914 (+) NCBI GRCm38 19 38,947,555 - 38,970,470 (+) NCBI
Sequence:
TCTTTGTCTTTTTAAGGCGGGGTTTGTACATAGCCCTGACTGTCCTGAATGTGCCACCACTGCCCAGACCTTTTAACTTTTTCTTACATGTAACACGGAAAGTAGCATACATGATGGCTTCAACATGA
hide sequence
RefSeq Acc Id:
NP_032260 ⟸ NM_008234
- UniProtKB:
Q8VDZ1 (UniProtKB/Swiss-Prot), Q497T3 (UniProtKB/Swiss-Prot), Q9CYV7 (UniProtKB/Swiss-Prot), Q60848 (UniProtKB/Swiss-Prot)
- Sequence:
MAEQTEPAVITPAMLEEEEQLEAAGLEKERKMLEEAQKSWDRESTEIRYRRLQHLLEKSNIYSKFLLTKMEQQQLEEQKKKEKLEKKKRSLKLTEGKSLVDGNGEKPVMKKKRGREDESYNISEVMSK
hide sequence
RefSeq Acc Id:
XP_006526762 ⟸ XM_006526699
- Peptide Label:
isoform X1
- UniProtKB:
Q8VDZ1 (UniProtKB/Swiss-Prot), Q497T3 (UniProtKB/Swiss-Prot), Q9CYV7 (UniProtKB/Swiss-Prot), Q60848 (UniProtKB/Swiss-Prot)
- Sequence:
MAEQTEPAVITPAMLEEEEQLEAAGLEKERKMLEEAQKSWDRESTEIRYRRLQHLLEKSNIYSK
hide sequence
RefSeq Acc Id:
XP_006526763 ⟸ XM_006526700
- Peptide Label:
isoform X2
- Sequence:
MKCRLIRELKRFNADNKLLLTGTPLQNNLSELWSLLNFLLPDVFDDLKSFESWFDITSLSETAEDIIAKEREQNVLHMLHQILTPFLLRRLKSDVALEVPPKREVVVYAPLCNKQEIFYTAIVNRTIA
hide sequence
Ensembl Acc Id:
ENSMUSP00000116710 ⟸ ENSMUST00000145051
Ensembl Acc Id:
ENSMUSP00000025965 ⟸ ENSMUST00000025965
RGD ID: 13679416 Promoter ID: EPDNEW_M23857 Type: initiation region Name: Hells_1 Description: Mus musculus helicase, lymphoid specific , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 19 38,930,957 - 38,931,017 EPDNEW
RGD ID: 6830118 Promoter ID: MM_KWN:26991 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Lung, MEF_B4, MEF_B6, Spleen Transcripts: OTTMUST00000050285, OTTMUST00000050287, OTTMUST00000050288, OTTMUST00000050290 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 19 39,005,164 - 39,005,664 (+) MPROMDB
