Symbol:
Ogdhl
Name:
oxoglutarate dehydrogenase-like
RGD ID:
1614897
MGI Page
MGI
Description:
Predicted to enable oxoglutarate dehydrogenase (succinyl-transferring) activity. Predicted to be involved in 2-oxoglutarate metabolic process and tricarboxylic acid cycle. Predicted to be located in mitochondrial matrix. Predicted to be part of oxoglutarate dehydrogenase complex. Predicted to be active in mitochondrion. Is expressed in heart. Human ortholog(s) of this gene implicated in Yoon-Bellen neurodevelopmental syndrome. Orthologous to human OGDHL (oxoglutarate dehydrogenase L).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
2-oxoglutarate dehydrogenase-like, mitochondrial
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
OGDHL (oxoglutarate dehydrogenase L) HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Ogdhl (oxoglutarate dehydrogenase L) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ogdhl (oxoglutarate dehydrogenase L) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
OGDHL (oxoglutarate dehydrogenase L) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
OGDHL (oxoglutarate dehydrogenase L) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ogdhl (oxoglutarate dehydrogenase L) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
OGDHL (oxoglutarate dehydrogenase L) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
OGDHL (oxoglutarate dehydrogenase L) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ogdhl (oxoglutarate dehydrogenase L) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
OGDH (oxoglutarate dehydrogenase) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Ogdhl (oxoglutarate dehydrogenase L)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
OGDHL (oxoglutarate dehydrogenase L)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ogdhl (oxoglutarate dehydrogenase like)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
KGD1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG33791
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Nc73EF
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ogdh-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ogdhl
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 32,043,941 - 32,070,108 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 32,043,976 - 32,070,108 (+) Ensembl GRCm39 Ensembl GRCm38 14 32,321,982 - 32,348,151 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 32,322,019 - 32,348,151 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 33,135,205 - 33,161,006 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 31,151,028 - 31,176,829 (+) NCBI MGSCv36 mm8 MGSCv36 14 27,427,058 - 27,452,725 (+) NCBI MGSCv36 mm8 Celera 14 28,579,005 - 28,605,091 (+) NCBI Celera Cytogenetic Map 14 B NCBI cM Map 14 19.4 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ogdhl Mouse 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Ogdhl Mouse 1,2-dichloroethane increases expression EXP 6480464 ethylene dichloride results in increased expression of OGDHL mRNA CTD PMID:28960355 Ogdhl Mouse 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Ogdhl Mouse 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions EXP 6480464 [Flame Retardants results in increased abundance of 2 more ... CTD PMID:38995820 Ogdhl Mouse 2,2',5,5'-tetrachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Ogdhl Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO OGDHL (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of OGDHL mRNA CTD PMID:22298810 Ogdhl Mouse 2,4,4'-trichlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Ogdhl Mouse 2,6-dimethoxyphenol multiple interactions ISO OGDHL (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of and affects the localization of OGDHL protein CTD PMID:38598786 Ogdhl Mouse 2-palmitoylglycerol increases expression ISO OGDHL (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of OGDHL mRNA CTD PMID:37199045 Ogdhl Mouse acetamide decreases expression ISO Ogdhl (Rattus norvegicus) 6480464 acetamide results in decreased expression of OGDHL mRNA CTD PMID:31881176 Ogdhl Mouse aflatoxin B1 affects expression ISO OGDHL (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of OGDHL protein CTD PMID:20106945 Ogdhl Mouse aflatoxin B1 decreases expression ISO OGDHL (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of OGDHL mRNA CTD PMID:22100608 and PMID:27153756 Ogdhl Mouse aflatoxin B1 decreases methylation ISO OGDHL (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of OGDHL gene CTD PMID:27153756 Ogdhl Mouse aflatoxin B1 increases expression ISO Ogdhl (Rattus norvegicus) 6480464 Aflatoxin B1 results in increased expression of OGDHL mRNA CTD PMID:23630614 more ... Ogdhl Mouse all-trans-retinoic acid decreases expression ISO OGDHL (Homo sapiens) 6480464 Tretinoin results in decreased expression of OGDHL mRNA CTD PMID:33167477 Ogdhl Mouse aristolochic acid A decreases expression ISO OGDHL (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of OGDHL mRNA CTD PMID:33212167 Ogdhl Mouse atrazine increases expression ISO OGDHL (Homo sapiens) 6480464 Atrazine results in increased expression of OGDHL mRNA CTD PMID:22378314 Ogdhl Mouse benzo[a]pyrene affects methylation ISO OGDHL (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of OGDHL 5' UTR and Benzo(a)pyrene affects the methylation of OGDHL promoter CTD PMID:27901495 Ogdhl Mouse benzo[a]pyrene decreases expression ISO OGDHL (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of OGDHL mRNA CTD PMID:32234424 Ogdhl Mouse benzo[a]pyrene increases methylation ISO OGDHL (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of OGDHL 3' UTR CTD PMID:27901495 Ogdhl Mouse bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of OGDHL mRNA CTD PMID:34319233 Ogdhl Mouse bisphenol A increases expression ISO Ogdhl (Rattus norvegicus) 6480464 bisphenol A results in increased expression of OGDHL mRNA CTD PMID:25181051 Ogdhl Mouse bisphenol A decreases expression ISO Ogdhl (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of OGDHL mRNA CTD PMID:30816183 more ... Ogdhl Mouse bisphenol A increases methylation ISO Ogdhl (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of OGDHL gene CTD PMID:28505145 Ogdhl Mouse butanal increases expression ISO OGDHL (Homo sapiens) 6480464 butyraldehyde results in increased expression of OGDHL mRNA CTD PMID:26079696 Ogdhl Mouse C60 fullerene decreases expression ISO Ogdhl (Rattus norvegicus) 6480464 fullerene C60 results in decreased expression of OGDHL mRNA CTD PMID:19167457 Ogdhl Mouse cadmium atom decreases expression ISO OGDHL (Homo sapiens) 6480464 Cadmium results in decreased expression of OGDHL mRNA CTD PMID:21120746 Ogdhl Mouse copper(II) sulfate decreases expression ISO OGDHL (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of OGDHL mRNA CTD PMID:19549813 Ogdhl Mouse cyclosporin A decreases expression ISO OGDHL (Homo sapiens) 6480464 Cyclosporine results in decreased expression of OGDHL mRNA CTD PMID:20106945 more ... Ogdhl Mouse dinophysistoxin 1 decreases expression ISO OGDHL (Homo sapiens) 6480464 dinophysistoxin 1 results in decreased expression of OGDHL mRNA CTD PMID:28939011 Ogdhl Mouse dorsomorphin multiple interactions ISO OGDHL (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ogdhl Mouse doxorubicin decreases expression ISO OGDHL (Homo sapiens) 6480464 Doxorubicin results in decreased expression of OGDHL mRNA CTD PMID:29803840 Ogdhl Mouse endosulfan decreases expression ISO Ogdhl (Rattus norvegicus) 6480464 Endosulfan results in decreased expression of OGDHL mRNA CTD PMID:29391264 Ogdhl Mouse entinostat increases expression ISO OGDHL (Homo sapiens) 6480464 entinostat results in increased expression of OGDHL mRNA CTD PMID:26272509 Ogdhl Mouse entinostat multiple interactions ISO OGDHL (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of OGDHL mRNA CTD PMID:27188386 Ogdhl Mouse ethanol increases expression ISO Ogdhl (Rattus norvegicus) 6480464 Ethanol results in increased expression of OGDHL protein CTD PMID:19609968 Ogdhl Mouse ethanol affects expression EXP 6480464 Ethanol affects the expression of OGDHL mRNA CTD PMID:30319688 Ogdhl Mouse furan increases expression ISO Ogdhl (Rattus norvegicus) 6480464 furan results in increased expression of OGDHL mRNA CTD PMID:27387713 Ogdhl Mouse furfural multiple interactions ISO OGDHL (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of OGDHL protein and [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of OGDHL protein CTD PMID:38598786 Ogdhl Mouse gentamycin increases expression ISO Ogdhl (Rattus norvegicus) 6480464 Gentamicins results in increased expression of OGDHL mRNA CTD PMID:33387578 Ogdhl Mouse hydrogen sulfide increases expression EXP 6480464 Hydrogen Sulfide results in increased expression of OGDHL protein CTD PMID:29932956 Ogdhl Mouse indole-3-methanol multiple interactions ISO Ogdhl (Rattus norvegicus) 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of OGDHL mRNA CTD PMID:22129741 Ogdhl Mouse ivermectin decreases expression ISO OGDHL (Homo sapiens) 6480464 Ivermectin results in decreased expression of OGDHL protein CTD PMID:32959892 Ogdhl Mouse lead(0) affects expression ISO OGDHL (Homo sapiens) 6480464 Lead affects the expression of OGDHL mRNA CTD PMID:28903495 Ogdhl Mouse lipopolysaccharide multiple interactions ISO OGDHL (Homo sapiens) 6480464 [Lipopolysaccharides co-treated with resveratrol] results in increased expression of OGDHL mRNA CTD PMID:26667767 Ogdhl Mouse menadione affects expression ISO OGDHL (Homo sapiens) 6480464 Vitamin K 3 affects the expression of OGDHL mRNA CTD PMID:20044591 Ogdhl Mouse methamphetamine increases expression ISO OGDHL (Homo sapiens) 6480464 Methamphetamine results in increased expression of OGDHL mRNA CTD PMID:25290377 Ogdhl Mouse methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of OGDHL mRNA CTD PMID:36914120 Ogdhl Mouse N-nitrosodiethylamine multiple interactions ISO Ogdhl (Rattus norvegicus) 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of OGDHL mRNA CTD PMID:22129741 Ogdhl Mouse N-Nitrosopyrrolidine decreases expression ISO OGDHL (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of OGDHL mRNA CTD PMID:32234424 Ogdhl Mouse O-methyleugenol decreases expression ISO OGDHL (Homo sapiens) 6480464 methyleugenol results in decreased expression of OGDHL mRNA CTD PMID:32234424 Ogdhl Mouse okadaic acid decreases expression ISO OGDHL (Homo sapiens) 6480464 Okadaic Acid results in decreased expression of OGDHL mRNA CTD PMID:38832940 Ogdhl Mouse paracetamol increases expression ISO OGDHL (Homo sapiens) 6480464 Acetaminophen results in increased expression of OGDHL mRNA CTD PMID:25704631 Ogdhl Mouse paracetamol increases expression ISO Ogdhl (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of OGDHL mRNA CTD PMID:33387578 Ogdhl Mouse paracetamol decreases expression ISO OGDHL (Homo sapiens) 6480464 Acetaminophen results in decreased expression of OGDHL mRNA CTD PMID:29067470 Ogdhl Mouse PCB138 multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Ogdhl Mouse pentanal increases expression ISO OGDHL (Homo sapiens) 6480464 pentanal results in increased expression of OGDHL mRNA CTD PMID:26079696 Ogdhl Mouse perfluorohexanesulfonic acid increases expression EXP 6480464 perfluorohexanesulfonic acid results in increased expression of OGDHL mRNA CTD PMID:37995155 Ogdhl Mouse propanal increases expression ISO OGDHL (Homo sapiens) 6480464 propionaldehyde results in increased expression of OGDHL mRNA CTD PMID:26079696 Ogdhl Mouse resveratrol multiple interactions ISO OGDHL (Homo sapiens) 6480464 [Lipopolysaccharides co-treated with resveratrol] results in increased expression of OGDHL mRNA CTD PMID:26667767 Ogdhl Mouse SB 431542 multiple interactions ISO OGDHL (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ogdhl Mouse sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of OGDHL mRNA CTD PMID:37682722 Ogdhl Mouse sodium chloride multiple interactions ISO OGDHL (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of OGDHL protein more ... CTD PMID:38598786 Ogdhl Mouse tetrachloromethane decreases expression ISO Ogdhl (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of OGDHL mRNA CTD PMID:31150632 Ogdhl Mouse thapsigargin decreases expression ISO Ogdhl (Rattus norvegicus) 6480464 Thapsigargin results in decreased expression of OGDHL protein CTD PMID:35544339 Ogdhl Mouse thioacetamide increases expression ISO Ogdhl (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of OGDHL mRNA CTD PMID:23411599 Ogdhl Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of OGDHL promoter CTD PMID:35295148 Ogdhl Mouse trichloroethene increases expression ISO Ogdhl (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of OGDHL mRNA CTD PMID:33387578 Ogdhl Mouse tris(2-butoxyethyl) phosphate affects expression ISO OGDHL (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of OGDHL mRNA CTD PMID:29024780 Ogdhl Mouse valproic acid affects expression ISO OGDHL (Homo sapiens) 6480464 Valproic Acid affects the expression of OGDHL mRNA CTD PMID:25979313 Ogdhl Mouse valproic acid multiple interactions ISO OGDHL (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of OGDHL mRNA CTD PMID:27188386 Ogdhl Mouse valproic acid increases expression ISO OGDHL (Homo sapiens) 6480464 Valproic Acid results in increased expression of OGDHL mRNA CTD PMID:24383497 more ... Ogdhl Mouse vinclozolin increases expression ISO Ogdhl (Rattus norvegicus) 6480464 vinclozolin results in increased expression of OGDHL mRNA CTD PMID:23034163 Ogdhl Mouse vinclozolin increases methylation ISO Ogdhl (Rattus norvegicus) 6480464 vinclozolin results in increased methylation of OGDHL gene CTD PMID:31682807 Ogdhl Mouse zoledronic acid decreases expression ISO OGDHL (Homo sapiens) 6480464 zoledronic acid results in decreased expression of OGDHL mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (EXP) 1,2-dichloroethane (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,4'-trichlorobiphenyl (EXP) 2,6-dimethoxyphenol (ISO) 2-palmitoylglycerol (ISO) acetamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) atrazine (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (ISO) butanal (ISO) C60 fullerene (ISO) cadmium atom (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) dinophysistoxin 1 (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (ISO) entinostat (ISO) ethanol (EXP,ISO) furan (ISO) furfural (ISO) gentamycin (ISO) hydrogen sulfide (EXP) indole-3-methanol (ISO) ivermectin (ISO) lead(0) (ISO) lipopolysaccharide (ISO) menadione (ISO) methamphetamine (EXP,ISO) N-nitrosodiethylamine (ISO) N-Nitrosopyrrolidine (ISO) O-methyleugenol (ISO) okadaic acid (ISO) paracetamol (ISO) PCB138 (EXP) pentanal (ISO) perfluorohexanesulfonic acid (EXP) propanal (ISO) resveratrol (ISO) SB 431542 (ISO) sodium arsenite (EXP) sodium chloride (ISO) tetrachloromethane (ISO) thapsigargin (ISO) thioacetamide (ISO) titanium dioxide (EXP) trichloroethene (ISO) tris(2-butoxyethyl) phosphate (ISO) valproic acid (ISO) vinclozolin (ISO) zoledronic acid (ISO)
Ogdhl Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 32,043,941 - 32,070,108 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 32,043,976 - 32,070,108 (+) Ensembl GRCm39 Ensembl GRCm38 14 32,321,982 - 32,348,151 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 32,322,019 - 32,348,151 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 33,135,205 - 33,161,006 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 31,151,028 - 31,176,829 (+) NCBI MGSCv36 mm8 MGSCv36 14 27,427,058 - 27,452,725 (+) NCBI MGSCv36 mm8 Celera 14 28,579,005 - 28,605,091 (+) NCBI Celera Cytogenetic Map 14 B NCBI cM Map 14 19.4 NCBI
OGDHL Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 49,734,641 - 49,762,379 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 49,734,641 - 49,762,379 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 50,942,687 - 50,970,425 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 50,612,717 - 50,640,375 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 50,612,716 - 50,640,375 NCBI Celera 10 44,528,687 - 44,557,024 (-) NCBI Celera Cytogenetic Map 10 q11.23 NCBI HuRef 10 45,207,521 - 45,235,123 (-) NCBI HuRef CHM1_1 10 51,224,672 - 51,252,417 (-) NCBI CHM1_1 T2T-CHM13v2.0 10 50,583,410 - 50,612,062 (-) NCBI T2T-CHM13v2.0
Ogdhl Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 7,584,666 - 7,610,705 (+) NCBI GRCr8 mRatBN7.2 16 7,578,343 - 7,604,385 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 7,578,367 - 7,604,386 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 7,590,801 - 7,616,842 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 8,735,662 - 8,761,703 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 7,589,114 - 7,615,255 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 8,497,495 - 8,523,552 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 8,497,569 - 8,523,557 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 8,415,706 - 8,439,690 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 7,837,198 - 7,859,438 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 7,833,526 - 7,858,972 (+) NCBI Celera 16 7,595,930 - 7,618,394 (-) NCBI Celera Cytogenetic Map 16 p16 NCBI
Ogdhl Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955556 566,671 - 589,236 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955556 566,735 - 589,178 (+) NCBI ChiLan1.0 ChiLan1.0
OGDHL Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 62,006,485 - 62,035,055 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 62,011,805 - 62,040,373 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 44,476,006 - 44,504,578 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3
OGDHL Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 1,573,653 - 1,600,264 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 1,573,793 - 1,596,285 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 1,808,847 - 1,835,446 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 1,751,094 - 1,777,697 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 1,751,095 - 1,944,541 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 1,548,295 - 1,574,894 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 1,585,699 - 1,612,290 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 1,717,299 - 1,743,900 (-) NCBI UU_Cfam_GSD_1.0
Ogdhl
OGDHL Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 90,207,442 - 90,236,369 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 90,207,439 - 90,235,500 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 98,115,771 - 98,143,943 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
OGDHL Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 42,070,452 - 42,099,565 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 42,074,064 - 42,099,706 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 1,814,865 - 1,844,890 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ogdhl
.
Predicted Target Of
Count of predictions: 157 Count of miRNA genes: 146 Interacting mature miRNAs: 154 Transcripts: ENSMUST00000022480 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1357589 Kdnw2_m kidney weight 2 (mouse) Not determined 14 20887473 121269804 Mouse 27226748 Femd8_m femur midshaft diameter 8, 10 week (mouse) 14 13769273 46737457 Mouse 1357527 Epfpq1_m epididymal fat percentage QTL 1 (mouse) Not determined 14 21062450 71885801 Mouse 27226744 Metcl6_m metatarsal-calcaneal length 6, 5 week (mouse) 14 30321957 52937457 Mouse 27226775 Tibl7_m tibia length 7, 5 week (mouse) 14 30321957 48837457 Mouse 27226774 Tibl15_m tibia length 15, 10 week (mouse) 14 30321957 87937436 Mouse 4142485 Modor2_m modifier of ocular retardation 2 (mouse) Not determined 14 24926248 58179769 Mouse 1301372 Sluc13_m susceptibility to lung cancer 13 (mouse) Not determined 14 18827604 52827726 Mouse 4141550 Dbm3_m diabetes modifier 3 (mouse) Not determined 5143473 39143596 Mouse 1300544 Hypn_m hyperinsulinemia (mouse) Not determined 14 15160616 49160765 Mouse 1301991 Wta3_m weight adult 3 (mouse) Not determined 14 3887473 37887650 Mouse 1300998 Cia17_m collagen induced arthritis 17 (mouse) Not determined 14 30335250 64335381 Mouse 4141864 Mrdq4_m modifier of retinal degeneration QTL 4 (mouse) Not determined 9923245 48765082 Mouse 10043886 Cia49_m collagen induced arthritis QTL 49 (mouse) Not determined 14 29996994 63997133 Mouse 1300779 Dyscalc4_m dystrophic cardiac calcinosis 4 (mouse) Not determined 14 12212871 46213007 Mouse 14746973 Manh76_m mandible shape 76 (mouse) 14 22287217 56287217 Mouse 1300909 Ath13_m atherosclerosis 13 (mouse) Not determined 14 30335250 64335381 Mouse 27226752 Femd4_m femur midshaft diameter 4, 5 week (mouse) 14 13769273 47237457 Mouse 13506929 Recrq10_m recombination rate in male meiosis QTL 10 (mouse) 14 27921957 61137449 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000022480 ⟹ ENSMUSP00000022480
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 32,043,976 - 32,069,777 (+) Ensembl GRCm38.p6 Ensembl 14 32,322,019 - 32,347,820 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000228286
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 32,047,349 - 32,049,927 (+) Ensembl GRCm38.p6 Ensembl 14 32,325,392 - 32,327,970 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000228529 ⟹ ENSMUSP00000154185
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 32,043,976 - 32,070,108 (+) Ensembl GRCm38.p6 Ensembl 14 32,322,019 - 32,348,151 (+) Ensembl
RefSeq Acc Id:
NM_001081130 ⟹ NP_001074599
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 14 32,043,976 - 32,070,108 (+) NCBI GRCm38 14 32,322,019 - 32,348,151 (+) NCBI MGSCv37 14 33,135,205 - 33,161,006 (+) RGD Celera 14 28,579,005 - 28,605,091 (+) RGD cM Map 14 ENTREZGENE
Sequence:
GACCTAGGTAATTGATACAGCGCGCTGCTCGTGACCCTCCGCTCAGTCCCCGGACCTTCAGCCCCCCGGACCGCGTGGCCCGGAACCTCGGCCAGCCGACTTGCCACAGGTCACCTCAGGAAATCACC
hide sequence
RefSeq Acc Id:
XM_030247786 ⟹ XP_030103646
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 14 32,043,941 - 32,066,935 (+) NCBI GRCm38 14 32,321,982 - 32,344,978 (+) NCBI
Sequence:
CCCGAGGGTGCGCGCTCACGGCGGCCGTGTCACGTGACCTAGGTAATTGATACAGCGCGCTGCT
hide sequence
RefSeq Acc Id:
NP_001074599 ⟸ NM_001081130
- UniProtKB:
B2RXT3 (UniProtKB/TrEMBL), E9Q7L0 (UniProtKB/TrEMBL)
- Sequence:
MSQLRLLPFRLGPRATKLLATRAIPVFSGCRRSSGPPTTIPRSRSGVSSSYVEEMYFAWLENPQSVHKSWDSFFQRASKEASVGPAQPQLPAVLQESRTSVSSCTKTSKLVEDHLAVQSLIRAYQIRG
hide sequence
RefSeq Acc Id:
XP_030103646 ⟸ XM_030247786
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSMUSP00000022480 ⟸ ENSMUST00000022480
Ensembl Acc Id:
ENSMUSP00000154185 ⟸ ENSMUST00000228529
RGD ID: 8681864 Promoter ID: EPDNEW_M18963 Type: initiation region Name: Ogdhl_1 Description: Mus musculus oxoglutarate dehydrogenase-like , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 14 32,322,015 - 32,322,075 EPDNEW
RGD ID: 6825234 Promoter ID: MM_KWN:16136 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, ES_Cell, Kidney Transcripts: NM_001081130 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 14 33,134,899 - 33,135,399 (+) MPROMDB
