Symbol:
Usp34
Name:
ubiquitin specific peptidase 34
RGD ID:
1616844
MGI Page
MGI
Description:
Predicted to enable cysteine-type deubiquitinase activity and cysteine-type endopeptidase activity. Predicted to be involved in positive regulation of canonical Wnt signaling pathway; protein K48-linked deubiquitination; and regulation of protein stability. Predicted to be active in cytosol and nucleus. Orthologous to human USP34 (ubiquitin specific peptidase 34).
Type:
protein-coding
RefSeq Status:
INFERRED
Previously known as:
A530081C03Rik; deubiquitinating enzyme 34; Mur; Murr2; U2af1-rs1 region 2; ubiquitin carboxyl-terminal hydrolase 34; ubiquitin specific protease 34; ubiquitin thioesterase 34; ubiquitin thiolesterase 34; ubiquitin-specific-processing protease 34
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
USP34 (ubiquitin specific peptidase 34) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Usp34 (ubiquitin specific peptidase 34) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Usp34 (ubiquitin specific peptidase 34) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
USP34 (ubiquitin specific peptidase 34) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
USP34 (ubiquitin specific peptidase 34) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Usp34 (ubiquitin specific peptidase 34) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
USP34 (ubiquitin specific peptidase 34) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
USP34 (ubiquitin specific peptidase 34) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Usp34 (ubiquitin specific peptidase 34) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
USP34 (ubiquitin specific peptidase 34)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Usp34 (ubiquitin specific peptidase 34)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
usp34 (ubiquitin specific peptidase 34)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
puf
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
usp34
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 23,256,433 - 23,440,560 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 23,256,895 - 23,440,560 (+) Ensembl GRCm39 Ensembl GRCm38 11 23,303,185 - 23,490,560 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 23,306,895 - 23,490,560 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 23,206,895 - 23,390,560 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 23,297,186 - 23,346,963 (+) NCBI MGSCv36 mm8 Celera 11 25,434,085 - 25,618,456 (+) NCBI Celera Cytogenetic Map 11 A3.2 NCBI cM Map 11 14.29 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Usp34 Mouse (-)-demecolcine increases expression ISO RGD:1318847 6480464 Demecolcine results in increased expression of USP34 mRNA CTD PMID:23649840 Usp34 Mouse (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:1318847 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of USP34 mRNA CTD PMID:22079256 Usp34 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1,2-Dimethylhydrazine results in decreased expression of USP34 mRNA CTD PMID:22206623 Usp34 Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of USP34 mRNA CTD PMID:39298647 Usp34 Mouse 2,3',4,4',5-Pentachlorobiphenyl increases expression EXP 6480464 2,3',4,4',5-pentachlorobiphenyl results in increased expression of USP34 mRNA CTD PMID:31388691 Usp34 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of USP34 mRNA CTD PMID:18691609 Usp34 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1565181 6480464 Tetrachlorodibenzodioxin results in increased expression of USP34 mRNA CTD PMID:34747641 Usp34 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of USP34 mRNA CTD PMID:19770486 Usp34 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1565181 6480464 Tetrachlorodibenzodioxin results in decreased expression of USP34 mRNA CTD PMID:21215274 Usp34 Mouse 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO RGD:1565181 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of USP34 mRNA CTD PMID:32109520 Usp34 Mouse 2,4,6-tribromophenol decreases expression ISO RGD:1318847 6480464 2,4,6-tribromophenol results in decreased expression of USP34 mRNA CTD PMID:31675489 Usp34 Mouse 2-hydroxypropanoic acid decreases expression ISO RGD:1318847 6480464 Lactic Acid results in decreased expression of USP34 mRNA CTD PMID:30851411 Usp34 Mouse 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:1318847 6480464 tetrabromobisphenol A results in decreased expression of USP34 protein CTD PMID:31675489 Usp34 Mouse 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of USP34 mRNA CTD PMID:20188158|PMID:26251327 Usp34 Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1318847 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Usp34 Mouse aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of USP34 mRNA CTD PMID:19770486 Usp34 Mouse aflatoxin B1 decreases methylation ISO RGD:1318847 6480464 Aflatoxin B1 results in decreased methylation of USP34 gene CTD PMID:27153756 Usp34 Mouse antirheumatic drug increases expression ISO RGD:1318847 6480464 Antirheumatic Agents results in increased expression of USP34 mRNA CTD PMID:24449571 Usp34 Mouse aristolochic acid A decreases expression ISO RGD:1318847 6480464 aristolochic acid I results in decreased expression of USP34 mRNA CTD PMID:33212167 Usp34 Mouse arsane multiple interactions ISO RGD:1318847 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Usp34 Mouse arsenic atom multiple interactions ISO RGD:1318847 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Usp34 Mouse benzo[a]pyrene decreases expression ISO RGD:1318847 6480464 Benzo(a)pyrene results in decreased expression of USP34 mRNA CTD PMID:20106945|PMID:21632981 Usp34 Mouse benzo[a]pyrene increases expression ISO RGD:1318847 6480464 Benzo(a)pyrene results in increased expression of USP34 mRNA CTD PMID:26238291 Usp34 Mouse benzo[a]pyrene diol epoxide I decreases expression ISO RGD:1318847 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of USP34 mRNA CTD PMID:19150397|PMID:20018196 Usp34 Mouse bisphenol A affects expression ISO RGD:1565181 6480464 bisphenol A affects the expression of USP34 mRNA CTD PMID:25181051 Usp34 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of USP34 mRNA CTD PMID:35598803 Usp34 Mouse bisphenol A decreases expression ISO RGD:1318847 6480464 bisphenol A results in decreased expression of USP34 protein CTD PMID:31675489 Usp34 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of USP34 mRNA CTD PMID:38074096 Usp34 Mouse bisphenol A increases methylation ISO RGD:1565181 6480464 bisphenol A results in increased methylation of USP34 gene CTD PMID:28505145 Usp34 Mouse bisphenol A decreases expression ISO RGD:1565181 6480464 bisphenol A results in decreased expression of USP34 mRNA CTD PMID:30816183 Usp34 Mouse bisphenol F multiple interactions ISO RGD:1318847 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Usp34 Mouse cadmium atom multiple interactions ISO RGD:1318847 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of USP34 more ... CTD PMID:35301059 Usp34 Mouse cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of USP34 mRNA CTD PMID:24982889 Usp34 Mouse cadmium dichloride multiple interactions ISO RGD:1318847 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of USP34 more ... CTD PMID:35301059 Usp34 Mouse caffeine affects phosphorylation ISO RGD:1318847 6480464 Caffeine affects the phosphorylation of USP34 protein CTD PMID:35688186 Usp34 Mouse CGP 52608 multiple interactions ISO RGD:1318847 6480464 CGP 52608 promotes the reaction [RORA protein binds to USP34 gene] CTD PMID:28238834 Usp34 Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of USP34 mRNA CTD PMID:29156651|PMID:37019170 Usp34 Mouse ciguatoxin CTX1B affects expression EXP 6480464 Ciguatoxins affects the expression of USP34 mRNA CTD PMID:18353800 Usp34 Mouse cisplatin decreases expression ISO RGD:1318847 6480464 Cisplatin results in decreased expression of USP34 mRNA CTD PMID:27594783 Usp34 Mouse clobetasol decreases expression EXP 6480464 Clobetasol results in decreased expression of USP34 mRNA CTD PMID:27462272 Usp34 Mouse clozapine increases expression ISO RGD:1318847 6480464 Clozapine results in increased expression of USP34 protein CTD PMID:34122009 Usp34 Mouse coumarin decreases phosphorylation ISO RGD:1318847 6480464 coumarin results in decreased phosphorylation of USP34 protein CTD PMID:35688186 Usp34 Mouse decabromodiphenyl ether decreases expression ISO RGD:1565181 6480464 decabromobiphenyl ether results in decreased expression of USP34 mRNA CTD PMID:23640034 Usp34 Mouse decabromodiphenyl ether decreases expression ISO RGD:1318847 6480464 decabromobiphenyl ether results in decreased expression of USP34 protein CTD PMID:31675489 Usp34 Mouse dexamethasone multiple interactions ISO RGD:1318847 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Usp34 Mouse Dibutyl phosphate affects expression ISO RGD:1318847 6480464 di-n-butylphosphoric acid affects the expression of USP34 mRNA CTD PMID:37042841 Usp34 Mouse dorsomorphin multiple interactions ISO RGD:1318847 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Usp34 Mouse doxorubicin decreases expression ISO RGD:1318847 6480464 Doxorubicin results in decreased expression of USP34 mRNA CTD PMID:29803840 Usp34 Mouse ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of USP34 mRNA CTD PMID:29018328 Usp34 Mouse formaldehyde decreases expression ISO RGD:1318847 6480464 Formaldehyde results in decreased expression of USP34 mRNA CTD PMID:20655997 Usp34 Mouse formaldehyde increases expression ISO RGD:1318847 6480464 Formaldehyde results in increased expression of USP34 mRNA CTD PMID:23649840 Usp34 Mouse FR900359 affects phosphorylation ISO RGD:1318847 6480464 FR900359 affects the phosphorylation of USP34 protein CTD PMID:37730182 Usp34 Mouse indometacin multiple interactions ISO RGD:1318847 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Usp34 Mouse ivermectin decreases expression ISO RGD:1318847 6480464 Ivermectin results in decreased expression of USP34 protein CTD PMID:32959892 Usp34 Mouse lead diacetate multiple interactions ISO RGD:1318847 6480464 [lead acetate co-treated with zinc protoporphyrin] results in increased expression of USP34 mRNA CTD PMID:22839698 Usp34 Mouse manganese atom multiple interactions ISO RGD:1318847 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Usp34 Mouse manganese(0) multiple interactions ISO RGD:1318847 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Usp34 Mouse manganese(II) chloride multiple interactions ISO RGD:1318847 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Usp34 Mouse methyl methanesulfonate increases expression ISO RGD:1318847 6480464 Methyl Methanesulfonate results in increased expression of USP34 mRNA CTD PMID:23649840 Usp34 Mouse methylmercury chloride decreases expression ISO RGD:1318847 6480464 methylmercuric chloride results in decreased expression of USP34 mRNA CTD PMID:26272509 Usp34 Mouse miconazole decreases expression EXP 6480464 Miconazole results in decreased expression of USP34 mRNA CTD PMID:27462272 Usp34 Mouse oxaliplatin multiple interactions ISO RGD:1565181 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of USP34 mRNA CTD PMID:25729387 Usp34 Mouse potassium chromate decreases expression ISO RGD:1318847 6480464 potassium chromate(VI) results in decreased expression of USP34 mRNA CTD PMID:22079256 Usp34 Mouse potassium chromate multiple interactions ISO RGD:1318847 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of USP34 mRNA CTD PMID:22079256 Usp34 Mouse potassium dichromate decreases expression EXP 6480464 Potassium Dichromate results in decreased expression of USP34 mRNA CTD PMID:23608068 Usp34 Mouse rac-lactic acid decreases expression ISO RGD:1318847 6480464 Lactic Acid results in decreased expression of USP34 mRNA CTD PMID:30851411 Usp34 Mouse SB 431542 multiple interactions ISO RGD:1318847 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Usp34 Mouse sodium arsenite multiple interactions ISO RGD:1318847 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Usp34 Mouse succimer multiple interactions EXP 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of USP34 mRNA; [Succimer co-treated more ... CTD PMID:21641980|PMID:26378955 Usp34 Mouse sunitinib increases expression ISO RGD:1318847 6480464 Sunitinib results in increased expression of USP34 mRNA CTD PMID:31533062 Usp34 Mouse testosterone enanthate affects expression ISO RGD:1318847 6480464 testosterone enanthate affects the expression of USP34 mRNA CTD PMID:17440010 Usp34 Mouse thimerosal affects expression ISO RGD:1318847 6480464 Thimerosal affects the expression of USP34 mRNA CTD PMID:27188386 Usp34 Mouse thiram increases expression ISO RGD:1318847 6480464 Thiram results in increased expression of USP34 mRNA CTD PMID:38568856 Usp34 Mouse topotecan multiple interactions ISO RGD:1565181 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of USP34 mRNA CTD PMID:25729387 Usp34 Mouse topotecan decreases expression ISO RGD:1565181 6480464 Topotecan results in decreased expression of USP34 mRNA CTD PMID:25729387 Usp34 Mouse trichostatin A increases expression ISO RGD:1318847 6480464 trichostatin A results in increased expression of USP34 mRNA CTD PMID:24935251 Usp34 Mouse trichostatin A multiple interactions ISO RGD:1318847 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Usp34 Mouse trichostatin A decreases expression ISO RGD:1318847 6480464 trichostatin A results in decreased expression of USP34 mRNA CTD PMID:26272509 Usp34 Mouse triphenyl phosphate affects expression ISO RGD:1318847 6480464 triphenyl phosphate affects the expression of USP34 mRNA CTD PMID:37042841 Usp34 Mouse triptonide decreases expression EXP 6480464 triptonide results in decreased expression of USP34 mRNA CTD PMID:33045310 Usp34 Mouse tungsten decreases expression EXP 6480464 Tungsten results in decreased expression of USP34 mRNA CTD PMID:30912803 Usp34 Mouse tunicamycin decreases expression EXP 6480464 Tunicamycin results in decreased expression of USP34 mRNA CTD PMID:17127020 Usp34 Mouse valproic acid decreases expression ISO RGD:1318847 6480464 Valproic Acid results in decreased expression of USP34 mRNA CTD PMID:23179753|PMID:25192806 Usp34 Mouse vincristine increases expression ISO RGD:1318847 6480464 Vincristine results in increased expression of USP34 mRNA CTD PMID:23649840 Usp34 Mouse vorinostat decreases expression ISO RGD:1318847 6480464 vorinostat results in decreased expression of USP34 mRNA CTD PMID:27188386 Usp34 Mouse zinc protoporphyrin multiple interactions ISO RGD:1318847 6480464 [lead acetate co-treated with zinc protoporphyrin] results in increased expression of USP34 mRNA CTD PMID:22839698
(-)-demecolcine (ISO) (-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (EXP) 17beta-estradiol (EXP) 2,3',4,4',5-Pentachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4,6-tribromophenol (ISO) 2-hydroxypropanoic acid (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) aflatoxin B1 (EXP,ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) CGP 52608 (ISO) chlorpyrifos (EXP) ciguatoxin CTX1B (EXP) cisplatin (ISO) clobetasol (EXP) clozapine (ISO) coumarin (ISO) decabromodiphenyl ether (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dorsomorphin (ISO) doxorubicin (ISO) ethanol (EXP) formaldehyde (ISO) FR900359 (ISO) indometacin (ISO) ivermectin (ISO) lead diacetate (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) miconazole (EXP) oxaliplatin (ISO) potassium chromate (ISO) potassium dichromate (EXP) rac-lactic acid (ISO) SB 431542 (ISO) sodium arsenite (ISO) succimer (EXP) sunitinib (ISO) testosterone enanthate (ISO) thimerosal (ISO) thiram (ISO) topotecan (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (EXP) tungsten (EXP) tunicamycin (EXP) valproic acid (ISO) vincristine (ISO) vorinostat (ISO) zinc protoporphyrin (ISO)
Usp34 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 23,256,433 - 23,440,560 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 23,256,895 - 23,440,560 (+) Ensembl GRCm39 Ensembl GRCm38 11 23,303,185 - 23,490,560 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 23,306,895 - 23,490,560 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 23,206,895 - 23,390,560 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 23,297,186 - 23,346,963 (+) NCBI MGSCv36 mm8 Celera 11 25,434,085 - 25,618,456 (+) NCBI Celera Cytogenetic Map 11 A3.2 NCBI cM Map 11 14.29 NCBI
USP34 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 61,187,463 - 61,471,087 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 61,187,463 - 61,471,087 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 61,414,598 - 61,698,222 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 61,268,094 - 61,551,353 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 61,326,887 - 61,544,591 NCBI Celera 2 61,259,053 - 61,542,286 (-) NCBI Celera Cytogenetic Map 2 p15 NCBI HuRef 2 61,155,323 - 61,406,983 (-) NCBI HuRef CHM1_1 2 61,345,076 - 61,628,268 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 61,193,315 - 61,476,925 (-) NCBI T2T-CHM13v2.0
Usp34 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 101,487,110 - 101,677,519 (+) NCBI GRCr8 mRatBN7.2 14 97,285,799 - 97,476,376 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 97,286,018 - 97,476,376 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 101,618,406 - 101,808,552 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 102,862,754 - 103,052,913 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 99,334,322 - 99,524,478 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 108,060,653 - 108,264,706 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 108,143,869 - 108,264,706 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 108,136,049 - 108,169,242 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 14 104,954,066 - 105,100,563 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 103,990,220 - 104,426,186 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 14 96,263,246 - 96,453,075 (+) NCBI Celera Cytogenetic Map 14 q22 NCBI
Usp34 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955424 22,474,098 - 22,689,322 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955424 22,434,292 - 22,689,944 (+) NCBI ChiLan1.0 ChiLan1.0
USP34 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 64,912,972 - 65,196,317 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 64,916,937 - 65,200,268 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 61,272,350 - 61,555,244 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 62,411,168 - 62,643,009 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 62,411,173 - 62,644,812 (-) Ensembl panpan1.1 panPan2
USP34 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 61,264,605 - 61,459,603 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 61,267,478 - 61,511,347 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 61,154,885 - 61,401,035 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 62,273,979 - 62,520,172 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 62,276,482 - 62,520,570 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 61,976,715 - 62,205,083 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 62,261,456 - 62,507,713 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 62,559,525 - 62,802,709 (-) NCBI UU_Cfam_GSD_1.0
Usp34 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 21,670,538 - 21,890,968 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936491 6,680,950 - 6,869,651 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936491 6,680,324 - 6,862,053 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
USP34 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 80,370,691 - 80,587,761 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 80,330,896 - 80,589,514 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 84,382,219 - 84,510,793 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
USP34 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 45,516,555 - 45,798,676 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 45,516,587 - 45,798,054 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 66,003,118 - 66,289,921 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Usp34
.
Predicted Target Of
Count of predictions: 2494 Count of miRNA genes: 697 Interacting mature miRNAs: 926 Transcripts: ENSMUST00000070402, ENSMUST00000101465, ENSMUST00000125701, ENSMUST00000129368, ENSMUST00000129521, ENSMUST00000130131, ENSMUST00000137823, ENSMUST00000148927, ENSMUST00000155984, ENSMUST00000180046 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1302171 Pgia28_m proteoglycan induced arthritis 28 (mouse) Not determined 11 8906097 42906218 Mouse 1357720 Kidpq1_m kidney weight percentage QTL 1 (mouse) Not determined 11 12268637 68500330 Mouse 1357722 Vtbt11_m vertebral trabecular bone trait 11 (mouse) Not determined 11 1 23880487 Mouse 1357851 Scfq3_m subcutaneous fat pad weight QTL 3 (mouse) Not determined 11 12268637 68500330 Mouse 27226762 Feml21_m femur length 21, 16 week (mouse) 11 11750000 65990826 Mouse 1301765 Skull15_m skull morphology 15 (mouse) Not determined 11 1 25976374 Mouse 4141470 Egq4_m early growth QTL 4 (mouse) Not determined 12268637 68500330 Mouse 13524844 Ppiq9_m prepulse inhibition QTL 9 (mouse) 11 9049997 35077325 Mouse 4142109 W10q2_m weight 10 weeks QTL 2 (mouse) Not determined 12268637 68500330 Mouse 1300661 Lmr6_m leishmaniasis resistance 6 (mouse) Not determined 11 1 25976374 Mouse 13208559 Wght10_m weight 10 (mouse) 11 3950000 88890826 Mouse 10412216 Eae44_m experimental allergic encephalomyelitis susceptibility 44 (mouse) Not determined 11 12268637 39950840 Mouse 13208558 Lgth12_m body length 12 (mouse) 11 3950000 94890826 Mouse 26884401 Huml4_m humerus length 4, 10 week (mouse) 11 11550000 68490826 Mouse 10053687 Eae6_m susceptibility to experimental allergic encephalomyelitis 6 (mouse) Not determined 11 17781966 68500330 Mouse 27226798 Scvln18_m sacral vertebrae length 2, 16 week (mouse) 11 3250000 60690826 Mouse 4141582 Lgaq1_m late growth adjusted QTL 1 (mouse) Not determined 12268637 68500330 Mouse 4141966 Tailq1_m tail length QTL 1 (mouse) Not determined 12268637 68500330 Mouse 1300768 Tshp9_m tooth shape 9 (mouse) Not determined 11 1 25976374 Mouse 1558945 Orgwq8_m organ weight QTL 8 (mouse) Not determined 11 17056175 67078411 Mouse 4142216 Lgq1_m late growth QTL 1 (mouse) Not determined 12268637 68500330 Mouse 1300905 Scc6_m colon tumor susceptibility 6 (mouse) Not determined 11 6880277 89019734 Mouse 14746971 Manh70_m mandible shape 70 (mouse) 11 19905890 53905890 Mouse 39128214 Lwq20_m liver weight QTL 20 (mouse) 11 12268637 118022724 Mouse 26884446 Sklq10_m skull length QTL 10, 10 week (mouse) 11 3250000 62890826 Mouse 4141047 Nilac1_m nicotine induced locomotor activity 1 (mouse) Not determined 11 9011780 43011942 Mouse 10412246 Dfs2_m dental fluorosis suseptibility 2 (mouse) Not determined 11 21807364 95881231 Mouse 1559002 Lmrq4_m Leishmania major resistance QTL 4 (mouse) Not determined 11 12268637 69684947 Mouse 1300938 Bulb3_m bulb size 3 (mouse) Not determined 11 18578616 52578716 Mouse 1357518 Tgyl1_m triglyceride level 1 (mouse) Not determined 11 6880277 33916219 Mouse 4142308 W6q3_m weight 6 weeks QTL 3 (mouse) Not determined 11 12268637 68500330 Mouse 1357640 Orq2_m ovulation rate QTL 2 (mouse) Not determined 11 12268637 68500330 Mouse 1300599 Cocrb11_m cocaine related behavior 11 (mouse) Not determined 11 2670355 36671472 Mouse 1357437 Epfq4_m epididymal fat pad weight QTL 4 (mouse) Not determined 11 12268637 68500330 Mouse 4141398 Tgq22_m triglyceride QTL 22 (mouse) Not determined 21163406 55163406 Mouse 27226741 Metcl5_m metatarsal-calcaneal length 5, 5 week (mouse) 11 4650000 46290827 Mouse 1300990 Bits3_m bitterness sensitivity 3 (mouse) Not determined 11 8372121 42372260 Mouse 27226738 Metcl11_m metatarsal-calcaneal length 11, 10 week (mouse) 11 8850000 61390826 Mouse 27226735 Metcl16_m metatarsal-calcaneal length 16, 16 week (mouse) 11 5250000 35090827 Mouse 12801459 Leuf1_m leukocyte filtration 1 (mouse) 11 18578616 52578716 Mouse 1300579 Thypr1_m thymocyte proliferative response 1 (mouse) Not determined 11 19282577 53282715 Mouse 10044008 Hbnr15_m Heligmosomoides bakeri nematode resistance 15 (mouse) Not determined 11 227052 34227232 Mouse 12801457 Intmrm2_m intima/media ratio modifier 2 (mouse) 11 18578616 52578716 Mouse 12801460 Intim2_m intima modifier 2 (mouse) 11 18578616 52578716 Mouse 27095909 Scvln6_m sacral vertebrae length 2, 5 week (mouse) 11 3250000 44090827 Mouse 4141127 W3q4_m weight 3 weeks QTL 4 (mouse) Not determined 12268637 68500330 Mouse 4141894 Nidd6k_m Nidd6 on KK-A (mouse) Not determined 19124204 96897826 Mouse 13463479 Mchq19_m mean corpuscular hemoglobin QTL 19 (mouse) 11 10951232 44951464 Mouse 27095904 Scvln12_m sacral vertebrae length 2, 10 week (mouse) 11 3250000 34495048 Mouse 13463472 Mcvq15_m mean corpuscular volume QTL 15 (mouse) 11 10951232 44951464 Mouse 26884453 Sklq16_m skull length QTL 16, 16 week (mouse) 11 3250000 72690826 Mouse
AI450991
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 11 23,489,464 - 23,489,670 UniSTS GRCm38 MGSCv37 11 23,389,464 - 23,389,670 UniSTS GRCm37 Celera 11 25,617,360 - 25,617,566 UniSTS Cytogenetic Map 11 A3.2 UniSTS Whitehead/MRC_RH 11 397.65 UniSTS
UniSTS:236535
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 11 23,489,944 - 23,490,062 UniSTS GRCm38 MGSCv37 11 23,389,944 - 23,390,062 UniSTS GRCm37 Celera 11 25,617,840 - 25,617,958 UniSTS Cytogenetic Map 11 A3.2 UniSTS
UniSTS:225269
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 11 23,399,479 - 23,399,675 UniSTS GRCm38 MGSCv37 11 23,299,479 - 23,299,675 UniSTS GRCm37 Celera 11 25,527,404 - 25,527,600 UniSTS Cytogenetic Map 11 A3.2 UniSTS
D11Bhm20
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 7 F1 UniSTS Cytogenetic Map 5 E2 UniSTS Cytogenetic Map 1 C3 UniSTS Cytogenetic Map 17 A3.3 UniSTS Cytogenetic Map 19 D1 UniSTS Cytogenetic Map 13 A2-A3 UniSTS Cytogenetic Map 11 A1 UniSTS Cytogenetic Map 5 C1 UniSTS Cytogenetic Map 12 D1 UniSTS Cytogenetic Map 8 E1 UniSTS Cytogenetic Map 4 D1 UniSTS Cytogenetic Map 7 B4 UniSTS Cytogenetic Map 3 F1 UniSTS Cytogenetic Map 7 A1 UniSTS Cytogenetic Map 4 E1 UniSTS Cytogenetic Map 10 B4 UniSTS Cytogenetic Map 2 E5 UniSTS Cytogenetic Map 14 B UniSTS Cytogenetic Map 10 C1 UniSTS Cytogenetic Map 19 C2 UniSTS Cytogenetic Map 7 A3 UniSTS Cytogenetic Map 16 C1.1 UniSTS Cytogenetic Map 3 B UniSTS Cytogenetic Map 13 B3 UniSTS Cytogenetic Map 15 F1 UniSTS Cytogenetic Map 5 B1 UniSTS Cytogenetic Map 2 E2 UniSTS Cytogenetic Map 8 B3.3 UniSTS Cytogenetic Map 6 F3 UniSTS Cytogenetic Map 4 C7 UniSTS Cytogenetic Map 12 F1 UniSTS Cytogenetic Map 10 A3 UniSTS Cytogenetic Map 14 D2 UniSTS Cytogenetic Map 6 A3.3 UniSTS Cytogenetic Map 6 G3 UniSTS Cytogenetic Map 9 F2 UniSTS Cytogenetic Map 11 E2 UniSTS Cytogenetic Map 1 C1.3 UniSTS Cytogenetic Map 13 D2 UniSTS Cytogenetic Map 11 C UniSTS Cytogenetic Map 17 B1 UniSTS Cytogenetic Map 18 B3 UniSTS Cytogenetic Map 4 E2 UniSTS Cytogenetic Map X A5 UniSTS Cytogenetic Map 6 A2 UniSTS Cytogenetic Map 2 H4 UniSTS Cytogenetic Map 5 F UniSTS Cytogenetic Map 11 E1 UniSTS Cytogenetic Map 16 C4 UniSTS Cytogenetic Map 3 G1 UniSTS Cytogenetic Map 8 D2 UniSTS Cytogenetic Map 2 H2 UniSTS Cytogenetic Map 11 B5 UniSTS Cytogenetic Map 4 D3 UniSTS Cytogenetic Map 12 C3 UniSTS Cytogenetic Map 7 B1-B2 UniSTS Cytogenetic Map 4 D2.2 UniSTS Cytogenetic Map 11 B1.1 UniSTS Cytogenetic Map 15 B3.1 UniSTS Cytogenetic Map 8 D3 UniSTS Cytogenetic Map 10 D2 UniSTS Cytogenetic Map 15 E3 UniSTS Cytogenetic Map 2 H1 UniSTS Cytogenetic Map 7 E3 UniSTS Cytogenetic Map 4 D2.3 UniSTS Cytogenetic Map 10 D3 UniSTS Cytogenetic Map 12 E UniSTS Cytogenetic Map 5 G2 UniSTS Cytogenetic Map 1 H6 UniSTS Cytogenetic Map 16 A1 UniSTS Cytogenetic Map 2 A3 UniSTS Cytogenetic Map 9 A5.2 UniSTS Cytogenetic Map 3 D UniSTS Cytogenetic Map 6 B1 UniSTS Cytogenetic Map X C-D UniSTS Cytogenetic Map 13 B1 UniSTS Cytogenetic Map 11 A3.2 UniSTS Cytogenetic Map 8 C3 UniSTS Cytogenetic Map X A7.3 UniSTS Cytogenetic Map 12 A1.1 UniSTS Cytogenetic Map 16 B4 UniSTS Cytogenetic Map 4 B3 UniSTS Cytogenetic Map 5 E5 UniSTS Cytogenetic Map 19 B UniSTS cM Map 11 44.15 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000125701
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 23,436,805 - 23,437,323 (+) Ensembl GRCm38.p6 Ensembl 11 23,486,805 - 23,487,323 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000129368 ⟹ ENSMUSP00000121426
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 23,420,289 - 23,438,368 (+) Ensembl GRCm38.p6 Ensembl 11 23,470,289 - 23,488,368 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000129521
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 23,407,938 - 23,410,897 (+) Ensembl GRCm38.p6 Ensembl 11 23,457,938 - 23,460,897 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000130131 ⟹ ENSMUSP00000115168
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 23,370,055 - 23,406,686 (+) Ensembl GRCm38.p6 Ensembl 11 23,420,055 - 23,456,686 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000137823 ⟹ ENSMUSP00000120747
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 23,256,916 - 23,439,744 (+) Ensembl GRCm38.p6 Ensembl 11 23,306,916 - 23,489,744 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000148927
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 23,408,077 - 23,410,610 (+) Ensembl GRCm38.p6 Ensembl 11 23,458,077 - 23,460,610 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000155984
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 23,364,976 - 23,370,652 (+) Ensembl GRCm38.p6 Ensembl 11 23,414,976 - 23,420,652 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000180046 ⟹ ENSMUSP00000137430
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 23,256,895 - 23,440,560 (+) Ensembl GRCm38.p6 Ensembl 11 23,306,895 - 23,490,560 (+) Ensembl
RefSeq Acc Id:
NM_001190401 ⟹ NP_001177330
RefSeq Status:
INFERRED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 23,256,895 - 23,440,560 (+) NCBI GRCm38 11 23,306,895 - 23,490,560 (+) NCBI MGSCv37 11 23,206,895 - 23,390,560 (+) RGD Celera 11 25,434,085 - 25,618,456 (+) RGD cM Map 11 ENTREZGENE
Sequence:
GCCTCCGTCCCCTCCCCCCCGCCGGTCGGGATCAGTCAGCGCGATCCTAAGCGGGGGAGGGGGGGGCGGCGGCCGAACGATGTGCGAGAACTGCGCAGACCTGGTGGAGGTGTTAAATGAAATATCAG
hide sequence
RefSeq Acc Id:
XM_006514565 ⟹ XP_006514628
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 23,256,485 - 23,439,741 (+) NCBI GRCm38 11 23,303,185 - 23,489,741 (+) NCBI
Sequence:
GAGAGGCGGAGGGCGGGGGCAGCGAGGAGGGCGGAGGAATGAGTGCGCGAGGCGCCTCTCTTCG
hide sequence
RefSeq Acc Id:
XM_006514566 ⟹ XP_006514629
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 23,256,433 - 23,439,741 (+) NCBI GRCm38 11 23,306,433 - 23,489,353 (+) NCBI
Sequence:
GGAAAGGGAGGGCGGCCAGCGGCTCCGGCAGGGCGTGCGGCGTGTGTGCGGAGAGAGGCGGAGGGCGGGGGCAGCGAGGAGGGCGGAGGAATGAGTGCGCGAGGCGCCTCTCTTCGGCTCCTTCGCCT
hide sequence
RefSeq Acc Id:
XM_006514567 ⟹ XP_006514630
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 23,256,485 - 23,439,741 (+) NCBI GRCm38 11 23,303,185 - 23,489,741 (+) NCBI
Sequence:
GAGAGGCGGAGGGCGGGGGCAGCGAGGAGGGCGGAGGAATGAGTGCGCGAGGCGCCTCTCTTCG
hide sequence
RefSeq Acc Id:
XM_017314317 ⟹ XP_017169806
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 23,256,485 - 23,439,741 (+) NCBI GRCm38 11 23,303,185 - 23,489,741 (+) NCBI
Sequence:
GAGAGGCGGAGGGCGGGGGCAGCGAGGAGGGCGGAGGAATGAGTGCGCGAGGCGCCTCTCTTCGGCTCCTTCGCCTGGGCGGAAAGAGCCGAGCGCAGCCCGAGCGCTCCATTAAAATGGCGGCGGCG
hide sequence
RefSeq Acc Id:
XM_030245632 ⟹ XP_030101492
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 23,256,593 - 23,439,741 (+) NCBI GRCm38 11 23,306,481 - 23,489,353 (+) NCBI
Sequence:
CCATTAAAATGGCGGCGGCGGCGGCGGTGGCCGCGGCGTCTGGTCGGTGGTGAAGTGACTCTGC
hide sequence
RefSeq Acc Id:
XM_030245633 ⟹ XP_030101493
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 23,256,593 - 23,439,741 (+) NCBI GRCm38 11 23,306,520 - 23,489,353 (+) NCBI
Sequence:
CCATTAAAATGGCGGCGGCGGCGGCGGTGGCCGCGGCGTCTGGTCGGTGGTGAAGTGACTCTGCTGCTTCTCTCCCCACCCACCCCTCCCTCTCCCCTCCCCCGTCCTTCCCCCTTCCCCCGCCGCCG
hide sequence
RefSeq Acc Id:
XM_036156397 ⟹ XP_036012290
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 23,256,485 - 23,439,741 (+) NCBI
Sequence:
GAGAGGCGGAGGGCGGGGGCAGCGAGGAGGGCGGAGGAATGAGTGCGCGAGGCGCCTCTCTTCGGCTCCTTCGCCTGGGCGGAAAGAGCCGAGCGCAGCCCGAGCGCTCCATTAAAATGGCGGCGGCG
hide sequence
RefSeq Acc Id:
NP_001177330 ⟸ NM_001190401
- UniProtKB:
Q7TMJ6 (UniProtKB/Swiss-Prot), Q6P563 (UniProtKB/Swiss-Prot), Q3UPN0 (UniProtKB/Swiss-Prot), Q3UF93 (UniProtKB/Swiss-Prot), A2AF77 (UniProtKB/Swiss-Prot), A2AF27 (UniProtKB/Swiss-Prot), A2AF26 (UniProtKB/Swiss-Prot), Q8CCH0 (UniProtKB/Swiss-Prot), Q6ZQ93 (UniProtKB/Swiss-Prot), F6WJB7 (UniProtKB/TrEMBL)
- Sequence:
MCENCADLVEVLNEISDIEGGDGLQLRKEHTLKIFAYINSWTQRQCLCCFKEYKHLEIFNQVVCALINLVIAQVQVLRDQLCKHCTTINIDSTWQDESNQAEEPLSIDRECNEGNTERQKSIEKKSNS
hide sequence
RefSeq Acc Id:
XP_006514628 ⟸ XM_006514565
- Peptide Label:
isoform X1
- UniProtKB:
F6WJB7 (UniProtKB/TrEMBL)
- Sequence:
MCENCADLVEVLNEISDIEGGDGLQLRKEHTLKIFAYINSWTQRQCLCCFKEYKHLEIFNQVVCALINLVIAQVQVLRDQLCKHCTTINIDSTWQDESNQAEEPLSIDRECNEGNTERQKSIEKKSNS
hide sequence
RefSeq Acc Id:
XP_006514630 ⟸ XM_006514567
- Peptide Label:
isoform X4
- UniProtKB:
F6WJB7 (UniProtKB/TrEMBL)
- Sequence:
MCENCADLVEVLNEISDIEGGDGLQLRKEHTLKIFAYINSWTQRQCLCCFKEYKHLEIFNQVVCALINLVIAQVQVLRDQLCKHCTTINIDSTWQDESNQAEEPLSIDRECNEGNTERQKSIEKKSNS
hide sequence
RefSeq Acc Id:
XP_006514629 ⟸ XM_006514566
- Peptide Label:
isoform X2
- UniProtKB:
F6WJB7 (UniProtKB/TrEMBL)
- Sequence:
MCENCADLVEVLNEISDIEGGDGLQLRKEHTLKIFAYINSWTQRQCLCCFKEYKHLEIFNQVVC
hide sequence
RefSeq Acc Id:
XP_017169806 ⟸ XM_017314317
- Peptide Label:
isoform X5
- UniProtKB:
F6WJB7 (UniProtKB/TrEMBL)
- Sequence:
MCENCADLVEVLNEISDIEGGDGLQLRKEHTLKIFAYINSWTQRQCLCCFKEYKHLEIFNQVVC
hide sequence
RefSeq Acc Id:
XP_030101492 ⟸ XM_030245632
- Peptide Label:
isoform X6
- UniProtKB:
F6WJB7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_030101493 ⟸ XM_030245633
- Peptide Label:
isoform X7
- UniProtKB:
F6WJB7 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSMUSP00000115168 ⟸ ENSMUST00000130131
Ensembl Acc Id:
ENSMUSP00000121426 ⟸ ENSMUST00000129368
Ensembl Acc Id:
ENSMUSP00000120747 ⟸ ENSMUST00000137823
Ensembl Acc Id:
ENSMUSP00000137430 ⟸ ENSMUST00000180046
RefSeq Acc Id:
XP_036012290 ⟸ XM_036156397
- Peptide Label:
isoform X3
- UniProtKB:
F6WJB7 (UniProtKB/TrEMBL)
RGD ID: 8674106 Promoter ID: EPDNEW_M15084 Type: initiation region Name: Usp34_1 Description: Mus musculus ubiquitin specific peptidase 34 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 11 23,306,928 - 23,306,988 EPDNEW
RGD ID: 6822428 Promoter ID: MM_KWN:6671 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Lung Transcripts: OTTMUST00000011783, OTTMUST00000011784 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 23,356,771 - 23,357,271 (+) MPROMDB
